Query         psy10064
Match_columns 257
No_of_seqs    154 out of 369
Neff          5.1 
Searched_HMMs 46136
Date          Fri Aug 16 16:57:37 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10064.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10064hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2990|consensus              100.0 1.7E-91 3.6E-96  634.5  14.0  250    1-250     1-260 (317)
  2 PF04502 DUF572:  Family of unk 100.0 8.9E-76 1.9E-80  547.2  15.7  212    1-231     1-214 (324)
  3 KOG2989|consensus              100.0   1E-50 2.2E-55  362.0   6.6  193    1-211     1-195 (253)
  4 COG5134 Uncharacterized conser 100.0   7E-41 1.5E-45  295.2  11.6  214    7-232     1-220 (272)
  5 PF05907 DUF866:  Eukaryotic pr  91.6     0.2 4.4E-06   43.1   3.6   63   47-112    25-90  (161)
  6 PF08271 TF_Zn_Ribbon:  TFIIB z  90.3    0.19 4.1E-06   33.7   1.8   25   88-113     1-25  (43)
  7 PF10122 Mu-like_Com:  Mu-like   87.6    0.48   1E-05   33.8   2.3   34   52-100     4-37  (51)
  8 PRK03681 hypA hydrogenase nick  81.2    0.68 1.5E-05   37.6   0.9   32   47-96     65-96  (114)
  9 COG4332 Uncharacterized protei  79.8     1.1 2.4E-05   39.8   1.8   41   51-98     16-60  (203)
 10 PRK12380 hydrogenase nickel in  79.4    0.96 2.1E-05   36.6   1.2   34   42-95     61-94  (113)
 11 smart00834 CxxC_CXXC_SSSS Puta  77.9     2.8 6.1E-05   27.0   2.9   20   82-103     2-21  (41)
 12 COG4416 Com Mu-like prophage p  77.8       1 2.3E-05   32.6   0.8   40   52-109     4-46  (60)
 13 PF13240 zinc_ribbon_2:  zinc-r  77.7     1.1 2.3E-05   26.7   0.7   15   54-68      1-15  (23)
 14 PRK00564 hypA hydrogenase nick  77.1     1.2 2.7E-05   36.2   1.2   35   43-96     63-97  (117)
 15 COG0375 HybF Zn finger protein  74.0       3 6.5E-05   34.4   2.7   29   48-95     66-94  (115)
 16 KOG2990|consensus               72.1     1.8   4E-05   40.8   1.2   14    5-18     74-87  (317)
 17 PF11331 DUF3133:  Protein of u  69.8     3.8 8.3E-05   28.6   2.1   41   49-100     4-44  (46)
 18 TIGR00100 hypA hydrogenase nic  69.7     2.5 5.5E-05   34.2   1.4   35   42-96     61-95  (115)
 19 COG2888 Predicted Zn-ribbon RN  68.9       5 0.00011   29.6   2.6   32   52-100     9-40  (61)
 20 PF09723 Zn-ribbon_8:  Zinc rib  67.9     5.5 0.00012   26.7   2.5   20   82-103     2-21  (42)
 21 COG1996 RPC10 DNA-directed RNA  65.4     6.7 0.00014   27.7   2.6   19   87-105    24-42  (49)
 22 KOG2272|consensus               65.3     2.7 5.9E-05   39.3   0.8   22   78-99    154-175 (332)
 23 TIGR02605 CxxC_CxxC_SSSS putat  63.7     6.1 0.00013   27.0   2.1   18   82-101     2-19  (52)
 24 PF07754 DUF1610:  Domain of un  62.7     6.3 0.00014   23.9   1.8   10   55-64      1-10  (24)
 25 PRK03824 hypA hydrogenase nick  61.1       6 0.00013   33.0   2.0   45   48-96     66-116 (135)
 26 PF06107 DUF951:  Bacterial pro  60.4     6.1 0.00013   28.8   1.7   33   25-63     10-42  (57)
 27 PRK14890 putative Zn-ribbon RN  60.3     9.4  0.0002   28.0   2.7   17   48-64      3-19  (59)
 28 PRK00762 hypA hydrogenase nick  59.3     5.1 0.00011   32.9   1.3   18   42-61     61-78  (124)
 29 PF10263 SprT-like:  SprT-like   58.1     9.2  0.0002   31.5   2.7   34   51-99    122-155 (157)
 30 PRK04351 hypothetical protein;  55.9      12 0.00026   31.9   3.0   37   49-100   109-145 (149)
 31 PF10058 DUF2296:  Predicted in  52.6      12 0.00027   26.6   2.2   34   49-95     19-52  (54)
 32 KOG3368|consensus               52.4      17 0.00036   30.9   3.3   32   77-108    62-93  (140)
 33 PF01921 tRNA-synt_1f:  tRNA sy  51.4     9.1  0.0002   37.2   1.8   41   49-100   171-212 (360)
 34 PF13719 zinc_ribbon_5:  zinc-r  51.1      19 0.00042   23.4   2.8   36   51-98      1-36  (37)
 35 KOG2407|consensus               50.7     5.7 0.00012   40.4   0.3   15   46-60    492-506 (575)
 36 PF13717 zinc_ribbon_4:  zinc-r  50.2      20 0.00042   23.3   2.7   35   51-97      1-35  (36)
 37 KOG3794|consensus               49.9     9.7 0.00021   37.6   1.7   14    5-18     66-81  (453)
 38 PRK00398 rpoP DNA-directed RNA  49.8      14 0.00031   24.8   2.1   18   87-104    21-38  (46)
 39 PF05876 Terminase_GpA:  Phage   49.4     9.3  0.0002   38.9   1.6   36   77-112   190-234 (557)
 40 PF07255 Benyvirus_14KDa:  Beny  49.1      14  0.0003   30.2   2.2   73   44-121    25-99  (123)
 41 COG1405 SUA7 Transcription ini  48.9     8.9 0.00019   36.0   1.3   28   88-116     2-30  (285)
 42 COG2956 Predicted N-acetylgluc  48.6      11 0.00024   36.7   1.8   20   82-101   363-382 (389)
 43 PF01155 HypA:  Hydrogenase exp  47.8     8.1 0.00018   31.1   0.7   18   43-61     62-79  (113)
 44 smart00731 SprT SprT homologue  47.3      22 0.00047   29.5   3.3   36   50-99    110-145 (146)
 45 smart00132 LIM Zinc-binding do  46.9      13 0.00029   22.8   1.5   36   54-98      1-38  (39)
 46 COG3091 SprT Zn-dependent meta  46.1      17 0.00036   31.6   2.4   41   51-103   116-156 (156)
 47 PF05876 Terminase_GpA:  Phage   46.0      14 0.00031   37.5   2.3   39   51-98    199-240 (557)
 48 PF13248 zf-ribbon_3:  zinc-rib  42.5      12 0.00026   22.5   0.7   16   52-67      2-17  (26)
 49 PF13005 zf-IS66:  zinc-finger   42.3      35 0.00076   22.6   3.1   41   54-94      4-47  (47)
 50 PF06750 DiS_P_DiS:  Bacterial   42.2     4.3 9.4E-05   31.8  -1.6   34   53-99     34-70  (92)
 51 PRK04016 DNA-directed RNA poly  42.1      12 0.00026   27.7   0.8   15   50-64      2-16  (62)
 52 TIGR01206 lysW lysine biosynth  42.0      18 0.00039   25.9   1.7   15   88-102     3-17  (54)
 53 PF09855 DUF2082:  Nucleic-acid  41.3      28 0.00061   25.7   2.7   43   54-96      2-45  (64)
 54 COG2816 NPY1 NTP pyrophosphohy  40.3      18 0.00038   34.2   1.8   48   54-118   113-166 (279)
 55 PF01396 zf-C4_Topoisom:  Topoi  39.8      27 0.00059   23.0   2.2   17   89-105     3-19  (39)
 56 PF11931 DUF3449:  Domain of un  38.7      10 0.00022   33.9   0.0   30   53-82    102-137 (196)
 57 TIGR02098 MJ0042_CXXC MJ0042 f  38.0      17 0.00036   23.3   0.9   18   87-104     2-19  (38)
 58 COG4481 Uncharacterized protei  37.3      22 0.00048   25.9   1.5   24   42-65     24-47  (60)
 59 COG1644 RPB10 DNA-directed RNA  36.7      14 0.00031   27.4   0.5   14   50-63      2-15  (63)
 60 PF14255 Cys_rich_CPXG:  Cystei  36.6      29 0.00064   24.6   2.1   19   89-107     2-20  (52)
 61 PF06044 DRP:  Dam-replacing fa  36.6      17 0.00038   33.7   1.1   51   52-116    31-82  (254)
 62 COG2093 DNA-directed RNA polym  36.6      20 0.00043   26.8   1.2   20   89-108    20-47  (64)
 63 smart00659 RPOLCX RNA polymera  36.5      34 0.00074   23.3   2.3   18   87-104    19-36  (44)
 64 COG2051 RPS27A Ribosomal prote  36.5      38 0.00082   25.5   2.7   17   85-101    36-52  (67)
 65 PRK00750 lysK lysyl-tRNA synth  35.7      33 0.00073   34.5   3.1   27   49-75    172-199 (510)
 66 PF09082 DUF1922:  Domain of un  35.5      33 0.00071   25.9   2.3   30   53-101     4-33  (68)
 67 PRK11823 DNA repair protein Ra  34.3      26 0.00057   34.6   2.0   28   53-101     8-35  (446)
 68 TIGR00467 lysS_arch lysyl-tRNA  33.6      36 0.00077   34.6   2.9   24   49-72    165-188 (515)
 69 PF05129 Elf1:  Transcription e  33.6      40 0.00086   25.8   2.5   44   47-101    17-60  (81)
 70 PF04113 Gpi16:  Gpi16 subunit,  33.0     9.3  0.0002   39.2  -1.4   26   46-71    507-533 (564)
 71 KOG2846|consensus               32.6      20 0.00043   34.6   0.8   42   51-105   219-260 (328)
 72 PF02150 RNA_POL_M_15KD:  RNA p  32.1      47   0.001   21.5   2.3   16   90-105     4-19  (35)
 73 PRK14704 anaerobic ribonucleos  32.1      30 0.00066   35.9   2.2   38   40-105   548-585 (618)
 74 PF05864 Chordopox_RPO7:  Chord  32.0      23  0.0005   26.1   0.9   16   49-64      1-16  (63)
 75 cd00730 rubredoxin Rubredoxin;  31.7      22 0.00047   25.0   0.7   39   53-95      2-42  (50)
 76 PHA02998 RNA polymerase subuni  31.5      11 0.00024   33.6  -1.0   60   49-114   108-178 (195)
 77 PF01927 Mut7-C:  Mut7-C RNAse   31.4      38 0.00082   28.3   2.3   15   50-64     89-103 (147)
 78 PF11793 FANCL_C:  FANCL C-term  31.4      27 0.00059   25.8   1.2   16   87-102    55-70  (70)
 79 KOG1296|consensus               31.3      20 0.00043   31.0   0.6   61   49-112    27-90  (161)
 80 PRK08271 anaerobic ribonucleos  31.2      29 0.00062   36.1   1.8   34   40-95    555-588 (623)
 81 PRK00423 tfb transcription ini  30.4      26 0.00056   32.9   1.3   24   88-112    12-35  (310)
 82 PRK06260 threonine synthase; V  30.4      35 0.00075   32.9   2.1   35   51-104     2-36  (397)
 83 PF01194 RNA_pol_N:  RNA polyme  30.4      23 0.00049   26.1   0.7   13   51-63      3-15  (60)
 84 TIGR00416 sms DNA repair prote  30.2      31 0.00067   34.2   1.8   28   53-101     8-35  (454)
 85 cd02339 ZZ_Mind_bomb Zinc fing  30.0      28 0.00062   23.8   1.1   16   53-68      1-16  (45)
 86 PLN00032 DNA-directed RNA poly  29.8      25 0.00054   26.7   0.8   14   51-64      3-16  (71)
 87 PRK12496 hypothetical protein;  29.6      32 0.00069   29.6   1.6   11   89-99    145-155 (164)
 88 PF13597 NRDD:  Anaerobic ribon  29.6      48   0.001   33.7   3.1   33   41-96    481-513 (546)
 89 cd02338 ZZ_PCMF_like Zinc fing  29.6      25 0.00054   24.3   0.7    7   53-59      1-7   (49)
 90 cd00674 LysRS_core_class_I cat  29.6      48   0.001   32.0   2.9   11   49-59    166-176 (353)
 91 COG5134 Uncharacterized conser  29.5      20 0.00043   33.0   0.3   19   77-98     35-53  (272)
 92 PRK07111 anaerobic ribonucleos  29.1      37 0.00079   36.0   2.2   33   40-95    669-701 (735)
 93 KOG2636|consensus               29.0      17 0.00036   36.6  -0.3   31   52-82    401-437 (497)
 94 smart00661 RPOL9 RNA polymeras  28.8      32 0.00069   23.1   1.2   11   54-64      2-12  (52)
 95 PRK00464 nrdR transcriptional   28.5      43 0.00094   28.7   2.2   55   53-116     1-58  (154)
 96 cd01121 Sms Sms (bacterial rad  27.6      42  0.0009   32.5   2.2   17   86-102    13-29  (372)
 97 PHA03082 DNA-dependent RNA pol  27.2      31 0.00067   25.4   0.9   16   49-64      1-16  (63)
 98 PF13790 DUF4182:  Domain of un  27.1      81  0.0018   21.2   2.8   30   52-94      3-32  (38)
 99 PF04606 Ogr_Delta:  Ogr/Delta-  26.6      38 0.00082   23.1   1.2   19   89-107     1-19  (47)
100 PF00569 ZZ:  Zinc finger, ZZ t  26.5      35 0.00076   23.1   1.0   19   51-69      3-21  (46)
101 PF14353 CpXC:  CpXC protein     26.1      38 0.00082   27.3   1.3   40   53-99      2-50  (128)
102 KOG4253|consensus               26.0 2.7E+02  0.0059   24.5   6.6   53  151-203    39-92  (175)
103 PRK11788 tetratricopeptide rep  25.7      45 0.00098   30.5   1.9   14   86-99    367-380 (389)
104 PRK05978 hypothetical protein;  25.6      25 0.00054   30.1   0.2   33   51-100    32-65  (148)
105 PF02146 SIR2:  Sir2 family;  I  25.4      29 0.00062   29.5   0.5   12   51-62    104-115 (178)
106 PF04828 GFA:  Glutathione-depe  25.2      95  0.0021   22.5   3.3   39   74-114    35-74  (92)
107 PF05973 Gp49:  Phage derived p  25.1 1.1E+02  0.0023   23.0   3.6   41   78-119    35-76  (91)
108 PF00645 zf-PARP:  Poly(ADP-rib  25.1      34 0.00074   25.4   0.8   14   53-66      8-21  (82)
109 PRK03954 ribonuclease P protei  24.7      77  0.0017   26.3   2.9   42   53-100    65-106 (121)
110 TIGR03844 cysteate_syn cysteat  24.7      58  0.0013   31.8   2.6   34   51-104     1-34  (398)
111 PRK04023 DNA polymerase II lar  24.5      38 0.00083   37.3   1.4   19   40-61    617-635 (1121)
112 COG0484 DnaJ DnaJ-class molecu  24.2 1.8E+02  0.0039   28.6   5.8   59   44-105   134-201 (371)
113 TIGR02487 NrdD anaerobic ribon  24.0      53  0.0012   33.7   2.2   35   40-96    513-547 (579)
114 cd02344 ZZ_HERC2 Zinc finger,   23.8      43 0.00094   23.1   1.1   15   53-67      1-15  (45)
115 COG0675 Transposase and inacti  23.5 1.1E+02  0.0024   27.3   4.0   12   49-60    306-317 (364)
116 COG5525 Bacteriophage tail ass  23.5      52  0.0011   34.2   2.0   60   51-116   226-285 (611)
117 PF04810 zf-Sec23_Sec24:  Sec23  23.2      86  0.0019   20.6   2.4   35   53-100     3-37  (40)
118 PRK07591 threonine synthase; V  23.2      54  0.0012   32.0   2.1   16   88-103    34-49  (421)
119 PF04690 YABBY:  YABBY protein;  23.0      50  0.0011   29.0   1.6   38   52-100    12-49  (170)
120 PF04899 MbeD_MobD:  MbeD/MobD   23.0 2.2E+02  0.0047   21.4   4.8   45  160-207    10-54  (70)
121 COG2023 RPR2 RNase P subunit R  23.0   1E+02  0.0022   25.2   3.2   46   46-100    47-95  (105)
122 PF03604 DNA_RNApol_7kD:  DNA d  22.7      33 0.00071   22.0   0.3   13   88-100    18-30  (32)
123 PRK00807 50S ribosomal protein  22.6      28 0.00062   24.5  -0.0   43   54-106     3-47  (52)
124 PRK08197 threonine synthase; V  21.6      65  0.0014   31.0   2.2   31   53-103     8-38  (394)
125 COG0846 SIR2 NAD-dependent pro  21.3      45 0.00099   30.7   1.0   17   50-66    120-136 (250)
126 PRK09678 DNA-binding transcrip  21.1      51  0.0011   25.0   1.1   17   88-104     2-18  (72)
127 KOG0006|consensus               21.1      93   0.002   30.4   3.1   49   44-112   126-175 (446)
128 PRK00420 hypothetical protein;  21.1      70  0.0015   26.2   2.0   33   51-101    22-54  (112)
129 smart00531 TFIIE Transcription  21.0      64  0.0014   26.9   1.8   43   50-103    97-139 (147)
130 cd02340 ZZ_NBR1_like Zinc fing  21.0      53  0.0011   22.1   1.0   15   53-68      1-15  (43)
131 TIGR00354 polC DNA polymerase,  20.8      54  0.0012   36.0   1.6   21   53-96    626-646 (1095)
132 PF09538 FYDLN_acid:  Protein o  20.8      51  0.0011   26.7   1.1   13   88-100    27-39  (108)
133 PRK05654 acetyl-CoA carboxylas  20.8      35 0.00075   32.2   0.2   33   52-100    27-59  (292)
134 PF08996 zf-DNA_Pol:  DNA Polym  20.6      72  0.0016   27.8   2.1   20   85-104    16-35  (188)
135 PRK08351 DNA-directed RNA poly  20.6      57  0.0012   24.0   1.2    8   89-96     17-24  (61)
136 PF01258 zf-dskA_traR:  Prokary  20.1      47   0.001   21.2   0.6   14   51-65      3-16  (36)

No 1  
>KOG2990|consensus
Probab=100.00  E-value=1.7e-91  Score=634.51  Aligned_cols=250  Identities=51%  Similarity=0.944  Sum_probs=241.4

Q ss_pred             CCcccCCCcccCCCCCCCCCCCccccCchhhHHHHhhhcCCeeEEEEeceeeeecCCCCccccccceeeeeccccccccc
Q psy10064          1 MGERKGTNKYYPPDYDPSVGGLNKFLGTHALRERARKLHMGIMIIRFELPYNIWCEGCNNHIGMGVRYNAEKKKVGMYYS   80 (257)
Q Consensus         1 M~ERK~~nkYyPPD~DP~k~~~nk~~~~h~l~~Ra~k~~~g~~~VRfe~Pf~i~C~~C~~~I~kG~rfNA~K~~vg~Y~s   80 (257)
                      |||||+.||||||||+|.++|+|+|||+||||.||||+++||+||||||||||||.+|.+||++||||||+|++||+||+
T Consensus         1 mgerkg~nkYyPPd~~p~~gsln~~~g~h~lrerarKi~~gilvIRFEMPynIWC~gC~nhIgmGvRyNAeKkkvGnYYt   80 (317)
T KOG2990|consen    1 MGERKGQNKYYPPDFNPKHGSLNKYHGTHALRERARKIDQGILVIRFEMPYNIWCDGCKNHIGMGVRYNAEKKKVGNYYT   80 (317)
T ss_pred             CcccccCCcccCCCCCcccCcccccccchhHHHHHHhhccceEEEEEecccchhhccHHHhhhccceechhhhhcccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeeEEEEEEcCCCCceeEEeeCCCCCCeeeccCceecccCCCcccCCcccccchHhhhcCCCCchhhcccccccchhhhH
Q psy10064         81 TPVYQFRMKCHLCDSHFEIKTDPGNLDYVIVSGARRQENRWNPLENEQIVPETKEVSRKLFDDPMYKLEHGTNDMSSSKS  160 (257)
Q Consensus        81 t~I~~F~~kC~~C~~~i~i~TDPkn~dYv~~~Ga~r~~e~~d~~~~~~~~~~~~e~~~~~~~d~m~~LE~~~~d~~~~~~  160 (257)
                      ||||+|.||||+|.|+|+|+|||+||+|||+|||+|++++||+.+++++.+.++++++++..|||++|||+..|.+..+.
T Consensus        81 Tpiw~FrmKchlC~n~i~iqTDP~NceYvI~SGaqRKeer~D~~d~Eq~~~t~~e~k~KLa~DamyrLEHqe~D~~k~k~  160 (317)
T KOG2990|consen   81 TPIWSFRMKCHLCDNYIVIQTDPKNCEYVITSGAQRKEERYDAEDAEQMEPTAEEEKGKLASDAMYRLEHQEVDLKKKKA  160 (317)
T ss_pred             CcccchhhcccccCCceeeecCCCCceEEEeccccccccccCchhhhhccchhhhhcccccccHHHHHHhHHHhHhhhhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhhhccChHHHHHHHHHHHHHHHHHHHHHHHhHHHHhhccCCCCCcCCCChhhHHhhhcccccCc----
Q psy10064        161 KASHLNKLLDRQESVWKNDFDANRVLRDSFRKKKKQLKALQDKDNALLSKSSLSLKLVPEHKNDIRLASLYKYQHV----  236 (257)
Q Consensus       161 ~~~~L~eL~~~~~~~~~ddy~~n~~LR~~fR~~kk~~~~~~~~d~al~~~~~l~i~Ll~e~eeD~~~A~~v~f~~~----  236 (257)
                      +.+.|..|++.++++|.|||.+|++||++||++||..+++++.|..|+++.+|+|.|||+|++|+..|.+|+|.+.    
T Consensus       161 aep~l~~l~e~~~~rw~Ddf~~ns~LRaqfR~~kK~~~e~~~~D~~l~~r~sl~I~lLPeTe~Dr~~A~llk~~~~~~ke  240 (317)
T KOG2990|consen  161 AEPVLVRLQEVNDARWADDFQANSRLRAQFREEKKLINEQEARDLDLFARASLDILLLPETEEDRKIASLLKFNTKKRKE  240 (317)
T ss_pred             cchHHHHHHHHHHHHhccchhhhHHHHHHHHHHHHHhhhhhhhhHHHHHhhhcCcccCCCchhhHHHHHHHhhcccchhh
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999872    


Q ss_pred             ------cccccccCCCCCCC
Q psy10064        237 ------KPKLNVKLKAPSSS  250 (257)
Q Consensus       237 ------~~~~~~~~~~~~~~  250 (257)
                            +..|+++|--++|.
T Consensus       241 dr~~~~r~~i~srp~~~~S~  260 (317)
T KOG2990|consen  241 DRENNRRLEIKSRPSRTGST  260 (317)
T ss_pred             hHHhhhhhhhccCCCCCCCc
Confidence                  46788886655544


No 2  
>PF04502 DUF572:  Family of unknown function (DUF572) ;  InterPro: IPR007590 This entry represents eukaryotic proteins with undetermined function belonging to the CWC16 family.
Probab=100.00  E-value=8.9e-76  Score=547.15  Aligned_cols=212  Identities=47%  Similarity=0.766  Sum_probs=192.9

Q ss_pred             CCcccCCCcccCCCCCCCCCCCccccCchhhHHHHhhhcCCeeEEEEeceeeeecCCCCccccccceeeeecccccc--c
Q psy10064          1 MGERKGTNKYYPPDYDPSVGGLNKFLGTHALRERARKLHMGIMIIRFELPYNIWCEGCNNHIGMGVRYNAEKKKVGM--Y   78 (257)
Q Consensus         1 M~ERK~~nkYyPPD~DP~k~~~nk~~~~h~l~~Ra~k~~~g~~~VRfe~Pf~i~C~~C~~~I~kG~rfNA~K~~vg~--Y   78 (257)
                      ||||||+||||||||||++         ||+++|++   +|+++|||||||+|||++|++|||+||||||+|++||+  |
T Consensus         1 M~ERK~~nkYyPPD~d~~k---------~~~~kr~k---~~~~~VRf~~Pf~i~C~~C~~~I~kG~rFNA~Ke~v~~E~Y   68 (324)
T PF04502_consen    1 MSERKVLNKYYPPDFDPSK---------HPLRKRAK---QGILTVRFMMPFNIWCNTCGEYIYKGVRFNARKEKVGNEKY   68 (324)
T ss_pred             CcccccCCCccCCCCCccc---------ccccccCc---CcceEEEEcCCccCcCCCCccccccceeeeeeeEecCCCcc
Confidence            9999999999999999665         67888877   79999999999999999999999999999999999987  9


Q ss_pred             cceeeEEEEEEcCCCCceeEEeeCCCCCCeeeccCceecccCCCcccCCcccccchHhhhcCCCCchhhcccccccchhh
Q psy10064         79 YSTPVYQFRMKCHLCDSHFEIKTDPGNLDYVIVSGARRQENRWNPLENEQIVPETKEVSRKLFDDPMYKLEHGTNDMSSS  158 (257)
Q Consensus        79 ~st~I~~F~~kC~~C~~~i~i~TDPkn~dYv~~~Ga~r~~e~~d~~~~~~~~~~~~e~~~~~~~d~m~~LE~~~~d~~~~  158 (257)
                      ||||||+||||||.|+++|+|+|||+|+||||++||+|+++.| ...++++...++++++++..|||++||+++.|++++
T Consensus        69 ls~~I~rF~~kC~~C~~~i~~kTDPkn~dY~~~~Ga~R~~~~~-~~~~~~~~~~~~~~~~~~~~d~m~~LE~~~~d~~~~  147 (324)
T PF04502_consen   69 LSTPIYRFYIKCPRCSNEIEFKTDPKNTDYVVESGARRNFEPD-KEEEEQEEREDKEEEEEEEEDPMKALEKRTEDSKRE  147 (324)
T ss_pred             ccceEEEEEEEcCCCCCEEeeecCCCCCCeeeecCeeecCCcc-hhhhhhhhhhhHHHhhhccCCchHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999966554 444555555556666677899999999999999999


Q ss_pred             hHHHHHHHHHHHHHhhhccChHHHHHHHHHHHHHHHHHHHHHHHhHHHHhhccCCCCCcCCCChhhHHhhhcc
Q psy10064        159 KSKASHLNKLLDRQESVWKNDFDANRVLRDSFRKKKKQLKALQDKDNALLSKSSLSLKLVPEHKNDIRLASLY  231 (257)
Q Consensus       159 ~~~~~~L~eL~~~~~~~~~ddy~~n~~LR~~fR~~kk~~~~~~~~d~al~~~~~l~i~Ll~e~eeD~~~A~~v  231 (257)
                      +++.++|++|+++|.+  .|+|+.|++||+.||.++++++.+++.|+++.++++|.    |++++|..+|..-
T Consensus       148 ~~~~~~LeeL~~~~~r--~d~~~~n~~Lr~~~r~~~k~~~~~~~~d~~~~~~~~~~----~~~~~~~r~~~~~  214 (324)
T PF04502_consen  148 MEALERLEELQELNAR--KDDYDANQMLRKRFREEKKERERQEEEDEALKKKISLG----PESEEDKRLAADE  214 (324)
T ss_pred             HHHHHHHHHHHHHHhc--cCchhhHHHHHHHHHHHHHHHHHhHHHHHHHHHhhccC----cchhhhhhhhcch
Confidence            9999999999999997  89999999999999999999999999999998888775    8888888887774


No 3  
>KOG2989|consensus
Probab=100.00  E-value=1e-50  Score=361.97  Aligned_cols=193  Identities=30%  Similarity=0.456  Sum_probs=161.7

Q ss_pred             CCcccCCCcccCCCCCCCCCCCccccCchhhHHHHhhhcCCeeEEEEeceeeeecCCCCccccccceeeeecccc-c-cc
Q psy10064          1 MGERKGTNKYYPPDYDPSVGGLNKFLGTHALRERARKLHMGIMIIRFELPYNIWCEGCNNHIGMGVRYNAEKKKV-G-MY   78 (257)
Q Consensus         1 M~ERK~~nkYyPPD~DP~k~~~nk~~~~h~l~~Ra~k~~~g~~~VRfe~Pf~i~C~~C~~~I~kG~rfNA~K~~v-g-~Y   78 (257)
                      |+||||+|+||||||||++++            |++.....++.||+|+||+|+|++||+|||+|++||++++.| | .|
T Consensus         1 m~Erk~lnkyyppdfDP~ki~------------r~k~~k~~q~~~Rlm~Pf~~rC~tCgeyi~kg~kfN~r~E~~~~e~y   68 (253)
T KOG2989|consen    1 MSERKVLNKYYPPDFDPKKIP------------RAKEPKNRQLKIRLMTPFRLRCNTCGEYIYKGKKFNAREEDVIEETY   68 (253)
T ss_pred             CcccccccccCCCCCChhhhh------------hhhccchhhcceeecccceeecccccchhhcCCCcchhHHhhhcccc
Confidence            999999999999999999974            333334456899999999999999999999999999999988 5 69


Q ss_pred             cceeeEEEEEEcCCCCceeEEeeCCCCCCeeeccCceecccCCCcccCCcccccchHhhhcCCCCchhhcccccccchhh
Q psy10064         79 YSTPVYQFRMKCHLCDSHFEIKTDPGNLDYVIVSGARRQENRWNPLENEQIVPETKEVSRKLFDDPMYKLEHGTNDMSSS  158 (257)
Q Consensus        79 ~st~I~~F~~kC~~C~~~i~i~TDPkn~dYv~~~Ga~r~~e~~d~~~~~~~~~~~~e~~~~~~~d~m~~LE~~~~d~~~~  158 (257)
                      |||+||+|||+|+.|+++|+|+|||+|+|||+++||+|+++.|...+.+.-..  .++  ....|+|..||+++.+++.+
T Consensus        69 Lgiki~Rf~i~Ct~cl~el~~rTDp~N~dY~~E~Ga~r~y~~~~~~eeek~k~--~~~--~d~~d~m~~lekrt~~S~~e  144 (253)
T KOG2989|consen   69 LGIKIFRFYIKCTRCLRELSFRTDPKNSDYVIESGATRNYEPIEEEEEEKRKF--EEE--EDMKDEIKRLEKRTFQSKDE  144 (253)
T ss_pred             ccceeeeeeeeccchHhhhhhhcCCcchHHHHHhcchhcccccchhHHHHHHH--Hhh--hhhhhHHHHHHHHhhhhhhH
Confidence            99999999999999999999999999999999999999998876544322111  111  33479999999999999999


Q ss_pred             hHHHHHHHHHHHHHhhhccChHHHHHHHHHHHHHHHHHHHHHHHhHHHHhhcc
Q psy10064        159 KSKASHLNKLLDRQESVWKNDFDANRVLRDSFRKKKKQLKALQDKDNALLSKS  211 (257)
Q Consensus       159 ~~~~~~L~eL~~~~~~~~~ddy~~n~~LR~~fR~~kk~~~~~~~~d~al~~~~  211 (257)
                      +.....|++|...+.+....|+..  .|....+..++..++.++++++|.+..
T Consensus       145 ~~~~~~ldel~~~k~r~~~id~~~--~l~~~~~~~~k~~~~~eee~~~liks~  195 (253)
T KOG2989|consen  145 EIIRRALDELKVLKERPAPIDLVS--ELLATNERPRKYAKRKEEEKKVLIKSI  195 (253)
T ss_pred             HHHHHHHHHHHHHhcccCcccHHH--HHHHHhhhhHHHHHHHHHHHHHHHHHH
Confidence            999999999999998877777654  466666667777777777777776544


No 4  
>COG5134 Uncharacterized conserved protein [Function unknown]
Probab=100.00  E-value=7e-41  Score=295.19  Aligned_cols=214  Identities=31%  Similarity=0.568  Sum_probs=165.7

Q ss_pred             CCcccCCCCCCCCCCCccccCchhh-HHHHhhhc---CCeeEEEEeceeeeecCCCCccccccceeeeeccccc--cccc
Q psy10064          7 TNKYYPPDYDPSVGGLNKFLGTHAL-RERARKLH---MGIMIIRFELPYNIWCEGCNNHIGMGVRYNAEKKKVG--MYYS   80 (257)
Q Consensus         7 ~nkYyPPD~DP~k~~~nk~~~~h~l-~~Ra~k~~---~g~~~VRfe~Pf~i~C~~C~~~I~kG~rfNA~K~~vg--~Y~s   80 (257)
                      .|+|||||+.|--.-        || +.++.|++   ..-+.||+|.||+|+|+.|++||++|+||||.|+-++  .|||
T Consensus         1 ~~ky~pp~~NrvlAq--------pL~~~~~~KlK~arprglSiRL~TPF~~RCL~C~~YI~K~~rfNavkE~~~dK~y~~   72 (272)
T COG5134           1 MGKYIPPEGNRVLAQ--------PLAKRKFDKLKNARPRGLSIRLETPFPVRCLNCENYIQKGTRFNAVKEEIGDKSYYT   72 (272)
T ss_pred             CCCCcCCCCchhhcc--------hhHHHHHHHhcccCcccceEEeccCcceeecchhhhhhcccchhHHHHHhcccccce
Confidence            489999999986421        12 33444543   3348999999999999999999999999999999996  4889


Q ss_pred             eeeEEEEEEcCCCCceeEEeeCCCCCCeeeccCceecccCCCcccCCcccccchHhhhcCCCCchhhcccccccchhhhH
Q psy10064         81 TPVYQFRMKCHLCDSHFEIKTDPGNLDYVIVSGARRQENRWNPLENEQIVPETKEVSRKLFDDPMYKLEHGTNDMSSSKS  160 (257)
Q Consensus        81 t~I~~F~~kC~~C~~~i~i~TDPkn~dYv~~~Ga~r~~e~~d~~~~~~~~~~~~e~~~~~~~d~m~~LE~~~~d~~~~~~  160 (257)
                      |.||||+|+||.|++.|.|+|||+|++||+++|++|+.+.-++.+++..  .+ ..+.--..|....+|+...+......
T Consensus        73 ~kiYRf~I~C~~C~n~i~~RTDPkN~~YV~EsGg~R~i~pq~~n~D~~k--~~-~Ve~~~Esd~~~~~eK~~~Q~~~~~~  149 (272)
T COG5134          73 TKIYRFSIKCHLCSNPIDVRTDPKNTEYVVESGGRRKIEPQDINEDPAK--AE-NVEKVPESDAIEALEKQLTQQKSEKH  149 (272)
T ss_pred             eEEEEEEEEccCCCCceeeecCCCCceEEEecCceeecCccccccChhh--hh-hhhcCchhHHHHHHHHHHHHhhcccc
Confidence            9999999999999999999999999999999999998765544332211  00 00111124556677777666555555


Q ss_pred             HHHHHHHHHHHHhhhccChHHHHHHHHHHHHHHHHHHHHHHHhHHHHhhccCCCCCcCCCChhhHHhhhccc
Q psy10064        161 KASHLNKLLDRQESVWKNDFDANRVLRDSFRKKKKQLKALQDKDNALLSKSSLSLKLVPEHKNDIRLASLYK  232 (257)
Q Consensus       161 ~~~~L~eL~~~~~~~~~ddy~~n~~LR~~fR~~kk~~~~~~~~d~al~~~~~l~i~Ll~e~eeD~~~A~~v~  232 (257)
                      ...++..+-.++.+.|.++|...+.+|.+||+.|+-+..|++++-.+..+..++++++|.+- |...|.+++
T Consensus       150 ~ssA~n~~D~L~Krl~~~~~~~~~~~~~~~~~~k~~e~~q~a~~~~~~~~a~~~~~i~~~~~-d~~~~~~~~  220 (272)
T COG5134         150 NSSAINFIDELNKRLWSDPFVSSQRLRKQFRERKKIEKKQEAKDLSLKNRAALDIDILPSSS-DKDKALLLL  220 (272)
T ss_pred             hhhhhhHHHHHHHHhhcCchhhhHHHHHHHHHHhhhHHHHHHHHhhhhhhhhhhhccCCccc-hhhHHHHhh
Confidence            55556666667788999999999999999999999998999999999999999999998654 444454444


No 5  
>PF05907 DUF866:  Eukaryotic protein of unknown function (DUF866);  InterPro: IPR008584 This family consists of a number of hypothetical eukaryotic proteins of unknown function with an average length of around 165 residues.; PDB: 1ZSO_B.
Probab=91.58  E-value=0.2  Score=43.12  Aligned_cols=63  Identities=29%  Similarity=0.490  Sum_probs=35.6

Q ss_pred             EeceeeeecCCCCccccccceeeee-cccc-ccccceeeEEEEEEcCCCCceeEEeeCCC-CCCeeecc
Q psy10064         47 FELPYNIWCEGCNNHIGMGVRYNAE-KKKV-GMYYSTPVYQFRMKCHLCDSHFEIKTDPG-NLDYVIVS  112 (257)
Q Consensus        47 fe~Pf~i~C~~C~~~I~kG~rfNA~-K~~v-g~Y~st~I~~F~~kC~~C~~~i~i~TDPk-n~dYv~~~  112 (257)
                      |.-.|.|.|..|++--.+.+-+|.. +..+ |   |---=.|.+||..|..+.+|.--|. ...|..+.
T Consensus        25 ~~~~fkvkCt~CgE~~~k~V~i~~~e~~e~~g---srG~aNfv~KCk~C~re~si~i~~~~~~~~~~e~   90 (161)
T PF05907_consen   25 FEWFFKVKCTSCGEVHPKWVYINRFEKHEIPG---SRGTANFVMKCKFCKRESSIDIIPGKGKPYTAED   90 (161)
T ss_dssp             --EEEEEEETTSS--EEEEEEE-TT-BEE-TT---SS-EESEEE--SSSS--EEEEEE--TTTEEEGGG
T ss_pred             CEEEEEEEECCCCCccCcceEeecceEEecCC---CccceEeEecCcCcCCccEEEEEecCcccccccc
Confidence            4577999999999988888888854 3334 3   1112379999999999888855443 45666653


No 6  
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=90.29  E-value=0.19  Score=33.74  Aligned_cols=25  Identities=36%  Similarity=0.468  Sum_probs=22.3

Q ss_pred             EEcCCCCceeEEeeCCCCCCeeeccC
Q psy10064         88 MKCHLCDSHFEIKTDPGNLDYVIVSG  113 (257)
Q Consensus        88 ~kC~~C~~~i~i~TDPkn~dYv~~~G  113 (257)
                      |+||.|++.- |-+|+.++++|+..=
T Consensus         1 m~Cp~Cg~~~-~~~D~~~g~~vC~~C   25 (43)
T PF08271_consen    1 MKCPNCGSKE-IVFDPERGELVCPNC   25 (43)
T ss_dssp             ESBTTTSSSE-EEEETTTTEEEETTT
T ss_pred             CCCcCCcCCc-eEEcCCCCeEECCCC
Confidence            7899999987 899999999998873


No 7  
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=87.56  E-value=0.48  Score=33.76  Aligned_cols=34  Identities=24%  Similarity=0.632  Sum_probs=25.7

Q ss_pred             eeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEEe
Q psy10064         52 NIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIK  100 (257)
Q Consensus        52 ~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~  100 (257)
                      .|+|.+|+..++++          |.|-     ...||||.|..--.++
T Consensus         4 eiRC~~CnklLa~~----------g~~~-----~leIKCpRC~tiN~~~   37 (51)
T PF10122_consen    4 EIRCGHCNKLLAKA----------GEVI-----ELEIKCPRCKTINHVR   37 (51)
T ss_pred             ceeccchhHHHhhh----------cCcc-----EEEEECCCCCccceEe
Confidence            58999999999984          2222     4579999998766554


No 8  
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=81.22  E-value=0.68  Score=37.57  Aligned_cols=32  Identities=22%  Similarity=0.544  Sum_probs=22.2

Q ss_pred             EeceeeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCce
Q psy10064         47 FELPYNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSH   96 (257)
Q Consensus        47 fe~Pf~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~   96 (257)
                      -..|-..||..|+.+...                 +-+ |++.||.|++.
T Consensus        65 ~~~p~~~~C~~Cg~~~~~-----------------~~~-~~~~CP~Cgs~   96 (114)
T PRK03681         65 EEQEAECWCETCQQYVTL-----------------LTQ-RVRRCPQCHGD   96 (114)
T ss_pred             EeeCcEEEcccCCCeeec-----------------CCc-cCCcCcCcCCC
Confidence            478999999999963322                 111 33679999874


No 9  
>COG4332 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=79.83  E-value=1.1  Score=39.84  Aligned_cols=41  Identities=27%  Similarity=0.536  Sum_probs=30.2

Q ss_pred             eeeecCCCCc---cccccc-eeeeeccccccccceeeEEEEEEcCCCCceeE
Q psy10064         51 YNIWCEGCNN---HIGMGV-RYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFE   98 (257)
Q Consensus        51 f~i~C~~C~~---~I~kG~-rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~   98 (257)
                      -...|++||-   ++.-|. |.||.++.+..++      -| ||+.|.+...
T Consensus        16 ~~k~C~~Cg~kr~f~cSg~fRvNAq~K~LDvWl------IY-kC~~Cd~tWN   60 (203)
T COG4332          16 PAKRCNSCGVKRAFTCSGKFRVNAQGKVLDVWL------IY-KCTHCDYTWN   60 (203)
T ss_pred             hhhhCcccCCcceeeecCcEEEcCCCcEEEEEE------EE-EeeccCCccc
Confidence            3467999986   777775 8899988887443      33 8999987543


No 10 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=79.36  E-value=0.96  Score=36.64  Aligned_cols=34  Identities=24%  Similarity=0.602  Sum_probs=23.2

Q ss_pred             eeEEEEeceeeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCc
Q psy10064         42 IMIIRFELPYNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDS   95 (257)
Q Consensus        42 ~~~VRfe~Pf~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~   95 (257)
                      .|.| -+.|-.+||..|+....-.                   .+.+.||.|++
T Consensus        61 ~L~I-~~vp~~~~C~~Cg~~~~~~-------------------~~~~~CP~Cgs   94 (113)
T PRK12380         61 DLHI-VYKPAQAWCWDCSQVVEIH-------------------QHDAQCPHCHG   94 (113)
T ss_pred             EEEE-EeeCcEEEcccCCCEEecC-------------------CcCccCcCCCC
Confidence            3444 4789999999998533221                   13456999987


No 11 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=77.88  E-value=2.8  Score=27.04  Aligned_cols=20  Identities=30%  Similarity=0.941  Sum_probs=13.6

Q ss_pred             eeEEEEEEcCCCCceeEEeeCC
Q psy10064         82 PVYQFRMKCHLCDSHFEIKTDP  103 (257)
Q Consensus        82 ~I~~F~~kC~~C~~~i~i~TDP  103 (257)
                      |+|.|  +|+.|+..+++...-
T Consensus         2 p~Y~y--~C~~Cg~~fe~~~~~   21 (41)
T smart00834        2 PIYEY--RCEDCGHTFEVLQKI   21 (41)
T ss_pred             CCEEE--EcCCCCCEEEEEEec
Confidence            56665  688888877766543


No 12 
>COG4416 Com Mu-like prophage protein Com [General function prediction only]
Probab=77.81  E-value=1  Score=32.63  Aligned_cols=40  Identities=30%  Similarity=0.621  Sum_probs=26.7

Q ss_pred             eeecCCCCccccccceeeeecccccc-ccceeeEEEEEEcCCCC--ceeEEeeCCCCCCee
Q psy10064         52 NIWCEGCNNHIGMGVRYNAEKKKVGM-YYSTPVYQFRMKCHLCD--SHFEIKTDPGNLDYV  109 (257)
Q Consensus        52 ~i~C~~C~~~I~kG~rfNA~K~~vg~-Y~st~I~~F~~kC~~C~--~~i~i~TDPkn~dYv  109 (257)
                      +|+|.+|+..+.+.         -|. ||       ..|||.|.  |+|.|+  -+.+.|+
T Consensus         4 tiRC~~CnKlLa~a---------~~~~yl-------e~KCPrCK~vN~~~~~--~e~~t~~   46 (60)
T COG4416           4 TIRCAKCNKLLAEA---------EGQAYL-------EKKCPRCKEVNEFYIK--EEATTQI   46 (60)
T ss_pred             eeehHHHhHHHHhc---------ccceee-------eecCCccceeeeeecc--cccchhh
Confidence            68999999888762         133 65       67999995  455554  3445554


No 13 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=77.71  E-value=1.1  Score=26.70  Aligned_cols=15  Identities=20%  Similarity=0.793  Sum_probs=11.1

Q ss_pred             ecCCCCcccccccee
Q psy10064         54 WCEGCNNHIGMGVRY   68 (257)
Q Consensus        54 ~C~~C~~~I~kG~rf   68 (257)
                      .|..||..|-.+.+|
T Consensus         1 ~Cp~CG~~~~~~~~f   15 (23)
T PF13240_consen    1 YCPNCGAEIEDDAKF   15 (23)
T ss_pred             CCcccCCCCCCcCcc
Confidence            377888888777665


No 14 
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=77.11  E-value=1.2  Score=36.21  Aligned_cols=35  Identities=17%  Similarity=0.345  Sum_probs=23.4

Q ss_pred             eEEEEeceeeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCce
Q psy10064         43 MIIRFELPYNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSH   96 (257)
Q Consensus        43 ~~VRfe~Pf~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~   96 (257)
                      |.| -+.|..++|..|+....-.                 -+ ++++||.|++.
T Consensus        63 L~I-e~vp~~~~C~~Cg~~~~~~-----------------~~-~~~~CP~Cgs~   97 (117)
T PRK00564         63 LDI-VDEKVELECKDCSHVFKPN-----------------AL-DYGVCEKCHSK   97 (117)
T ss_pred             EEE-EecCCEEEhhhCCCccccC-----------------Cc-cCCcCcCCCCC
Confidence            444 4689999999998543221                 11 33579999974


No 15 
>COG0375 HybF Zn finger protein HypA/HybF (possibly regulating hydrogenase expression) [General function prediction only]
Probab=73.97  E-value=3  Score=34.39  Aligned_cols=29  Identities=34%  Similarity=0.823  Sum_probs=22.0

Q ss_pred             eceeeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCc
Q psy10064         48 ELPYNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDS   95 (257)
Q Consensus        48 e~Pf~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~   95 (257)
                      ..|-..||..|                 +.++..-.|.|+  ||.|.+
T Consensus        66 ~~p~~~~C~~C-----------------~~~~~~e~~~~~--CP~C~s   94 (115)
T COG0375          66 EEPAECWCLDC-----------------GQEVELEELDYR--CPKCGS   94 (115)
T ss_pred             EeccEEEeccC-----------------CCeecchhheeE--CCCCCC
Confidence            46888999999                 344555677777  999985


No 16 
>KOG2990|consensus
Probab=72.06  E-value=1.8  Score=40.83  Aligned_cols=14  Identities=29%  Similarity=0.261  Sum_probs=11.1

Q ss_pred             cCCCcccCCCCCCC
Q psy10064          5 KGTNKYYPPDYDPS   18 (257)
Q Consensus         5 K~~nkYyPPD~DP~   18 (257)
                      |+.|+|++|+|.++
T Consensus        74 kvGnYYtTpiw~Fr   87 (317)
T KOG2990|consen   74 KVGNYYTTPIWSFR   87 (317)
T ss_pred             hccccccCcccchh
Confidence            67888899988754


No 17 
>PF11331 DUF3133:  Protein of unknown function (DUF3133);  InterPro: IPR021480  This eukaryotic family of proteins has no known function. 
Probab=69.82  E-value=3.8  Score=28.56  Aligned_cols=41  Identities=17%  Similarity=0.618  Sum_probs=25.9

Q ss_pred             ceeeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEEe
Q psy10064         49 LPYNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIK  100 (257)
Q Consensus        49 ~Pf~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~  100 (257)
                      .|| |.|.+|.+.+--=..|-..++.+          -.++|-.|+..|.|.
T Consensus         4 APF-v~C~~C~~lLqlP~~~~~~~k~~----------~klrCGaCs~vl~~s   44 (46)
T PF11331_consen    4 APF-VVCSSCFELLQLPAKFSLSKKNQ----------QKLRCGACSEVLSFS   44 (46)
T ss_pred             CCE-eECccHHHHHcCCCccCCCccce----------eEEeCCCCceeEEEe
Confidence            477 45999988544333332222222          257899999999875


No 18 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=69.73  E-value=2.5  Score=34.23  Aligned_cols=35  Identities=20%  Similarity=0.395  Sum_probs=23.6

Q ss_pred             eeEEEEeceeeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCce
Q psy10064         42 IMIIRFELPYNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSH   96 (257)
Q Consensus        42 ~~~VRfe~Pf~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~   96 (257)
                      .|.| =..|-..+|..|+....-.                   .+.+.||.|++.
T Consensus        61 ~L~I-~~~p~~~~C~~Cg~~~~~~-------------------~~~~~CP~Cgs~   95 (115)
T TIGR00100        61 KLNI-EDEPVECECEDCSEEVSPE-------------------IDLYRCPKCHGI   95 (115)
T ss_pred             EEEE-EeeCcEEEcccCCCEEecC-------------------CcCccCcCCcCC
Confidence            3444 3678899999998543321                   124789999874


No 19 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=68.85  E-value=5  Score=29.60  Aligned_cols=32  Identities=19%  Similarity=0.408  Sum_probs=23.2

Q ss_pred             eeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEEe
Q psy10064         52 NIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIK  100 (257)
Q Consensus        52 ~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~  100 (257)
                      ...|.+||..|.-|.++                 -.|.||+|+..+.++
T Consensus         9 ~~~CtSCg~~i~p~e~~-----------------v~F~CPnCGe~~I~R   40 (61)
T COG2888           9 PPVCTSCGREIAPGETA-----------------VKFPCPNCGEVEIYR   40 (61)
T ss_pred             CceeccCCCEeccCCce-----------------eEeeCCCCCceeeeh
Confidence            57899999988665432                 147899998776654


No 20 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=67.89  E-value=5.5  Score=26.66  Aligned_cols=20  Identities=30%  Similarity=0.972  Sum_probs=15.1

Q ss_pred             eeEEEEEEcCCCCceeEEeeCC
Q psy10064         82 PVYQFRMKCHLCDSHFEIKTDP  103 (257)
Q Consensus        82 ~I~~F~~kC~~C~~~i~i~TDP  103 (257)
                      |||.|  +|..|++.+++...-
T Consensus         2 P~Yey--~C~~Cg~~fe~~~~~   21 (42)
T PF09723_consen    2 PIYEY--RCEECGHEFEVLQSI   21 (42)
T ss_pred             CCEEE--EeCCCCCEEEEEEEc
Confidence            67765  599999999887643


No 21 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=65.42  E-value=6.7  Score=27.75  Aligned_cols=19  Identities=26%  Similarity=0.656  Sum_probs=16.0

Q ss_pred             EEEcCCCCceeEEeeCCCC
Q psy10064         87 RMKCHLCDSHFEIKTDPGN  105 (257)
Q Consensus        87 ~~kC~~C~~~i~i~TDPkn  105 (257)
                      .++|+.|+..|-|+-=|..
T Consensus        24 ~irCp~Cg~rIl~K~R~~~   42 (49)
T COG1996          24 GIRCPYCGSRILVKERPKV   42 (49)
T ss_pred             ceeCCCCCcEEEEeccCCc
Confidence            3799999999999977654


No 22 
>KOG2272|consensus
Probab=65.26  E-value=2.7  Score=39.33  Aligned_cols=22  Identities=18%  Similarity=0.612  Sum_probs=17.9

Q ss_pred             ccceeeEEEEEEcCCCCceeEE
Q psy10064         78 YYSTPVYQFRMKCHLCDSHFEI   99 (257)
Q Consensus        78 Y~st~I~~F~~kC~~C~~~i~i   99 (257)
                      |-+-|-.-++|+|+.|+++++-
T Consensus       154 fr~d~yH~yHFkCt~C~keL~s  175 (332)
T KOG2272|consen  154 FRGDPYHPYHFKCTTCGKELTS  175 (332)
T ss_pred             ccCCCCCccceecccccccccc
Confidence            5567778899999999998753


No 23 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=63.66  E-value=6.1  Score=27.04  Aligned_cols=18  Identities=33%  Similarity=1.139  Sum_probs=13.0

Q ss_pred             eeEEEEEEcCCCCceeEEee
Q psy10064         82 PVYQFRMKCHLCDSHFEIKT  101 (257)
Q Consensus        82 ~I~~F~~kC~~C~~~i~i~T  101 (257)
                      |||.|  +|..|+..+++..
T Consensus         2 P~Yey--~C~~Cg~~fe~~~   19 (52)
T TIGR02605         2 PIYEY--RCTACGHRFEVLQ   19 (52)
T ss_pred             CCEEE--EeCCCCCEeEEEE
Confidence            66666  5888888777763


No 24 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=62.71  E-value=6.3  Score=23.93  Aligned_cols=10  Identities=30%  Similarity=0.833  Sum_probs=6.8

Q ss_pred             cCCCCccccc
Q psy10064         55 CEGCNNHIGM   64 (257)
Q Consensus        55 C~~C~~~I~k   64 (257)
                      |.+|+..|.-
T Consensus         1 C~sC~~~i~~   10 (24)
T PF07754_consen    1 CTSCGRPIAP   10 (24)
T ss_pred             CccCCCcccC
Confidence            7778776653


No 25 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=61.10  E-value=6  Score=32.99  Aligned_cols=45  Identities=22%  Similarity=0.400  Sum_probs=24.2

Q ss_pred             eceeeeecCCCCccccccceeeeeccccc----c--ccceeeEEEEEEcCCCCce
Q psy10064         48 ELPYNIWCEGCNNHIGMGVRYNAEKKKVG----M--YYSTPVYQFRMKCHLCDSH   96 (257)
Q Consensus        48 e~Pf~i~C~~C~~~I~kG~rfNA~K~~vg----~--Y~st~I~~F~~kC~~C~~~   96 (257)
                      ..|-..||..||....-.    ..++.++    .  -|.--...+.++||.|++.
T Consensus        66 ~~p~~~~C~~CG~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~CP~Cgs~  116 (135)
T PRK03824         66 EEEAVLKCRNCGNEWSLK----EVKESLDEEIREAIHFIPEVVHAFLKCPKCGSR  116 (135)
T ss_pred             ecceEEECCCCCCEEecc----cccccccccccccccccccccccCcCCcCCCCC
Confidence            568889999998432110    0122221    0  1111123466889999873


No 26 
>PF06107 DUF951:  Bacterial protein of unknown function (DUF951);  InterPro: IPR009296 This family consists of several short hypothetical bacterial proteins of unknown function.
Probab=60.44  E-value=6.1  Score=28.79  Aligned_cols=33  Identities=27%  Similarity=0.370  Sum_probs=24.8

Q ss_pred             ccCchhhHHHHhhhcCCeeEEEEeceeeeecCCCCcccc
Q psy10064         25 FLGTHALRERARKLHMGIMIIRFELPYNIWCEGCNNHIG   63 (257)
Q Consensus        25 ~~~~h~l~~Ra~k~~~g~~~VRfe~Pf~i~C~~C~~~I~   63 (257)
                      +...||=|.      +-=-++|+=|=|-+.|.+|+..|-
T Consensus        10 mKK~HPCG~------~~Wei~R~GaDikikC~gCg~~im   42 (57)
T PF06107_consen   10 MKKPHPCGS------NEWEIIRIGADIKIKCLGCGRQIM   42 (57)
T ss_pred             EcCCCCCCC------CEEEEEEccCcEEEEECCCCCEEE
Confidence            445676553      234699999999999999998764


No 27 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=60.31  E-value=9.4  Score=28.02  Aligned_cols=17  Identities=24%  Similarity=0.348  Sum_probs=12.4

Q ss_pred             eceeeeecCCCCccccc
Q psy10064         48 ELPYNIWCEGCNNHIGM   64 (257)
Q Consensus        48 e~Pf~i~C~~C~~~I~k   64 (257)
                      ++.-...|.+|+..|.-
T Consensus         3 ~~~~~~~CtSCg~~i~~   19 (59)
T PRK14890          3 EMMEPPKCTSCGIEIAP   19 (59)
T ss_pred             ccccCccccCCCCcccC
Confidence            44455689999998863


No 28 
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=59.27  E-value=5.1  Score=32.91  Aligned_cols=18  Identities=28%  Similarity=0.588  Sum_probs=13.5

Q ss_pred             eeEEEEeceeeeecCCCCcc
Q psy10064         42 IMIIRFELPYNIWCEGCNNH   61 (257)
Q Consensus        42 ~~~VRfe~Pf~i~C~~C~~~   61 (257)
                      .|.| -+.|-..|| .|+.+
T Consensus        61 ~L~I-~~vp~~~~C-~Cg~~   78 (124)
T PRK00762         61 DLIV-EMIPVEIEC-ECGYE   78 (124)
T ss_pred             EEEE-EecCeeEEe-eCcCc
Confidence            3444 478999999 99854


No 29 
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=58.10  E-value=9.2  Score=31.48  Aligned_cols=34  Identities=18%  Similarity=0.417  Sum_probs=22.2

Q ss_pred             eeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEE
Q psy10064         51 YNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEI   99 (257)
Q Consensus        51 f~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i   99 (257)
                      |...|..|+..+.+=.+.+..     .          ..|..|.+.|+.
T Consensus       122 ~~~~C~~C~~~~~r~~~~~~~-----~----------~~C~~C~~~l~~  155 (157)
T PF10263_consen  122 YVYRCPSCGREYKRHRRSKRK-----R----------YRCGRCGGPLVQ  155 (157)
T ss_pred             eEEEcCCCCCEeeeecccchh-----h----------EECCCCCCEEEE
Confidence            678899998776442222111     1          679999988875


No 30 
>PRK04351 hypothetical protein; Provisional
Probab=55.93  E-value=12  Score=31.89  Aligned_cols=37  Identities=22%  Similarity=0.458  Sum_probs=28.3

Q ss_pred             ceeeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEEe
Q psy10064         49 LPYNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIK  100 (257)
Q Consensus        49 ~Pf~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~  100 (257)
                      -.|.-.|..|+..+.+=.|+|-               -...|..|.+.+.+.
T Consensus       109 ~~y~Y~C~~Cg~~~~r~Rr~n~---------------~~yrCg~C~g~L~~~  145 (149)
T PRK04351        109 KNYLYECQSCGQQYLRKRRINT---------------KRYRCGKCRGKLKLI  145 (149)
T ss_pred             ceEEEECCCCCCEeeeeeecCC---------------CcEEeCCCCcEeeec
Confidence            4478899999987776666663               236799999999876


No 31 
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=52.59  E-value=12  Score=26.61  Aligned_cols=34  Identities=24%  Similarity=0.637  Sum_probs=22.5

Q ss_pred             ceeeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCc
Q psy10064         49 LPYNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDS   95 (257)
Q Consensus        49 ~Pf~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~   95 (257)
                      -.+.++|..|..|-|.--     ++.. .|       ..++|+.|+.
T Consensus        19 ~r~aLIC~~C~~hNGla~-----~~~~-~~-------i~y~C~~Cg~   52 (54)
T PF10058_consen   19 NRYALICSKCFSHNGLAP-----KEEF-EE-------IQYRCPYCGA   52 (54)
T ss_pred             CceeEECcccchhhcccc-----cccC-Cc-------eEEEcCCCCC
Confidence            457899999999877731     1111 11       2678999975


No 32 
>KOG3368|consensus
Probab=52.43  E-value=17  Score=30.95  Aligned_cols=32  Identities=22%  Similarity=0.328  Sum_probs=29.7

Q ss_pred             cccceeeEEEEEEcCCCCceeEEeeCCCCCCe
Q psy10064         77 MYYSTPVYQFRMKCHLCDSHFEIKTDPGNLDY  108 (257)
Q Consensus        77 ~Y~st~I~~F~~kC~~C~~~i~i~TDPkn~dY  108 (257)
                      .||+|.-|+.++-|+--+=+|++-|||+.+++
T Consensus        62 ~sy~Ts~YklhfyeTptglk~vl~Tdpk~~~i   93 (140)
T KOG3368|consen   62 LSYKTSKYKLHFYETPTGLKFVLNTDPKAGSI   93 (140)
T ss_pred             eEEeeceeEEEEEEcCCCcEEEEecCCCcccH
Confidence            48899999999999999999999999998775


No 33 
>PF01921 tRNA-synt_1f:  tRNA synthetases class I (K);  InterPro: IPR002904 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. Lysyl-tRNA synthetase (6.1.1.6 from EC) is an alpha 2 homodimer that belong to both class I and class II. In eubacteria and eukaryota lysyl-tRNA synthetases belong to class II in the same family as aspartyl tRNA synthetase. The class Ic lysyl-tRNA synthetase family is present in archaea and in a number of bacterial groups that include the alphaproteobacteria and spirochaetes[]. A refined crystal structures shows that the active site of LysU is shaped to position the substrates for the nucleophilic attack of the lysine carboxylate on the ATP alpha-phosphate. No residues are directly involved in catalysis, but a number of highly conserved amino acids and three metal ions coordinate the substrates and stabilise the pentavalent transition state. A loop close to the catalytic pocket, disordered in the lysine-bound structure, becomes ordered upon adenine binding [].; GO: 0000166 nucleotide binding, 0004824 lysine-tRNA ligase activity, 0005524 ATP binding, 0006430 lysyl-tRNA aminoacylation, 0005737 cytoplasm; PDB: 1IRX_A.
Probab=51.42  E-value=9.1  Score=37.24  Aligned_cols=41  Identities=24%  Similarity=0.518  Sum_probs=21.1

Q ss_pred             ceeeeecCCCCc-cccccceeeeeccccccccceeeEEEEEEcCCCCceeEEe
Q psy10064         49 LPYNIWCEGCNN-HIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIK  100 (257)
Q Consensus        49 ~Pf~i~C~~C~~-~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~  100 (257)
                      .||...|..||. .--.=+.||....+|           +.+|+.|+.+.++.
T Consensus       171 ~Pf~piC~~cGri~tt~v~~~d~~~~~v-----------~Y~c~~cG~~g~~~  212 (360)
T PF01921_consen  171 SPFLPICEKCGRIDTTEVTEYDPEGGTV-----------TYRCEECGHEGEVD  212 (360)
T ss_dssp             -SEEEEETTTEE--EEEEEEE--SSSEE-----------EEE--TTS---EEE
T ss_pred             eeeeeeccccCCcccceeeEeecCCCEE-----------EEEecCCCCEEEEe
Confidence            599999999987 232333444443333           47899999876543


No 34 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=51.13  E-value=19  Score=23.41  Aligned_cols=36  Identities=22%  Similarity=0.541  Sum_probs=21.3

Q ss_pred             eeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeE
Q psy10064         51 YNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFE   98 (257)
Q Consensus        51 f~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~   98 (257)
                      +.|.|.+|+      ++|+-.-.+++.      -.-..+|+.|.+.|.
T Consensus         1 M~i~CP~C~------~~f~v~~~~l~~------~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen    1 MIITCPNCQ------TRFRVPDDKLPA------GGRKVRCPKCGHVFR   36 (37)
T ss_pred             CEEECCCCC------ceEEcCHHHccc------CCcEEECCCCCcEee
Confidence            357888885      344444444321      111588999988775


No 35 
>KOG2407|consensus
Probab=50.73  E-value=5.7  Score=40.38  Aligned_cols=15  Identities=40%  Similarity=1.057  Sum_probs=13.1

Q ss_pred             EEeceeeeecCCCCc
Q psy10064         46 RFELPYNIWCEGCNN   60 (257)
Q Consensus        46 Rfe~Pf~i~C~~C~~   60 (257)
                      =|-|||||+|.+|--
T Consensus       492 DFSMPYNVIcltcTv  506 (575)
T KOG2407|consen  492 DFSMPYNVICLTCTV  506 (575)
T ss_pred             CCCCceeEEeeehhh
Confidence            489999999999954


No 36 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=50.15  E-value=20  Score=23.35  Aligned_cols=35  Identities=23%  Similarity=0.623  Sum_probs=21.4

Q ss_pred             eeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCcee
Q psy10064         51 YNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHF   97 (257)
Q Consensus        51 f~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i   97 (257)
                      +.|.|..|+      ++|+-.-++|.      -=.-..+|+.|++.|
T Consensus         1 M~i~Cp~C~------~~y~i~d~~ip------~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    1 MIITCPNCQ------AKYEIDDEKIP------PKGRKVRCSKCGHVF   35 (36)
T ss_pred             CEEECCCCC------CEEeCCHHHCC------CCCcEEECCCCCCEe
Confidence            357788884      45555555442      111258899998865


No 37 
>KOG3794|consensus
Probab=49.87  E-value=9.7  Score=37.60  Aligned_cols=14  Identities=29%  Similarity=0.584  Sum_probs=10.7

Q ss_pred             cCCCccc--CCCCCCC
Q psy10064          5 KGTNKYY--PPDYDPS   18 (257)
Q Consensus         5 K~~nkYy--PPD~DP~   18 (257)
                      .++|+||  ||-+++.
T Consensus        66 ~~~sFMY~~PPG~~KE   81 (453)
T KOG3794|consen   66 NGLSFMYEAPPGAKKE   81 (453)
T ss_pred             cccceeecCCCCCCch
Confidence            4678888  7778876


No 38 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=49.77  E-value=14  Score=24.82  Aligned_cols=18  Identities=22%  Similarity=0.593  Sum_probs=14.6

Q ss_pred             EEEcCCCCceeEEeeCCC
Q psy10064         87 RMKCHLCDSHFEIKTDPG  104 (257)
Q Consensus        87 ~~kC~~C~~~i~i~TDPk  104 (257)
                      .++|+.|++.+.++..+.
T Consensus        21 ~~~Cp~CG~~~~~~~~~~   38 (46)
T PRK00398         21 GVRCPYCGYRILFKERPP   38 (46)
T ss_pred             ceECCCCCCeEEEccCCC
Confidence            489999999999876553


No 39 
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=49.45  E-value=9.3  Score=38.87  Aligned_cols=36  Identities=17%  Similarity=0.419  Sum_probs=27.0

Q ss_pred             cccceeeEEEEEEcCCCCceeEEe---------eCCCCCCeeecc
Q psy10064         77 MYYSTPVYQFRMKCHLCDSHFEIK---------TDPGNLDYVIVS  112 (257)
Q Consensus        77 ~Y~st~I~~F~~kC~~C~~~i~i~---------TDPkn~dYv~~~  112 (257)
                      .|......+|+..||+|+.+..+.         .+|+..-|+|.+
T Consensus       190 ~~~~sdqr~~~vpCPhCg~~~~l~~~~l~w~~~~~~~~a~y~C~~  234 (557)
T PF05876_consen  190 LYEESDQRRYYVPCPHCGEEQVLEWENLKWDKGEAPETARYVCPH  234 (557)
T ss_pred             HHHhCCceEEEccCCCCCCCccccccceeecCCCCccceEEECCC
Confidence            466556668999999998877665         257888888865


No 40 
>PF07255 Benyvirus_14KDa:  Benyvirus 14KDa protein;  InterPro: IPR009884 This family consists of several Benyvirus specific 14 kDa proteins of around 125 residues in length. Members of this family contain 9 conserved cysteine residues. The function of this family is unknown.
Probab=49.09  E-value=14  Score=30.19  Aligned_cols=73  Identities=18%  Similarity=0.191  Sum_probs=53.1

Q ss_pred             EEEEeceeeeecCCCCc--cccccceeeeeccccccccceeeEEEEEEcCCCCceeEEeeCCCCCCeeeccCceecccCC
Q psy10064         44 IIRFELPYNIWCEGCNN--HIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIKTDPGNLDYVIVSGARRQENRW  121 (257)
Q Consensus        44 ~VRfe~Pf~i~C~~C~~--~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~TDPkn~dYv~~~Ga~r~~e~~  121 (257)
                      .-||-+-|.-||+-=..  --|+|   -.+++.+-+  .+--..|.|+|-.|...++++..-+|..=-+..|-.|+...|
T Consensus        25 ~~~FSiK~~~W~LFT~~V~V~YR~---~~~~E~~~K--D~~RLHF~~~CV~C~~K~~~K~~Nk~H~~~~~~G~~R~~RNF   99 (123)
T PF07255_consen   25 CERFSIKFSEWKLFTTAVYVEYRQ---LGEKECSLK--DVCRLHFNMSCVKCCRKLKCKKQNKNHSKHVQNGYLRKVRNF   99 (123)
T ss_pred             eEEEEEecCCEEEEeeEEEEEEec---cCCccceeh--eeeeEEEeeehhhhcccceehhcCcchHHHhhcCeEEEecce
Confidence            56899999999986654  12333   224444311  234567999999999999999999998888888888876544


No 41 
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription]
Probab=48.94  E-value=8.9  Score=36.03  Aligned_cols=28  Identities=32%  Similarity=0.401  Sum_probs=24.1

Q ss_pred             EEcCCCCceeEEeeCCCCCCeeecc-Ccee
Q psy10064         88 MKCHLCDSHFEIKTDPGNLDYVIVS-GARR  116 (257)
Q Consensus        88 ~kC~~C~~~i~i~TDPkn~dYv~~~-Ga~r  116 (257)
                      +.||.|+.. .|-+|++++++||.. |+.=
T Consensus         2 ~~CpeCg~~-~~~~d~~~ge~VC~~CG~Vi   30 (285)
T COG1405           2 MSCPECGST-NIITDYERGEIVCADCGLVL   30 (285)
T ss_pred             CCCCCCCCc-cceeeccCCeEEeccCCEEe
Confidence            579999999 999999999999987 4433


No 42 
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]
Probab=48.56  E-value=11  Score=36.70  Aligned_cols=20  Identities=20%  Similarity=0.350  Sum_probs=16.9

Q ss_pred             eeEEEEEEcCCCCceeEEee
Q psy10064         82 PVYQFRMKCHLCDSHFEIKT  101 (257)
Q Consensus        82 ~I~~F~~kC~~C~~~i~i~T  101 (257)
                      ..+.||-.||.|..|=+|+.
T Consensus       363 ~a~~l~W~CPsC~~W~TikP  382 (389)
T COG2956         363 TAHTLYWHCPSCRAWETIKP  382 (389)
T ss_pred             cceeeeeeCCCcccccccCC
Confidence            35679999999999988874


No 43 
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=47.83  E-value=8.1  Score=31.11  Aligned_cols=18  Identities=28%  Similarity=0.637  Sum_probs=11.2

Q ss_pred             eEEEEeceeeeecCCCCcc
Q psy10064         43 MIIRFELPYNIWCEGCNNH   61 (257)
Q Consensus        43 ~~VRfe~Pf~i~C~~C~~~   61 (257)
                      |.| -..|...+|..|+..
T Consensus        62 L~I-e~~p~~~~C~~Cg~~   79 (113)
T PF01155_consen   62 LEI-EEVPARARCRDCGHE   79 (113)
T ss_dssp             EEE-EEE--EEEETTTS-E
T ss_pred             EEE-EecCCcEECCCCCCE
Confidence            444 467999999999864


No 44 
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=47.33  E-value=22  Score=29.52  Aligned_cols=36  Identities=25%  Similarity=0.506  Sum_probs=26.9

Q ss_pred             eeeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEE
Q psy10064         50 PYNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEI   99 (257)
Q Consensus        50 Pf~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i   99 (257)
                      .|.-.|..|+..+.+=.|.|..              =...|..|.+.+.+
T Consensus       110 ~~~y~C~~C~~~~~~~rr~~~~--------------~~y~C~~C~g~l~~  145 (146)
T smart00731      110 KYPYRCTGCGQRYLRVRRSNNV--------------SRYRCGKCGGKLIL  145 (146)
T ss_pred             eEEEECCCCCCCCceEccccCc--------------ceEEcCCCCCEEEe
Confidence            5688999999988765555532              23689999999875


No 45 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=46.85  E-value=13  Score=22.75  Aligned_cols=36  Identities=28%  Similarity=0.626  Sum_probs=20.8

Q ss_pred             ecCCCCcccccc-ceeeeecccccc-ccceeeEEEEEEcCCCCceeE
Q psy10064         54 WCEGCNNHIGMG-VRYNAEKKKVGM-YYSTPVYQFRMKCHLCDSHFE   98 (257)
Q Consensus        54 ~C~~C~~~I~kG-~rfNA~K~~vg~-Y~st~I~~F~~kC~~C~~~i~   98 (257)
                      +|..|+..|.-+ ...++    .+. |+..     -|+|..|...|+
T Consensus         1 ~C~~C~~~i~~~~~~~~~----~~~~~H~~-----Cf~C~~C~~~L~   38 (39)
T smart00132        1 KCAGCGKPIRGGELVLRA----LGKVWHPE-----CFKCSKCGKPLG   38 (39)
T ss_pred             CccccCCcccCCcEEEEe----CCcccccc-----CCCCcccCCcCc
Confidence            488999988776 22221    232 3322     367777777653


No 46 
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=46.06  E-value=17  Score=31.58  Aligned_cols=41  Identities=22%  Similarity=0.471  Sum_probs=30.1

Q ss_pred             eeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEEeeCC
Q psy10064         51 YNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIKTDP  103 (257)
Q Consensus        51 f~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~TDP  103 (257)
                      |.-+|. |+++--+=.|+|-.++.- .          .+|-.|.+.+.+++++
T Consensus       116 ~~Y~C~-C~q~~l~~RRhn~~~~g~-~----------YrC~~C~gkL~~~~~~  156 (156)
T COG3091         116 YPYRCQ-CQQHYLRIRRHNTVRRGE-V----------YRCGKCGGKLVFKGQV  156 (156)
T ss_pred             eeEEee-cCCccchhhhcccccccc-e----------EEeccCCceEEeccCC
Confidence            345899 999877767777655332 2          5799999999998864


No 47 
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=46.02  E-value=14  Score=37.53  Aligned_cols=39  Identities=18%  Similarity=0.446  Sum_probs=25.6

Q ss_pred             eeeecCCCCccc---cccceeeeeccccccccceeeEEEEEEcCCCCceeE
Q psy10064         51 YNIWCEGCNNHI---GMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFE   98 (257)
Q Consensus        51 f~i~C~~C~~~I---~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~   98 (257)
                      |.+.|.+||++.   ..+.+++..-         .--.-++.|+.|+..|+
T Consensus       199 ~~vpCPhCg~~~~l~~~~l~w~~~~---------~~~~a~y~C~~Cg~~i~  240 (557)
T PF05876_consen  199 YYVPCPHCGEEQVLEWENLKWDKGE---------APETARYVCPHCGCEIE  240 (557)
T ss_pred             EEccCCCCCCCccccccceeecCCC---------CccceEEECCCCcCCCC
Confidence            456799999863   3466663211         12335689999999886


No 48 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=42.50  E-value=12  Score=22.49  Aligned_cols=16  Identities=19%  Similarity=0.729  Sum_probs=10.6

Q ss_pred             eeecCCCCccccccce
Q psy10064         52 NIWCEGCNNHIGMGVR   67 (257)
Q Consensus        52 ~i~C~~C~~~I~kG~r   67 (257)
                      .+.|..||..|..+-+
T Consensus         2 ~~~Cp~Cg~~~~~~~~   17 (26)
T PF13248_consen    2 EMFCPNCGAEIDPDAK   17 (26)
T ss_pred             cCCCcccCCcCCcccc
Confidence            4677788777666533


No 49 
>PF13005 zf-IS66:  zinc-finger binding domain of transposase IS66 ;  InterPro: IPR024474 This entry represents a predicted helix-turn-helix domain from insertion element IS66 transposases [].
Probab=42.26  E-value=35  Score=22.64  Aligned_cols=41  Identities=15%  Similarity=0.290  Sum_probs=27.1

Q ss_pred             ecCCCCccccc-cceeeeecccc--ccccceeeEEEEEEcCCCC
Q psy10064         54 WCEGCNNHIGM-GVRYNAEKKKV--GMYYSTPVYQFRMKCHLCD   94 (257)
Q Consensus        54 ~C~~C~~~I~k-G~rfNA~K~~v--g~Y~st~I~~F~~kC~~C~   94 (257)
                      -|..||..+.. |..+=.+.-.+  ..+.=+-..++...|+.|+
T Consensus         4 ~C~~Cg~~l~~ig~~~~~q~l~~~p~~~~V~e~~~~~y~C~~C~   47 (47)
T PF13005_consen    4 ACPDCGGELKEIGEEKVRQVLDLPPAKPEVTEHVRHKYACPCCG   47 (47)
T ss_pred             cCCCCCceeeECCceeeEEEEeecccceEEEEEEeceEECCCCC
Confidence            48889886653 44433333222  3566788899999999995


No 50 
>PF06750 DiS_P_DiS:  Bacterial Peptidase A24 N-terminal domain;  InterPro: IPR010627 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This domain is found at the N terminus of bacterial aspartic peptidases belonging to MEROPS peptidase family A24 (clan AD), subfamily A24A (type IV prepilin peptidase, IPR000045 from INTERPRO). It's function has not been specifically determined; however some of the family have been characterised as bifunctional [], and this domain may contain the N-methylation activity. The domain consists of an intracellular region between a pair of transmembrane domains. This intracellular region contains an invariant proline and four conserved cysteines. These Cys residues are arranged in a two-pair motif, with the Cys residues of a pair separated (usually) by 2 aa and with each pair separated by 21 largely hydrophilic residues (C-X-X-C...X21...C-X-X-C); they have been shown to be essential to the overall function of the enzyme [, ].   The bifunctional enzyme prepilin peptidase (PilD) from Pseudomonas aeruginosa is a key determinant in both type-IV pilus biogenesis and extracellular protein secretion, in its roles as a leader peptidase and methyl transferase (MTase). It is responsible for endopeptidic cleavage of the unique leader peptides that characterise type-IV pilin precursors, as well as proteins with homologous leader sequences that are essential components of the general secretion pathway found in a variety of Gram-negative pathogens. Following removal of the leader peptides, the same enzyme is responsible for the second posttranslational modification that characterises the type-IV pilins and their homologues, namely N-methylation of the newly exposed N-terminal amino acid residue []. 
Probab=42.18  E-value=4.3  Score=31.77  Aligned_cols=34  Identities=18%  Similarity=0.601  Sum_probs=25.4

Q ss_pred             eecCCCCccccccceeeeeccccccccceeeEEE---EEEcCCCCceeEE
Q psy10064         53 IWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQF---RMKCHLCDSHFEI   99 (257)
Q Consensus        53 i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F---~~kC~~C~~~i~i   99 (257)
                      -.|.+|+..+.             -|--+||++|   +.||..|...|.+
T Consensus        34 S~C~~C~~~L~-------------~~~lIPi~S~l~lrGrCr~C~~~I~~   70 (92)
T PF06750_consen   34 SHCPHCGHPLS-------------WWDLIPILSYLLLRGRCRYCGAPIPP   70 (92)
T ss_pred             CcCcCCCCcCc-------------ccccchHHHHHHhCCCCcccCCCCCh
Confidence            46999987654             3456888776   5799999998864


No 51 
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=42.07  E-value=12  Score=27.73  Aligned_cols=15  Identities=20%  Similarity=0.383  Sum_probs=11.9

Q ss_pred             eeeeecCCCCccccc
Q psy10064         50 PYNIWCEGCNNHIGM   64 (257)
Q Consensus        50 Pf~i~C~~C~~~I~k   64 (257)
                      =+.|+|-+||.-|+-
T Consensus         2 iiPvRCFTCGkvi~~   16 (62)
T PRK04016          2 MIPVRCFTCGKVIAE   16 (62)
T ss_pred             CCCeEecCCCCChHH
Confidence            367899999998764


No 52 
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=42.03  E-value=18  Score=25.93  Aligned_cols=15  Identities=20%  Similarity=0.682  Sum_probs=7.9

Q ss_pred             EEcCCCCceeEEeeC
Q psy10064         88 MKCHLCDSHFEIKTD  102 (257)
Q Consensus        88 ~kC~~C~~~i~i~TD  102 (257)
                      ++|+.|+..|++..+
T Consensus         3 ~~CP~CG~~iev~~~   17 (54)
T TIGR01206         3 FECPDCGAEIELENP   17 (54)
T ss_pred             cCCCCCCCEEecCCC
Confidence            355555555555433


No 53 
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=41.28  E-value=28  Score=25.73  Aligned_cols=43  Identities=16%  Similarity=0.298  Sum_probs=28.1

Q ss_pred             ecCCCCccccccceeeeeccccccccceeeEEEE-EEcCCCCce
Q psy10064         54 WCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFR-MKCHLCDSH   96 (257)
Q Consensus        54 ~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~-~kC~~C~~~   96 (257)
                      .|..|++..+.=..+.+.--.+++.+.+..-+|+ +-|++|+-.
T Consensus         2 ~C~KCg~~~~e~~~v~~tgg~~skiFdvq~~~f~~v~C~~CGYT   45 (64)
T PF09855_consen    2 KCPKCGNEEYESGEVRATGGGLSKIFDVQNKKFTTVSCTNCGYT   45 (64)
T ss_pred             CCCCCCCcceecceEEccCCeeEEEEEecCcEEEEEECCCCCCE
Confidence            4999999877766666655444455554444443 469999764


No 54 
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair]
Probab=40.33  E-value=18  Score=34.15  Aligned_cols=48  Identities=19%  Similarity=0.373  Sum_probs=34.0

Q ss_pred             ecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEEeeCCC------CCCeeeccCceecc
Q psy10064         54 WCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIKTDPG------NLDYVIVSGARRQE  118 (257)
Q Consensus        54 ~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~TDPk------n~dYv~~~Ga~r~~  118 (257)
                      +|..||...+..         -|        ...+.|+.|++.+.=+|||-      +.++++--|-.|..
T Consensus       113 FCg~CG~~~~~~---------~~--------g~~~~C~~cg~~~fPR~dP~vIv~v~~~~~ilLa~~~~h~  166 (279)
T COG2816         113 FCGRCGTKTYPR---------EG--------GWARVCPKCGHEHFPRIDPCVIVAVIRGDEILLARHPRHF  166 (279)
T ss_pred             CCCCCCCcCccc---------cC--------ceeeeCCCCCCccCCCCCCeEEEEEecCCceeecCCCCCC
Confidence            599998855441         11        23588999999999999996      66666665555543


No 55 
>PF01396 zf-C4_Topoisom:  Topoisomerase DNA binding C4 zinc finger;  InterPro: IPR013498 DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks []. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis [, ]. DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA []. Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.  This entry represents the zinc-finger domain found in type IA topoisomerases, including bacterial and archaeal topoisomerase I and III enzymes, and in eukaryotic topoisomerase III enzymes. Escherichia coli topoisomerase I proteins contain five copies of a zinc-ribbon-like domain at their C terminus, two of which have lost their cysteine residues and are therefore probably not able to bind zinc []. This domain is still considered to be a member of the zinc-ribbon superfamily despite not being able to bind zinc. More information about this protein can be found at Protein of the Month: DNA Topoisomerase [].; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006265 DNA topological change, 0005694 chromosome
Probab=39.77  E-value=27  Score=23.02  Aligned_cols=17  Identities=18%  Similarity=0.522  Sum_probs=14.9

Q ss_pred             EcCCCCceeEEeeCCCC
Q psy10064         89 KCHLCDSHFEIKTDPGN  105 (257)
Q Consensus        89 kC~~C~~~i~i~TDPkn  105 (257)
                      +|+.|++.+++++....
T Consensus         3 ~CP~Cg~~lv~r~~k~g   19 (39)
T PF01396_consen    3 KCPKCGGPLVLRRGKKG   19 (39)
T ss_pred             CCCCCCceeEEEECCCC
Confidence            69999999999988877


No 56 
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=38.66  E-value=10  Score=33.93  Aligned_cols=30  Identities=23%  Similarity=0.429  Sum_probs=0.0

Q ss_pred             eecCCCCccccccce-----eeeeccccc-ccccee
Q psy10064         53 IWCEGCNNHIGMGVR-----YNAEKKKVG-MYYSTP   82 (257)
Q Consensus        53 i~C~~C~~~I~kG~r-----fNA~K~~vg-~Y~st~   82 (257)
                      -.|.=||+++|+|.|     |+..+-.-| ..||||
T Consensus       102 y~CEICGN~~Y~GrkaFekHF~E~rH~~GlrcLGI~  137 (196)
T PF11931_consen  102 YKCEICGNQSYKGRKAFEKHFQEWRHAYGLRCLGIP  137 (196)
T ss_dssp             ------------------------------------
T ss_pred             eeeEeCCCcceecHHHHHHhcChhHHHccChhcCCC
Confidence            469999999999964     554444444 244444


No 57 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=38.04  E-value=17  Score=23.30  Aligned_cols=18  Identities=22%  Similarity=0.632  Sum_probs=14.4

Q ss_pred             EEEcCCCCceeEEeeCCC
Q psy10064         87 RMKCHLCDSHFEIKTDPG  104 (257)
Q Consensus        87 ~~kC~~C~~~i~i~TDPk  104 (257)
                      .+.|++|...+.|..|+-
T Consensus         2 ~~~CP~C~~~~~v~~~~~   19 (38)
T TIGR02098         2 RIQCPNCKTSFRVVDSQL   19 (38)
T ss_pred             EEECCCCCCEEEeCHHHc
Confidence            478999999988887754


No 58 
>COG4481 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=37.31  E-value=22  Score=25.92  Aligned_cols=24  Identities=33%  Similarity=0.531  Sum_probs=20.5

Q ss_pred             eeEEEEeceeeeecCCCCcccccc
Q psy10064         42 IMIIRFELPYNIWCEGCNNHIGMG   65 (257)
Q Consensus        42 ~~~VRfe~Pf~i~C~~C~~~I~kG   65 (257)
                      --+||+-+-..|.|.+|+..|-.+
T Consensus        24 wkIiRvGaDIkikC~nC~h~vm~p   47 (60)
T COG4481          24 WKIIRVGADIKIKCENCGHSVMMP   47 (60)
T ss_pred             EEEEEecCcEEEEecCCCcEEEec
Confidence            358999999999999999977655


No 59 
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=36.72  E-value=14  Score=27.37  Aligned_cols=14  Identities=29%  Similarity=0.634  Sum_probs=11.1

Q ss_pred             eeeeecCCCCcccc
Q psy10064         50 PYNIWCEGCNNHIG   63 (257)
Q Consensus        50 Pf~i~C~~C~~~I~   63 (257)
                      =+.|+|-+||.-|+
T Consensus         2 iiPiRCFsCGkvi~   15 (63)
T COG1644           2 IIPVRCFSCGKVIG   15 (63)
T ss_pred             CCceEeecCCCCHH
Confidence            35689999998875


No 60 
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=36.65  E-value=29  Score=24.64  Aligned_cols=19  Identities=37%  Similarity=0.723  Sum_probs=11.5

Q ss_pred             EcCCCCceeEEeeCCCCCC
Q psy10064         89 KCHLCDSHFEIKTDPGNLD  107 (257)
Q Consensus        89 kC~~C~~~i~i~TDPkn~d  107 (257)
                      .||.|+..|++--|+...+
T Consensus         2 ~CPyCge~~~~~iD~s~~~   20 (52)
T PF14255_consen    2 QCPYCGEPIEILIDPSAGD   20 (52)
T ss_pred             CCCCCCCeeEEEEecCCCC
Confidence            4666666666666665543


No 61 
>PF06044 DRP:  Dam-replacing family;  InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements. The replacement of Dam-methylase by DRP allows phase variation through slippage-like mechanisms in several pathogenic isolates of Neisseria meningitidis [].; PDB: 4ESJ_A.
Probab=36.58  E-value=17  Score=33.69  Aligned_cols=51  Identities=25%  Similarity=0.664  Sum_probs=25.1

Q ss_pred             eeecCCCCcc-ccccceeeeeccccccccceeeEEEEEEcCCCCceeEEeeCCCCCCeeeccCcee
Q psy10064         52 NIWCEGCNNH-IGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIKTDPGNLDYVIVSGARR  116 (257)
Q Consensus        52 ~i~C~~C~~~-I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~TDPkn~dYv~~~Ga~r  116 (257)
                      ++-|..||.. |.+   |.+-         .|+=-  |.|+.|..+++++.-=++-.=.|.-||-.
T Consensus        31 n~yCP~Cg~~~L~~---f~NN---------~PVaD--F~C~~C~eeyELKSk~~~l~~~I~dGAY~   82 (254)
T PF06044_consen   31 NMYCPNCGSKPLSK---FENN---------RPVAD--FYCPNCNEEYELKSKKKKLSNKINDGAYH   82 (254)
T ss_dssp             H---TTT--SS-EE--------------------E--EE-TTT--EEEEEEEESS--SEEEEEEHH
T ss_pred             CCcCCCCCChhHhh---ccCC---------Cccce--eECCCCchHHhhhhhccccCCcccCccHH
Confidence            5789999974 533   3222         23333  55999999999999888888888888843


No 62 
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription]
Probab=36.57  E-value=20  Score=26.75  Aligned_cols=20  Identities=30%  Similarity=0.605  Sum_probs=15.1

Q ss_pred             EcCCCCce--------eEEeeCCCCCCe
Q psy10064         89 KCHLCDSH--------FEIKTDPGNLDY  108 (257)
Q Consensus        89 kC~~C~~~--------i~i~TDPkn~dY  108 (257)
                      -||.|+++        +.|-+||++++-
T Consensus        20 ~CP~Cgs~~~te~W~G~~iIidpe~SeI   47 (64)
T COG2093          20 ICPVCGSTDLTEEWFGLLIIIDPEKSEI   47 (64)
T ss_pred             cCCCCCCcccchhhccEEEEEcCcHHHH
Confidence            38999887        677888887653


No 63 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=36.48  E-value=34  Score=23.34  Aligned_cols=18  Identities=17%  Similarity=0.397  Sum_probs=15.3

Q ss_pred             EEEcCCCCceeEEeeCCC
Q psy10064         87 RMKCHLCDSHFEIKTDPG  104 (257)
Q Consensus        87 ~~kC~~C~~~i~i~TDPk  104 (257)
                      .++|+.|++.|.++-=|.
T Consensus        19 ~irC~~CG~rIlyK~R~~   36 (44)
T smart00659       19 VVRCRECGYRILYKKRTK   36 (44)
T ss_pred             ceECCCCCceEEEEeCCC
Confidence            599999999999987654


No 64 
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis]
Probab=36.46  E-value=38  Score=25.50  Aligned_cols=17  Identities=18%  Similarity=0.473  Sum_probs=12.7

Q ss_pred             EEEEEcCCCCceeEEee
Q psy10064         85 QFRMKCHLCDSHFEIKT  101 (257)
Q Consensus        85 ~F~~kC~~C~~~i~i~T  101 (257)
                      ++..+|..|+..|.--|
T Consensus        36 st~V~C~~CG~~l~~PT   52 (67)
T COG2051          36 STVVTCLICGTTLAEPT   52 (67)
T ss_pred             ceEEEecccccEEEecC
Confidence            35788999988877655


No 65 
>PRK00750 lysK lysyl-tRNA synthetase; Reviewed
Probab=35.74  E-value=33  Score=34.54  Aligned_cols=27  Identities=30%  Similarity=0.550  Sum_probs=19.7

Q ss_pred             ceeeeecCCCCccccccc-eeeeecccc
Q psy10064         49 LPYNIWCEGCNNHIGMGV-RYNAEKKKV   75 (257)
Q Consensus        49 ~Pf~i~C~~C~~~I~kG~-rfNA~K~~v   75 (257)
                      .||+..|..||....-.+ -||.+..+|
T Consensus       172 ~P~~pic~~cg~~~~~~~~~~d~~~~~v  199 (510)
T PRK00750        172 SPFLPICPKCGKVLTTPVISYDAEAGTV  199 (510)
T ss_pred             eeeeeeCCCCCccceEEEEEEeCCCCEE
Confidence            499999999998765554 566665544


No 66 
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=35.51  E-value=33  Score=25.88  Aligned_cols=30  Identities=20%  Similarity=0.507  Sum_probs=15.4

Q ss_pred             eecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEEee
Q psy10064         53 IWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIKT  101 (257)
Q Consensus        53 i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~T  101 (257)
                      ++| .||.++|--           .+..      +-+| .|+..|-|+.
T Consensus         4 frC-~Cgr~lya~-----------e~~k------TkkC-~CG~~l~vk~   33 (68)
T PF09082_consen    4 FRC-DCGRYLYAK-----------EGAK------TKKC-VCGKTLKVKE   33 (68)
T ss_dssp             EEE-TTS--EEEE-----------TT-S------EEEE-TTTEEEE--S
T ss_pred             EEe-cCCCEEEec-----------CCcc------eeEe-cCCCeeeeee
Confidence            578 688887741           1112      3578 7888777653


No 67 
>PRK11823 DNA repair protein RadA; Provisional
Probab=34.28  E-value=26  Score=34.58  Aligned_cols=28  Identities=14%  Similarity=0.408  Sum_probs=22.3

Q ss_pred             eecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEEee
Q psy10064         53 IWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIKT  101 (257)
Q Consensus        53 i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~T  101 (257)
                      -.|..||..-.+                     ++-+||.|..|=+|+-
T Consensus         8 y~C~~Cg~~~~~---------------------~~g~Cp~C~~w~t~~e   35 (446)
T PRK11823          8 YVCQECGAESPK---------------------WLGRCPECGAWNTLVE   35 (446)
T ss_pred             EECCcCCCCCcc---------------------cCeeCcCCCCccceee
Confidence            579999865444                     5789999999988876


No 68 
>TIGR00467 lysS_arch lysyl-tRNA synthetase, archaeal and spirochete. This model represents the lysyl-tRNA synthetases that are class I amino-acyl tRNA synthetases. It includes archaeal and spirochete examples of the enzyme. All other known examples are class IIc amino-acyl tRNA synthetases and seem to form a separate orthologous set.
Probab=33.61  E-value=36  Score=34.58  Aligned_cols=24  Identities=25%  Similarity=0.643  Sum_probs=17.5

Q ss_pred             ceeeeecCCCCccccccceeeeec
Q psy10064         49 LPYNIWCEGCNNHIGMGVRYNAEK   72 (257)
Q Consensus        49 ~Pf~i~C~~C~~~I~kG~rfNA~K   72 (257)
                      .||+..|..||.....=+.+|+..
T Consensus       165 ~P~~pic~~cGrv~~~~~~~~~~~  188 (515)
T TIGR00467       165 YPISVFCENCGRDTTTVNNYDNEY  188 (515)
T ss_pred             eeeeeecCCcCccCceEEEecCCc
Confidence            799999999998755444455544


No 69 
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=33.56  E-value=40  Score=25.84  Aligned_cols=44  Identities=25%  Similarity=0.594  Sum_probs=21.2

Q ss_pred             EeceeeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEEee
Q psy10064         47 FELPYNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIKT  101 (257)
Q Consensus        47 fe~Pf~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~T  101 (257)
                      --+|=..-|..|+.--.-.++++.. +.+|          .+.|..|+..+++..
T Consensus        17 ~~l~~~F~CPfC~~~~sV~v~idkk-~~~~----------~~~C~~Cg~~~~~~i   60 (81)
T PF05129_consen   17 PKLPKVFDCPFCNHEKSVSVKIDKK-EGIG----------ILSCRVCGESFQTKI   60 (81)
T ss_dssp             ---SS----TTT--SS-EEEEEETT-TTEE----------EEEESSS--EEEEE-
T ss_pred             CCCCceEcCCcCCCCCeEEEEEEcc-CCEE----------EEEecCCCCeEEEcc
Confidence            3456667899999877777777433 3333          589999987776653


No 70 
>PF04113 Gpi16:  Gpi16 subunit, GPI transamidase component;  InterPro: IPR007245 GPI (glycosyl phosphatidyl inositol) transamidase is a multiprotein complex. Gpi16, Gpi8 and Gaa1 for a sub-complex of the GPI transamidase. GPI transamidase adds glycosylphosphatidylinositols (GPIs) to newly synthesized proteins. Gpi16 is an essential N-glycosylated transmembrane glycoprotein. Gpi16 is largely found on the lumenal side of the ER. It has a single C-terminal transmembrane domain and a small C-terminal, cytosolic extension with an ER retrieval motif [].; GO: 0016021 integral to membrane, 0042765 GPI-anchor transamidase complex
Probab=32.97  E-value=9.3  Score=39.16  Aligned_cols=26  Identities=27%  Similarity=0.606  Sum_probs=19.5

Q ss_pred             EEeceeeeecCCCCc-cccccceeeee
Q psy10064         46 RFELPYNIWCEGCNN-HIGMGVRYNAE   71 (257)
Q Consensus        46 Rfe~Pf~i~C~~C~~-~I~kG~rfNA~   71 (257)
                      =|-|||||+|.+|-- -++=|.-||.-
T Consensus       507 DFSMPyNVI~lt~Tv~Al~FG~i~nll  533 (564)
T PF04113_consen  507 DFSMPYNVIILTCTVMALAFGSIFNLL  533 (564)
T ss_pred             CCCccchhhHHHHHHHHHHHHHHHHHH
Confidence            478999999999965 35556666653


No 71 
>KOG2846|consensus
Probab=32.57  E-value=20  Score=34.55  Aligned_cols=42  Identities=29%  Similarity=0.728  Sum_probs=27.7

Q ss_pred             eeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEEeeCCCC
Q psy10064         51 YNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIKTDPGN  105 (257)
Q Consensus        51 f~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~TDPkn  105 (257)
                      |.++|..|..|-|.-     +|+.- .|.       .|.|+.|.....=+-+|+|
T Consensus       219 yALIC~~C~~HNGla-----~~ee~-~yi-------~F~C~~Cn~LN~~~k~~e~  260 (328)
T KOG2846|consen  219 YALICSQCHHHNGLA-----RKEEY-EYI-------TFRCPHCNALNPAKKSPEN  260 (328)
T ss_pred             hhhcchhhccccCcC-----Chhhc-Cce-------EEECccccccCCCcCCccc
Confidence            578999999998873     33221 122       4789999987655544443


No 72 
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=32.14  E-value=47  Score=21.46  Aligned_cols=16  Identities=25%  Similarity=0.461  Sum_probs=9.3

Q ss_pred             cCCCCceeEEeeCCCC
Q psy10064         90 CHLCDSHFEIKTDPGN  105 (257)
Q Consensus        90 C~~C~~~i~i~TDPkn  105 (257)
                      |+.|++-+..+.|-.+
T Consensus         4 Cp~C~nlL~p~~~~~~   19 (35)
T PF02150_consen    4 CPECGNLLYPKEDKEK   19 (35)
T ss_dssp             ETTTTSBEEEEEETTT
T ss_pred             CCCCCccceEcCCCcc
Confidence            5666666665555554


No 73 
>PRK14704 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=32.11  E-value=30  Score=35.88  Aligned_cols=38  Identities=26%  Similarity=0.565  Sum_probs=27.3

Q ss_pred             CCeeEEEEeceeeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEEeeCCCC
Q psy10064         40 MGIMIIRFELPYNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIKTDPGN  105 (257)
Q Consensus        40 ~g~~~VRfe~Pf~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~TDPkn  105 (257)
                      .|+.-+-|-.||++ |..||-   .|.                   +...||.|++     +||++
T Consensus       548 ~~i~Y~sin~~~~~-C~~CGy---~g~-------------------~~~~CP~CG~-----~d~~~  585 (618)
T PRK14704        548 HGVGYGSINHPVDR-CKCCSY---HGV-------------------IGNECPSCGN-----EDEAN  585 (618)
T ss_pred             cCCceEEeCCCCee-cCCCCC---CCC-------------------cCccCcCCCC-----CCcch
Confidence            46777777888886 999983   442                   1278999998     56665


No 74 
>PF05864 Chordopox_RPO7:  Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide (RPO7);  InterPro: IPR008448 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. This family consists of several Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide sequences. DNA-dependent RNA polymerase catalyses the transcription of DNA into RNA [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=32.01  E-value=23  Score=26.05  Aligned_cols=16  Identities=13%  Similarity=0.655  Sum_probs=12.9

Q ss_pred             ceeeeecCCCCccccc
Q psy10064         49 LPYNIWCEGCNNHIGM   64 (257)
Q Consensus        49 ~Pf~i~C~~C~~~I~k   64 (257)
                      |=|.+.|.+||.-|.-
T Consensus         1 MVf~lvCSTCGrDlSe   16 (63)
T PF05864_consen    1 MVFQLVCSTCGRDLSE   16 (63)
T ss_pred             CeeeeeecccCCcchH
Confidence            5588999999987654


No 75 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=31.68  E-value=22  Score=25.04  Aligned_cols=39  Identities=18%  Similarity=0.340  Sum_probs=21.6

Q ss_pred             eecCCCCccccccceeeeecccc-cc-ccceeeEEEEEEcCCCCc
Q psy10064         53 IWCEGCNNHIGMGVRYNAEKKKV-GM-YYSTPVYQFRMKCHLCDS   95 (257)
Q Consensus        53 i~C~~C~~~I~kG~rfNA~K~~v-g~-Y~st~I~~F~~kC~~C~~   95 (257)
                      ..|..|| |||-..+-+..--.. |. +-.+|.   ..+|+.|+.
T Consensus         2 y~C~~Cg-yiYd~~~Gd~~~~i~pGt~f~~Lp~---~w~CP~C~a   42 (50)
T cd00730           2 YECRICG-YIYDPAEGDPDEGIPPGTPFEDLPD---DWVCPVCGA   42 (50)
T ss_pred             cCCCCCC-eEECCCCCCcccCcCCCCCHhHCCC---CCCCCCCCC
Confidence            3699998 887744433322111 32 223332   468999976


No 76 
>PHA02998 RNA polymerase subunit; Provisional
Probab=31.50  E-value=11  Score=33.56  Aligned_cols=60  Identities=27%  Similarity=0.456  Sum_probs=41.6

Q ss_pred             ceeeeecCCCCccccccceeeeecc-cc--ccccceeeEEEEEEcCCCCc----eeEEeeC----CCCCCeeeccCc
Q psy10064         49 LPYNIWCEGCNNHIGMGVRYNAEKK-KV--GMYYSTPVYQFRMKCHLCDS----HFEIKTD----PGNLDYVIVSGA  114 (257)
Q Consensus        49 ~Pf~i~C~~C~~~I~kG~rfNA~K~-~v--g~Y~st~I~~F~~kC~~C~~----~i~i~TD----Pkn~dYv~~~Ga  114 (257)
                      +-|.|.|      |.+||-||-+|- .+  +.|+.+--=.-..+|+.|++    .+.++|-    |...-|.|..-+
T Consensus       108 ~lfgikc------v~~~veydid~~~d~~y~~yfnvlpkkt~v~CPkCg~~~A~f~qlQTRSADEPmT~FYkC~~CG  178 (195)
T PHA02998        108 LLFGIKC------IKKGVEYDIDKIPDVDYDDYFNVLDEKYNTPCPNCKSKNTTPMMIQTRAADEPPLVRHACRDCK  178 (195)
T ss_pred             HHHHHHH------HhcCCccchhhcccccchhheeccCcccCCCCCCCCCCceEEEEEeeccCCCCceEEEEcCCCC
Confidence            4577877      458999999984 35  47887533224589999976    4567776    556778876533


No 77 
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=31.39  E-value=38  Score=28.27  Aligned_cols=15  Identities=27%  Similarity=0.541  Sum_probs=10.0

Q ss_pred             eeeeecCCCCccccc
Q psy10064         50 PYNIWCEGCNNHIGM   64 (257)
Q Consensus        50 Pf~i~C~~C~~~I~k   64 (257)
                      |+--+|..|+..+-.
T Consensus        89 ~~~sRC~~CN~~L~~  103 (147)
T PF01927_consen   89 PIFSRCPKCNGPLRP  103 (147)
T ss_pred             CCCCccCCCCcEeee
Confidence            445688888875444


No 78 
>PF11793 FANCL_C:  FANCL C-terminal domain; PDB: 3K1L_A.
Probab=31.37  E-value=27  Score=25.78  Aligned_cols=16  Identities=19%  Similarity=0.331  Sum_probs=11.4

Q ss_pred             EEEcCCCCceeEEeeC
Q psy10064         87 RMKCHLCDSHFEIKTD  102 (257)
Q Consensus        87 ~~kC~~C~~~i~i~TD  102 (257)
                      ...||.|..+|++++|
T Consensus        55 ~G~CP~C~~~i~~~~~   70 (70)
T PF11793_consen   55 FGECPYCSSPISWSFS   70 (70)
T ss_dssp             EEE-TTT-SEEEGGG-
T ss_pred             ccCCcCCCCeeeEecC
Confidence            4689999999999876


No 79 
>KOG1296|consensus
Probab=31.33  E-value=20  Score=31.01  Aligned_cols=61  Identities=18%  Similarity=0.272  Sum_probs=33.0

Q ss_pred             ceeeeecCCCCccccccceee--eeccccccccceeeEEEEEEcCCCCceeEEeeCCC-CCCeeecc
Q psy10064         49 LPYNIWCEGCNNHIGMGVRYN--AEKKKVGMYYSTPVYQFRMKCHLCDSHFEIKTDPG-NLDYVIVS  112 (257)
Q Consensus        49 ~Pf~i~C~~C~~~I~kG~rfN--A~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~TDPk-n~dYv~~~  112 (257)
                      .=|.+.|..||+.--+=+=.|  -+-..-|. =|+  -+|-|||..|+.+-+|.-=|. +..|..+.
T Consensus        27 f~~kLkCtnCgE~~dkw~~I~l~E~~~~pg~-Rgt--a~~v~KCK~C~Rensv~iv~~~~~pyt~ed   90 (161)
T KOG1296|consen   27 FYLKLKCTNCGELSDKWQYITLNEEVAMPGS-RGT--ASFVMKCKFCSRENSVTIVAFEDKPYTAED   90 (161)
T ss_pred             eEEEeccccccccCCceEEEEeeeeecCCCC-cch--hhHhhhhhhhcccCcEEEecCCCCcccccc
Confidence            346789999999543322211  11111110 122  278999999998877654333 34444443


No 80 
>PRK08271 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=31.19  E-value=29  Score=36.15  Aligned_cols=34  Identities=29%  Similarity=0.740  Sum_probs=25.6

Q ss_pred             CCeeEEEEeceeeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCc
Q psy10064         40 MGIMIIRFELPYNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDS   95 (257)
Q Consensus        40 ~g~~~VRfe~Pf~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~   95 (257)
                      .++.=.-+-.||++ |..|| |++.|.                    ...||.|++
T Consensus       555 ~~i~Yf~in~~~~i-C~~CG-~~~~g~--------------------~~~CP~CGs  588 (623)
T PRK08271        555 TGCNYFAFNVKITI-CNDCH-HIDKRT--------------------GKRCPICGS  588 (623)
T ss_pred             cCCceEEeCCCCcc-CCCCC-CcCCCC--------------------CcCCcCCCC
Confidence            46777788888887 99999 554441                    278999987


No 81 
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=30.44  E-value=26  Score=32.87  Aligned_cols=24  Identities=21%  Similarity=0.274  Sum_probs=19.0

Q ss_pred             EEcCCCCceeEEeeCCCCCCeeecc
Q psy10064         88 MKCHLCDSHFEIKTDPGNLDYVIVS  112 (257)
Q Consensus        88 ~kC~~C~~~i~i~TDPkn~dYv~~~  112 (257)
                      .+||.|++ -.|-+|.+++++||..
T Consensus        12 ~~Cp~Cg~-~~iv~d~~~Ge~vC~~   35 (310)
T PRK00423         12 LVCPECGS-DKLIYDYERGEIVCAD   35 (310)
T ss_pred             CcCcCCCC-CCeeEECCCCeEeecc
Confidence            46999987 4788888888887776


No 82 
>PRK06260 threonine synthase; Validated
Probab=30.40  E-value=35  Score=32.90  Aligned_cols=35  Identities=20%  Similarity=0.425  Sum_probs=24.4

Q ss_pred             eeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEEeeCCC
Q psy10064         51 YNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIKTDPG  104 (257)
Q Consensus        51 f~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~TDPk  104 (257)
                      +.+.|..||....                   +..+..+|+.|++.+.+.-|..
T Consensus         2 ~~~~C~~cg~~~~-------------------~~~~~~~Cp~cg~~l~~~y~~~   36 (397)
T PRK06260          2 YWLKCIECGKEYD-------------------PDEIIYTCPECGGLLEVIYDLD   36 (397)
T ss_pred             CEEEECCCCCCCC-------------------CCCccccCCCCCCeEEEEecch
Confidence            3478999985422                   2223467999999999887754


No 83 
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=30.35  E-value=23  Score=26.10  Aligned_cols=13  Identities=31%  Similarity=0.710  Sum_probs=9.5

Q ss_pred             eeeecCCCCcccc
Q psy10064         51 YNIWCEGCNNHIG   63 (257)
Q Consensus        51 f~i~C~~C~~~I~   63 (257)
                      +.|+|-+||..|+
T Consensus         3 iPVRCFTCGkvi~   15 (60)
T PF01194_consen    3 IPVRCFTCGKVIG   15 (60)
T ss_dssp             -SSS-STTTSBTC
T ss_pred             CceecCCCCCChh
Confidence            5689999999886


No 84 
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=30.19  E-value=31  Score=34.21  Aligned_cols=28  Identities=21%  Similarity=0.529  Sum_probs=21.9

Q ss_pred             eecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEEee
Q psy10064         53 IWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIKT  101 (257)
Q Consensus        53 i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~T  101 (257)
                      -.|..||..-.+                     ++-+||.|..|=+|.-
T Consensus         8 y~C~~Cg~~~~~---------------------~~g~Cp~C~~w~t~~~   35 (454)
T TIGR00416         8 FVCQHCGADSPK---------------------WQGKCPACHAWNTITE   35 (454)
T ss_pred             EECCcCCCCCcc---------------------ccEECcCCCCccccch
Confidence            579999854333                     6789999999988875


No 85 
>cd02339 ZZ_Mind_bomb Zinc finger, ZZ type. Zinc finger present in Drosophila Mind bomb (D-mib) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Mind bomb is an E3 ubiqitin ligase that has been shown to regulate signaling by the Notch ligand Delta in Drosophila melanogaster.
Probab=29.98  E-value=28  Score=23.81  Aligned_cols=16  Identities=31%  Similarity=0.856  Sum_probs=10.3

Q ss_pred             eecCCCCcccccccee
Q psy10064         53 IWCEGCNNHIGMGVRY   68 (257)
Q Consensus        53 i~C~~C~~~I~kG~rf   68 (257)
                      |.|.+|+...-.|+||
T Consensus         1 i~Cd~C~~~~i~G~Ry   16 (45)
T cd02339           1 IICDTCRKQGIIGIRW   16 (45)
T ss_pred             CCCCCCCCCCcccCeE
Confidence            5788887655555443


No 86 
>PLN00032 DNA-directed RNA polymerase; Provisional
Probab=29.75  E-value=25  Score=26.74  Aligned_cols=14  Identities=29%  Similarity=0.608  Sum_probs=10.7

Q ss_pred             eeeecCCCCccccc
Q psy10064         51 YNIWCEGCNNHIGM   64 (257)
Q Consensus        51 f~i~C~~C~~~I~k   64 (257)
                      +.|+|=+||..|+-
T Consensus         3 iPVRCFTCGkvig~   16 (71)
T PLN00032          3 IPVRCFTCGKVIGN   16 (71)
T ss_pred             CceeecCCCCCcHH
Confidence            46889999987753


No 87 
>PRK12496 hypothetical protein; Provisional
Probab=29.63  E-value=32  Score=29.57  Aligned_cols=11  Identities=27%  Similarity=0.745  Sum_probs=7.1

Q ss_pred             EcCCCCceeEE
Q psy10064         89 KCHLCDSHFEI   99 (257)
Q Consensus        89 kC~~C~~~i~i   99 (257)
                      -|+.|++++.-
T Consensus       145 ~C~~CG~~~~r  155 (164)
T PRK12496        145 VCEICGSPVKR  155 (164)
T ss_pred             cCCCCCChhhh
Confidence            47777776643


No 88 
>PF13597 NRDD:  Anaerobic ribonucleoside-triphosphate reductase; PDB: 1HK8_A 1H78_A 1H7A_A 1H79_A 1H7B_A.
Probab=29.59  E-value=48  Score=33.74  Aligned_cols=33  Identities=33%  Similarity=0.630  Sum_probs=16.9

Q ss_pred             CeeEEEEeceeeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCce
Q psy10064         41 GIMIIRFELPYNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSH   96 (257)
Q Consensus        41 g~~~VRfe~Pf~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~   96 (257)
                      ++.-+.+-.||++ |..||-...                   +   ...||.|+++
T Consensus       481 ~i~Y~~in~~~~~-C~~CG~~~~-------------------~---~~~CP~CGs~  513 (546)
T PF13597_consen  481 GIPYFTINPPIDI-CPDCGYIGG-------------------E---GDKCPKCGSE  513 (546)
T ss_dssp             H-SEEEEE--EEE-ETTT---S------------------------EEE-CCC---
T ss_pred             CCCeEEEecCccc-ccCCCcCCC-------------------C---CCCCCCCCCc
Confidence            6777888889987 999984221                   1   4679999997


No 89 
>cd02338 ZZ_PCMF_like Zinc finger, ZZ type. Zinc finger present in potassium channel modulatory factor (PCMF) 1  and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Human potassium channel modulatory factor 1 or FIGC has been shown to possess intrinsic E3 ubiquitin ligase activity and to promote ubiquitination.
Probab=29.58  E-value=25  Score=24.26  Aligned_cols=7  Identities=43%  Similarity=1.545  Sum_probs=5.2

Q ss_pred             eecCCCC
Q psy10064         53 IWCEGCN   59 (257)
Q Consensus        53 i~C~~C~   59 (257)
                      |.|.+|+
T Consensus         1 i~C~~C~    7 (49)
T cd02338           1 VSCDGCG    7 (49)
T ss_pred             CCCCCCc
Confidence            5688886


No 90 
>cd00674 LysRS_core_class_I catalytic core domain of  class I lysyl tRNA synthetase. Class I lysyl tRNA synthetase (LysRS) catalytic core domain. This class I enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. The class I LysRS is found only in archaea and some bacteria and has evolved separately from class II LysRS, as the two do not share structural or sequence similarity.
Probab=29.57  E-value=48  Score=32.05  Aligned_cols=11  Identities=36%  Similarity=1.147  Sum_probs=10.6

Q ss_pred             ceeeeecCCCC
Q psy10064         49 LPYNIWCEGCN   59 (257)
Q Consensus        49 ~Pf~i~C~~C~   59 (257)
                      .||+..|..||
T Consensus       166 ~P~~p~c~~cg  176 (353)
T cd00674         166 YPFMPYCEKCG  176 (353)
T ss_pred             eeeeeecCCcC
Confidence            79999999999


No 91 
>COG5134 Uncharacterized conserved protein [Function unknown]
Probab=29.45  E-value=20  Score=32.97  Aligned_cols=19  Identities=26%  Similarity=0.765  Sum_probs=15.4

Q ss_pred             cccceeeEEEEEEcCCCCceeE
Q psy10064         77 MYYSTPVYQFRMKCHLCDSHFE   98 (257)
Q Consensus        77 ~Y~st~I~~F~~kC~~C~~~i~   98 (257)
                      .-|-||   |.|+|-.|.+.|-
T Consensus        35 iRL~TP---F~~RCL~C~~YI~   53 (272)
T COG5134          35 IRLETP---FPVRCLNCENYIQ   53 (272)
T ss_pred             EEeccC---cceeecchhhhhh
Confidence            455666   9999999999883


No 92 
>PRK07111 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=29.08  E-value=37  Score=35.99  Aligned_cols=33  Identities=27%  Similarity=0.539  Sum_probs=23.6

Q ss_pred             CCeeEEEEeceeeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCc
Q psy10064         40 MGIMIIRFELPYNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDS   95 (257)
Q Consensus        40 ~g~~~VRfe~Pf~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~   95 (257)
                      .|+.-+-+-.||++ |..|| |++-                     +...||.|++
T Consensus       669 ~~i~Y~sin~~~~~-C~~CG-~~~~---------------------~~~~CP~CG~  701 (735)
T PRK07111        669 TNIGYGSINHPVDR-CPVCG-YLGV---------------------IEDKCPKCGS  701 (735)
T ss_pred             CCCceEEeCCCCee-cCCCC-CCCC---------------------cCccCcCCCC
Confidence            36666777778876 99998 4332                     1278999997


No 93 
>KOG2636|consensus
Probab=29.04  E-value=17  Score=36.60  Aligned_cols=31  Identities=29%  Similarity=0.528  Sum_probs=23.7

Q ss_pred             eeecCCCCccccccce-----eeeecccccc-cccee
Q psy10064         52 NIWCEGCNNHIGMGVR-----YNAEKKKVGM-YYSTP   82 (257)
Q Consensus        52 ~i~C~~C~~~I~kG~r-----fNA~K~~vg~-Y~st~   82 (257)
                      .-.|.-||+|.|+|.|     ||-.+-.-|. .||||
T Consensus       401 ey~CEICGNy~Y~GrkaF~RHF~EwRH~hGmrCLGIp  437 (497)
T KOG2636|consen  401 EYNCEICGNYVYKGRKAFDRHFNEWRHAHGMRCLGIP  437 (497)
T ss_pred             ccceeeccCccccCcHHHHHHhHHHHHhhcceecCCC
Confidence            3579999999999965     7777766673 66665


No 94 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=28.82  E-value=32  Score=23.14  Aligned_cols=11  Identities=27%  Similarity=0.721  Sum_probs=6.7

Q ss_pred             ecCCCCccccc
Q psy10064         54 WCEGCNNHIGM   64 (257)
Q Consensus        54 ~C~~C~~~I~k   64 (257)
                      .|..||+.++.
T Consensus         2 FCp~Cg~~l~~   12 (52)
T smart00661        2 FCPKCGNMLIP   12 (52)
T ss_pred             CCCCCCCcccc
Confidence            36777775543


No 95 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=28.54  E-value=43  Score=28.74  Aligned_cols=55  Identities=18%  Similarity=0.292  Sum_probs=29.7

Q ss_pred             eecCCCCcc--ccccceeeeeccccccccceeeEEEEEEcCCCCceeE-EeeCCCCCCeeeccCcee
Q psy10064         53 IWCEGCNNH--IGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFE-IKTDPGNLDYVIVSGARR  116 (257)
Q Consensus        53 i~C~~C~~~--I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~-i~TDPkn~dYv~~~Ga~r  116 (257)
                      |.|..||..  ...-.++++.        |--|=+| -.|++|+..+. +.+=-..--+|+-..++.
T Consensus         1 m~cp~c~~~~~~~~~s~~~~~--------~~~~~~~-~~c~~c~~~f~~~e~~~~~~i~VIKRDG~~   58 (154)
T PRK00464          1 MRCPFCGHPDTRVIDSRPAED--------GNAIRRR-RECLACGKRFTTFERVELVPLLVIKKDGRR   58 (154)
T ss_pred             CcCCCCCCCCCEeEeccccCC--------CCceeee-eeccccCCcceEeEeccCcccEEEecCCcC
Confidence            679999852  2222222222        1135566 78999987653 333333334566655554


No 96 
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=27.61  E-value=42  Score=32.50  Aligned_cols=17  Identities=18%  Similarity=0.397  Sum_probs=14.3

Q ss_pred             EEEEcCCCCceeEEeeC
Q psy10064         86 FRMKCHLCDSHFEIKTD  102 (257)
Q Consensus        86 F~~kC~~C~~~i~i~TD  102 (257)
                      +.-+||.|..|=+|.-.
T Consensus        13 ~~g~cp~c~~w~~~~e~   29 (372)
T cd01121          13 WLGKCPECGEWNTLVEE   29 (372)
T ss_pred             ccEECcCCCCceeeeeh
Confidence            56899999999888764


No 97 
>PHA03082 DNA-dependent RNA polymerase subunit; Provisional
Probab=27.21  E-value=31  Score=25.42  Aligned_cols=16  Identities=13%  Similarity=0.655  Sum_probs=12.7

Q ss_pred             ceeeeecCCCCccccc
Q psy10064         49 LPYNIWCEGCNNHIGM   64 (257)
Q Consensus        49 ~Pf~i~C~~C~~~I~k   64 (257)
                      |=|.+.|.+||.-|.-
T Consensus         1 MVf~lVCsTCGrDlSe   16 (63)
T PHA03082          1 MVFQLVCSTCGRDLSE   16 (63)
T ss_pred             CeeeeeecccCcchhH
Confidence            5588999999986653


No 98 
>PF13790 DUF4182:  Domain of unknown function (DUF4182)
Probab=27.12  E-value=81  Score=21.23  Aligned_cols=30  Identities=30%  Similarity=0.698  Sum_probs=19.1

Q ss_pred             eeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCC
Q psy10064         52 NIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCD   94 (257)
Q Consensus        52 ~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~   94 (257)
                      .|.|.+|+..|.-   |-          +-++=-||-.|..|.
T Consensus         3 tIvCq~C~~~Id~---~e----------~ekV~~lYg~C~~~e   32 (38)
T PF13790_consen    3 TIVCQHCNETIDH---FE----------TEKVTTLYGKCGKCE   32 (38)
T ss_pred             EEEeccccceeee---ec----------CCcEEEEEEECCCCc
Confidence            4789999887754   22          223444667787664


No 99 
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=26.61  E-value=38  Score=23.06  Aligned_cols=19  Identities=26%  Similarity=0.452  Sum_probs=15.6

Q ss_pred             EcCCCCceeEEeeCCCCCC
Q psy10064         89 KCHLCDSHFEIKTDPGNLD  107 (257)
Q Consensus        89 kC~~C~~~i~i~TDPkn~d  107 (257)
                      +||.|++...|+|-..-+.
T Consensus         1 ~CP~Cg~~a~ir~S~~~s~   19 (47)
T PF04606_consen    1 RCPHCGSKARIRTSRQLSP   19 (47)
T ss_pred             CcCCCCCeeEEEEchhhCc
Confidence            5999999999998776543


No 100
>PF00569 ZZ:  Zinc finger, ZZ type;  InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZZ-type zinc finger domains, named because of their ability to bind two zinc ions []. These domains contain 4-6 Cys residues that participate in zinc binding (plus additional Ser/His residues), including a Cys-X2-Cys motif found in other zinc finger domains. These zinc fingers are thought to be involved in protein-protein interactions. The structure of the ZZ domain shows that it belongs to the family of cross-brace zinc finger motifs that include the PHD, RING, and FYVE domains []. ZZ-type zinc finger domains are found in:   Transcription factors P300 and CBP. Plant proteins involved in light responses, such as Hrb1. E3 ubiquitin ligases MEX and MIB2 (6.3.2 from EC). Dystrophin and its homologues.   Single copies of the ZZ zinc finger occur in the transcriptional adaptor/coactivator proteins P300, in cAMP response element-binding protein (CREB)-binding protein (CBP) and ADA2. CBP provides several binding sites for transcriptional coactivators. The site of interaction with the tumour suppressor protein p53 and the oncoprotein E1A with CBP/P300 is a Cys-rich region that incorporates two zinc-binding motifs: ZZ-type and TAZ2-type. The ZZ-type zinc finger of CBP contains two twisted anti-parallel beta-sheets and a short alpha-helix, and binds two zinc ions []. One zinc ion is coordinated by four cysteine residues via 2 Cys-X2-Cys motifs, and the third zinc ion via a third Cys-X-Cys motif and a His-X-His motif. The first zinc cluster is strictly conserved, whereas the second zinc cluster displays variability in the position of the two His residues. In Arabidopsis thaliana (Mouse-ear cress), the hypersensitive to red and blue 1 (Hrb1) protein, which regulating both red and blue light responses, contains a ZZ-type zinc finger domain [].  ZZ-type zinc finger domains have also been identified in the testis-specific E3 ubiquitin ligase MEX that promotes death receptor-induced apoptosis []. MEX has four putative zinc finger domains: one ZZ-type, one SWIM-type and two RING-type. The region containing the ZZ-type and RING-type zinc fingers is required for interaction with UbcH5a and MEX self-association, whereas the SWIM domain was critical for MEX ubiquitination. In addition, the Cys-rich domains of dystrophin, utrophin and an 87kDa post-synaptic protein contain a ZZ-type zinc finger with high sequence identity to P300/CBP ZZ-type zinc fingers. In dystrophin and utrophin, the ZZ-type zinc finger lies between a WW domain (flanked by and EF hand) and the C-terminal coiled-coil domain. Dystrophin is thought to act as a link between the actin cytoskeleton and the extracellular matrix, and perturbations of the dystrophin-associated complex, for example, between dystrophin and the transmembrane glycoprotein beta-dystroglycan, may lead to muscular dystrophy. Dystrophin and its autosomal homologue utrophin interact with beta-dystroglycan via their C-terminal regions, which are comprised of a WW domain, an EF hand domain and a ZZ-type zinc finger domain []. The WW domain is the primary site of interaction between dystrophin or utrophin and dystroglycan, while the EF hand and ZZ-type zinc finger domains stabilise and strengthen this interaction.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1TOT_A 2DIP_A 2FC7_A 2E5R_A.
Probab=26.54  E-value=35  Score=23.08  Aligned_cols=19  Identities=37%  Similarity=0.819  Sum_probs=10.3

Q ss_pred             eeeecCCCCccccccceee
Q psy10064         51 YNIWCEGCNNHIGMGVRYN   69 (257)
Q Consensus        51 f~i~C~~C~~~I~kG~rfN   69 (257)
                      ..+.|.+|+...-.|+||-
T Consensus         3 ~~~~C~~C~~~~i~g~Ry~   21 (46)
T PF00569_consen    3 HGYTCDGCGTDPIIGVRYH   21 (46)
T ss_dssp             SSCE-SSS-SSSEESSEEE
T ss_pred             CCeECcCCCCCcCcCCeEE
Confidence            3578999987444455443


No 101
>PF14353 CpXC:  CpXC protein
Probab=26.13  E-value=38  Score=27.30  Aligned_cols=40  Identities=28%  Similarity=0.686  Sum_probs=25.7

Q ss_pred             eecCCCCcccc--ccceeeeec-----ccc--ccccceeeEEEEEEcCCCCceeEE
Q psy10064         53 IWCEGCNNHIG--MGVRYNAEK-----KKV--GMYYSTPVYQFRMKCHLCDSHFEI   99 (257)
Q Consensus        53 i~C~~C~~~I~--kG~rfNA~K-----~~v--g~Y~st~I~~F~~kC~~C~~~i~i   99 (257)
                      |.|.+|+....  -=+-.|+..     +.|  |++       |.+.||.|+..+.+
T Consensus         2 itCP~C~~~~~~~v~~~I~~~~~p~l~e~il~g~l-------~~~~CP~Cg~~~~~   50 (128)
T PF14353_consen    2 ITCPHCGHEFEFEVWTSINADEDPELKEKILDGSL-------FSFTCPSCGHKFRL   50 (128)
T ss_pred             cCCCCCCCeeEEEEEeEEcCcCCHHHHHHHHcCCc-------CEEECCCCCCceec
Confidence            67999988421  124556543     233  443       46789999998876


No 102
>KOG4253|consensus
Probab=26.00  E-value=2.7e+02  Score=24.47  Aligned_cols=53  Identities=15%  Similarity=0.267  Sum_probs=34.2

Q ss_pred             ccccchhhhHHHHHHHHHHH-HHhhhccChHHHHHHHHHHHHHHHHHHHHHHHh
Q psy10064        151 GTNDMSSSKSKASHLNKLLD-RQESVWKNDFDANRVLRDSFRKKKKQLKALQDK  203 (257)
Q Consensus       151 ~~~d~~~~~~~~~~L~eL~~-~~~~~~~ddy~~n~~LR~~fR~~kk~~~~~~~~  203 (257)
                      ..+|.+++.+...+|.++.+ +|.--..|.|+.-++|-+....--++.+-+-+.
T Consensus        39 ~nkdakk~~q~~~ei~dmKqelnavs~qD~fAkwaRlnRKi~kl~~ele~qs~n   92 (175)
T KOG4253|consen   39 GNKDAKKESQKVAEIQDMKQELNAVSMQDNFAKWARLNRKINKLDKELETQSKN   92 (175)
T ss_pred             cchhHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            35566666667777777754 444455789988888877766555555544443


No 103
>PRK11788 tetratricopeptide repeat protein; Provisional
Probab=25.68  E-value=45  Score=30.55  Aligned_cols=14  Identities=21%  Similarity=0.487  Sum_probs=10.7

Q ss_pred             EEEEcCCCCceeEE
Q psy10064         86 FRMKCHLCDSHFEI   99 (257)
Q Consensus        86 F~~kC~~C~~~i~i   99 (257)
                      ++..||.|+++=++
T Consensus       367 ~~~~c~~c~~~~~~  380 (389)
T PRK11788        367 LYWHCPSCKAWETI  380 (389)
T ss_pred             ceeECcCCCCccCc
Confidence            56789999886554


No 104
>PRK05978 hypothetical protein; Provisional
Probab=25.57  E-value=25  Score=30.13  Aligned_cols=33  Identities=15%  Similarity=0.479  Sum_probs=24.5

Q ss_pred             eeeecCCCCc-cccccceeeeeccccccccceeeEEEEEEcCCCCceeEEe
Q psy10064         51 YNIWCEGCNN-HIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIK  100 (257)
Q Consensus        51 f~i~C~~C~~-~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~  100 (257)
                      +..+|-.||+ .+++            .||.+     .-+|+.|+-.+++.
T Consensus        32 l~grCP~CG~G~LF~------------g~Lkv-----~~~C~~CG~~~~~~   65 (148)
T PRK05978         32 FRGRCPACGEGKLFR------------AFLKP-----VDHCAACGEDFTHH   65 (148)
T ss_pred             HcCcCCCCCCCcccc------------ccccc-----CCCccccCCccccC
Confidence            4578999986 4555            35554     47899999988776


No 105
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=25.44  E-value=29  Score=29.48  Aligned_cols=12  Identities=17%  Similarity=0.822  Sum_probs=8.3

Q ss_pred             eeeecCCCCccc
Q psy10064         51 YNIWCEGCNNHI   62 (257)
Q Consensus        51 f~i~C~~C~~~I   62 (257)
                      +.++|..|+...
T Consensus       104 ~~~~C~~C~~~~  115 (178)
T PF02146_consen  104 FRLRCSKCGKEY  115 (178)
T ss_dssp             EEEEETTTSBEE
T ss_pred             ceeeecCCCccc
Confidence            457888887743


No 106
>PF04828 GFA:  Glutathione-dependent formaldehyde-activating enzyme;  InterPro: IPR006913 The GFA family consists mainly of glutathione-dependent formaldehyde-activating enzymes, but also includes centromere protein V and a fission yeast protein described as uncharacterised lyase. Glutathione-dependent formaldehyde-activating enzyme catalyse the condensation of formaldehyde and glutathione to S-hydroxymethylglutathione.  All known members of this family contain 5 strongly conserved cysteine residues.; GO: 0016846 carbon-sulfur lyase activity, 0008152 metabolic process; PDB: 3FAC_B 1XA8_A 1X6M_B.
Probab=25.24  E-value=95  Score=22.49  Aligned_cols=39  Identities=26%  Similarity=0.308  Sum_probs=21.4

Q ss_pred             cccccc-ceeeEEEEEEcCCCCceeEEeeCCCCCCeeeccCc
Q psy10064         74 KVGMYY-STPVYQFRMKCHLCDSHFEIKTDPGNLDYVIVSGA  114 (257)
Q Consensus        74 ~vg~Y~-st~I~~F~~kC~~C~~~i~i~TDPkn~dYv~~~Ga  114 (257)
                      .+..|- +.+--. +.-|+.|+..|... ++...+++.+..+
T Consensus        35 ~l~~y~~s~~~~~-r~FC~~CGs~l~~~-~~~~~~~~~V~~g   74 (92)
T PF04828_consen   35 NLKEYQFSGKGVE-RYFCPTCGSPLFSE-DERDPDLVGVNAG   74 (92)
T ss_dssp             GEEEC--TTSSCE-EEEETTT--EEEEE-ESSTTTEEEEEGG
T ss_pred             cceEEEeCCCcCc-CcccCCCCCeeecc-cCCCCCEEEEEeE
Confidence            444565 333333 47899999999988 5555555555443


No 107
>PF05973 Gp49:  Phage derived protein Gp49-like (DUF891);  InterPro: IPR009241 This entry consists of several hypothetical viral and bacterial proteins some are annotated as addiction module killer proteins.
Probab=25.11  E-value=1.1e+02  Score=23.00  Aligned_cols=41  Identities=15%  Similarity=0.176  Sum_probs=34.1

Q ss_pred             ccc-eeeEEEEEEcCCCCceeEEeeCCCCCCeeeccCceeccc
Q psy10064         78 YYS-TPVYQFRMKCHLCDSHFEIKTDPGNLDYVIVSGARRQEN  119 (257)
Q Consensus        78 Y~s-t~I~~F~~kC~~C~~~i~i~TDPkn~dYv~~~Ga~r~~e  119 (257)
                      ++. ..||.+++.+.....-+.|-.+..+ .+|+.+|..++.+
T Consensus        35 ~l~~~~i~ElR~~~~~~~~Ri~y~~~~~~-~ivll~~f~Kkt~   76 (91)
T PF05973_consen   35 HLKGDGIYELRVRGGSNIYRILYFFDGGD-IIVLLHGFIKKTQ   76 (91)
T ss_pred             ccCcCCeEEEEEeecCCcceEEEEEcCcc-EEEEEEEEEeCCC
Confidence            344 7899999999998888999998888 7888888888754


No 108
>PF00645 zf-PARP:  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region;  InterPro: IPR001510 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents PARP (Poly(ADP) polymerase) type zinc finger domains. NAD(+) ADP-ribosyltransferase(2.4.2.30 from EC) [, ] is a eukaryotic enzyme that catalyses the covalent attachment of ADP-ribose units from NAD(+) to various nuclear acceptor proteins. This post-translational modification of nuclear proteins is dependent on DNA. It appears to be involved in the regulation of various important cellular processes such as differentiation, proliferation and tumour transformation as well as in the regulation of the molecular events involved in the recovery of the cell from DNA damage. Structurally, NAD(+) ADP-ribosyltransferase consists of three distinct domains: an N-terminal zinc-dependent DNA-binding domain, a central automodification domain and a C-terminal NAD-binding domain. The DNA-binding region contains a pair of PARP-type zinc finger domains which have been shown to bind DNA in a zinc-dependent manner. The PARP-type zinc finger domains seem to bind specifically to single-stranded DNA and to act as a DNA nick sensor. DNA ligase III [] contains, in its N-terminal section, a single copy of a zinc finger highly similar to those of PARP. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 1UW0_A 3OD8_D 3ODA_A 4AV1_A 2DMJ_A 4DQY_D 2L30_A 2CS2_A 2L31_A 3ODE_B ....
Probab=25.07  E-value=34  Score=25.41  Aligned_cols=14  Identities=36%  Similarity=0.869  Sum_probs=11.1

Q ss_pred             eecCCCCccccccc
Q psy10064         53 IWCEGCNNHIGMGV   66 (257)
Q Consensus        53 i~C~~C~~~I~kG~   66 (257)
                      -.|.+|+..|.+|.
T Consensus         8 a~Ck~C~~~I~kg~   21 (82)
T PF00645_consen    8 AKCKGCKKKIAKGE   21 (82)
T ss_dssp             EBETTTSCBE-TTS
T ss_pred             ccCcccCCcCCCCC
Confidence            36999999999984


No 109
>PRK03954 ribonuclease P protein component 4; Validated
Probab=24.70  E-value=77  Score=26.31  Aligned_cols=42  Identities=19%  Similarity=0.397  Sum_probs=27.6

Q ss_pred             eecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEEe
Q psy10064         53 IWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIK  100 (257)
Q Consensus        53 i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~  100 (257)
                      .+|..|+.++--|+  |+.-+..+.=+   . .+.+.|..|+..--|.
T Consensus        65 ~~CK~C~t~LiPG~--n~~vRi~~~~~---~-~vvitCl~CG~~kR~P  106 (121)
T PRK03954         65 RYCKRCHSFLVPGV--NARVRLRQKRM---P-HVVITCLECGHIMRYP  106 (121)
T ss_pred             HHhhcCCCeeecCC--ceEEEEecCCc---c-eEEEECccCCCEEeec
Confidence            47999999988884  55544332101   1 2678999999865543


No 110
>TIGR03844 cysteate_syn cysteate synthase. Members of this family are cysteate synthase, an enzyme of alternate pathway to sulfopyruvate, a precursor of coenzyme M.
Probab=24.65  E-value=58  Score=31.76  Aligned_cols=34  Identities=18%  Similarity=0.497  Sum_probs=23.4

Q ss_pred             eeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEEeeCCC
Q psy10064         51 YNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIKTDPG  104 (257)
Q Consensus        51 f~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~TDPk  104 (257)
                      |++.|..||.... .                 -  +..+|+.|.+.+.+.-|+.
T Consensus         1 ~~l~C~~Cg~~~~-~-----------------~--~~~~C~~c~g~l~~~y~~~   34 (398)
T TIGR03844         1 YTLRCPGCGEVLP-D-----------------H--YTLSCPLDCGLLRAEYAER   34 (398)
T ss_pred             CEEEeCCCCCccC-C-----------------c--cccCCCCCCCceEEeeccc
Confidence            5688999975322 1                 1  2367999989998887753


No 111
>PRK04023 DNA polymerase II large subunit; Validated
Probab=24.46  E-value=38  Score=37.33  Aligned_cols=19  Identities=16%  Similarity=0.457  Sum_probs=13.1

Q ss_pred             CCeeEEEEeceeeeecCCCCcc
Q psy10064         40 MGIMIIRFELPYNIWCEGCNNH   61 (257)
Q Consensus        40 ~g~~~VRfe~Pf~i~C~~C~~~   61 (257)
                      .|.+.|....+   .|..||..
T Consensus       617 ~g~~eVEVg~R---fCpsCG~~  635 (1121)
T PRK04023        617 KGTIEVEIGRR---KCPSCGKE  635 (1121)
T ss_pred             CCceeecccCc---cCCCCCCc
Confidence            46666665554   49999887


No 112
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones]
Probab=24.20  E-value=1.8e+02  Score=28.60  Aligned_cols=59  Identities=20%  Similarity=0.462  Sum_probs=38.8

Q ss_pred             EEEEeceeeeecCCCCccccccceeeeecccc------cccc-c--eeeEEEEEEcCCCCceeEEeeCCCC
Q psy10064         44 IIRFELPYNIWCEGCNNHIGMGVRYNAEKKKV------GMYY-S--TPVYQFRMKCHLCDSHFEIKTDPGN  105 (257)
Q Consensus        44 ~VRfe~Pf~i~C~~C~~~I~kG~rfNA~K~~v------g~Y~-s--t~I~~F~~kC~~C~~~i~i~TDPkn  105 (257)
                      ++.+.+|-.+-|.+|.-.   |.+-.+..++-      |... .  +-+|.+...|+.|.+.=.+-.||=.
T Consensus       134 ~~~i~~~~~~~C~~C~Gs---Gak~gt~~~tC~tC~G~G~v~~~~~~g~~~~~~~C~~C~G~G~~i~~pC~  201 (371)
T COG0484         134 KKEIRVTRSVTCSTCHGS---GAKPGTDPKTCPTCNGSGQVRTVQRTGFFSFQQTCPTCNGTGKIIKDPCG  201 (371)
T ss_pred             eeeEecceeeECCcCCCC---CCCCCCCCCcCCCCCCcCeEEEEEeeeEEEEEEECCCCccceeECCCCCC
Confidence            466788999999999754   33333222211      2111 1  1578999999999988888788754


No 113
>TIGR02487 NrdD anaerobic ribonucleoside-triphosphate reductase. This model represents the oxygen-sensitive (anaerobic, class III) ribonucleotide reductase. The mechanism of the enzyme involves a glycine-centered radical, a C-terminal zinc binding site, and a set of conserved active site cysteines and asparagines. This enzyme requires an activating component, NrdG, a radical-SAM domain containing enzyme (TIGR02491). Together the two form an alpha-2/beta-2 heterodimer.
Probab=24.01  E-value=53  Score=33.69  Aligned_cols=35  Identities=37%  Similarity=0.776  Sum_probs=25.5

Q ss_pred             CCeeEEEEeceeeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCce
Q psy10064         40 MGIMIIRFELPYNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSH   96 (257)
Q Consensus        40 ~g~~~VRfe~Pf~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~   96 (257)
                      .|+.-+-+-.|+++ |..|| |++.+.                    ...||.|++.
T Consensus       513 ~~i~Y~~~n~~~~~-C~~CG-~~g~~~--------------------~~~CP~Cgs~  547 (579)
T TIGR02487       513 NGIGYFGINPPVDV-CEDCG-YTGEGL--------------------NDKCPKCGSH  547 (579)
T ss_pred             cCCceEEeccCCcc-CCCCC-CCCCCC--------------------CCcCcCCCCc
Confidence            46777888888887 99998 354431                    1679999973


No 114
>cd02344 ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present in HERC2 and related proteins. HERC2 is a potential E3 ubiquitin protein ligase and/or guanine nucleotide exchange factor. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=23.83  E-value=43  Score=23.06  Aligned_cols=15  Identities=33%  Similarity=0.678  Sum_probs=8.7

Q ss_pred             eecCCCCccccccce
Q psy10064         53 IWCEGCNNHIGMGVR   67 (257)
Q Consensus        53 i~C~~C~~~I~kG~r   67 (257)
                      |.|.+|+...-.|.|
T Consensus         1 V~Cd~C~~~pI~G~R   15 (45)
T cd02344           1 VTCDGCQMFPINGPR   15 (45)
T ss_pred             CCCCCCCCCCCccCe
Confidence            468888655444433


No 115
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=23.52  E-value=1.1e+02  Score=27.26  Aligned_cols=12  Identities=17%  Similarity=0.346  Sum_probs=9.4

Q ss_pred             ceeeeecCCCCc
Q psy10064         49 LPYNIWCEGCNN   60 (257)
Q Consensus        49 ~Pf~i~C~~C~~   60 (257)
                      -|=+..|..||.
T Consensus       306 ~~tS~~C~~cg~  317 (364)
T COG0675         306 YYTSKTCPCCGH  317 (364)
T ss_pred             CCCcccccccCC
Confidence            344589999998


No 116
>COG5525 Bacteriophage tail assembly protein [General function prediction only]
Probab=23.49  E-value=52  Score=34.20  Aligned_cols=60  Identities=17%  Similarity=0.326  Sum_probs=35.5

Q ss_pred             eeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEEeeCCCCCCeeeccCcee
Q psy10064         51 YNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIKTDPGNLDYVIVSGARR  116 (257)
Q Consensus        51 f~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~TDPkn~dYv~~~Ga~r  116 (257)
                      |-+-|.|||++.+-  +|+-.---.|. ..++-=..++.|++|...|.=+   -|+.+|+..-+-+
T Consensus       226 ~yvpCPHCGe~q~l--~~~e~~~~~g~-~~~~~~~~~~~c~h~~~~i~~~---~~~~gv~~~~g~~  285 (611)
T COG5525         226 FYVPCPHCGEEQQL--KFGEKSGPRGL-KDTPAEAAFIQCEHCGCVIRPK---LNGRGVCLRTGEW  285 (611)
T ss_pred             EEeeCCCCCchhhc--cccccCCCcCc-ccchhhhhhhhccccCceeeee---ccCccchhccCCc
Confidence            78899999996443  12111111111 0122233468899999988875   7888887664433


No 117
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=23.24  E-value=86  Score=20.62  Aligned_cols=35  Identities=14%  Similarity=0.485  Sum_probs=16.8

Q ss_pred             eecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEEe
Q psy10064         53 IWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIK  100 (257)
Q Consensus        53 i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~  100 (257)
                      ++|..|+.||--=.+|+-.-+             ..+|..|...-.|.
T Consensus         3 ~rC~~C~aylNp~~~~~~~~~-------------~w~C~~C~~~N~lp   37 (40)
T PF04810_consen    3 VRCRRCRAYLNPFCQFDDGGK-------------TWICNFCGTKNPLP   37 (40)
T ss_dssp             -B-TTT--BS-TTSEEETTTT-------------EEEETTT--EEE--
T ss_pred             cccCCCCCEECCcceEcCCCC-------------EEECcCCCCcCCCC
Confidence            789999999876555543211             36788888755543


No 118
>PRK07591 threonine synthase; Validated
Probab=23.19  E-value=54  Score=32.00  Aligned_cols=16  Identities=25%  Similarity=0.426  Sum_probs=13.7

Q ss_pred             EEcCCCCceeEEeeCC
Q psy10064         88 MKCHLCDSHFEIKTDP  103 (257)
Q Consensus        88 ~kC~~C~~~i~i~TDP  103 (257)
                      .+|+.|++.+.+.-|.
T Consensus        34 ~~C~~cg~~l~~~y~~   49 (421)
T PRK07591         34 HVCEECFGPLEVAYDY   49 (421)
T ss_pred             ccCCCCCCeEEEEech
Confidence            6799999999998764


No 119
>PF04690 YABBY:  YABBY protein;  InterPro: IPR006780 YABBY proteins are a group of plant-specific transcription factors involved in the specification of abaxial polarity in lateral organs such as leaves and floral organs [, ].
Probab=23.04  E-value=50  Score=28.99  Aligned_cols=38  Identities=21%  Similarity=0.542  Sum_probs=28.4

Q ss_pred             eeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEEe
Q psy10064         52 NIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIK  100 (257)
Q Consensus        52 ~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~  100 (257)
                      -|.|+-|+..++-||-.++-=..|           +.+|-.|.+-+.+-
T Consensus        12 YVhCnFC~TiLaVsVP~ssL~~~V-----------TVRCGHCtNLLSVN   49 (170)
T PF04690_consen   12 YVHCNFCNTILAVSVPCSSLLKTV-----------TVRCGHCTNLLSVN   49 (170)
T ss_pred             EEEcCCcCeEEEEecchhhhhhhh-----------ceeccCccceeeee
Confidence            378999999999887666533333           47899999988854


No 120
>PF04899 MbeD_MobD:  MbeD/MobD like ;  InterPro: IPR006983 The MbeD and MobD proteins are plasmid encoded, and are involved in the plasmid mobilisation and transfer in the presence of conjugative plasmids [].
Probab=23.02  E-value=2.2e+02  Score=21.43  Aligned_cols=45  Identities=22%  Similarity=0.474  Sum_probs=27.8

Q ss_pred             HHHHHHHHHHHHHhhhccChHHHHHHHHHHHHHHHHHHHHHHHhHHHH
Q psy10064        160 SKASHLNKLLDRQESVWKNDFDANRVLRDSFRKKKKQLKALQDKDNAL  207 (257)
Q Consensus       160 ~~~~~L~eL~~~~~~~~~ddy~~n~~LR~~fR~~kk~~~~~~~~d~al  207 (257)
                      .+.+.|+.=.......|.+.|..   |+..|-..+++.....+.-..|
T Consensus        10 ~ale~Lq~~y~~q~~~Wq~sy~~---Lq~~~~~t~~~~a~L~~qv~~L   54 (70)
T PF04899_consen   10 SALEELQQSYEKQQQEWQSSYAD---LQHMFEQTSQENAALSEQVNNL   54 (70)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHhHHHHHHHHHHHHHH
Confidence            34555555566677789999965   6777766665555444444433


No 121
>COG2023 RPR2 RNase P subunit RPR2 [Translation, ribosomal structure and biogenesis]
Probab=22.97  E-value=1e+02  Score=25.16  Aligned_cols=46  Identities=24%  Similarity=0.376  Sum_probs=31.5

Q ss_pred             EEeceeee---ecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEEe
Q psy10064         46 RFELPYNI---WCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIK  100 (257)
Q Consensus        46 Rfe~Pf~i---~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~  100 (257)
                      +..+|=.+   .|.+|...+.-|+  |++.+-.+.+       -.+.|..|+...-|.
T Consensus        47 rv~lp~~iKR~~CkkC~t~Lvpg~--n~rvR~~~~~-------v~vtC~~CG~~~R~p   95 (105)
T COG2023          47 RVRLPREIKRTICKKCYTPLVPGK--NARVRLRKGR-------VVVTCLECGTIRRYP   95 (105)
T ss_pred             ccccCHHHHHHhccccCcccccCc--ceEEEEcCCe-------EEEEecCCCcEEEec
Confidence            34456554   6999999877774  7776666544       457899998866553


No 122
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=22.67  E-value=33  Score=22.02  Aligned_cols=13  Identities=23%  Similarity=0.654  Sum_probs=8.6

Q ss_pred             EEcCCCCceeEEe
Q psy10064         88 MKCHLCDSHFEIK  100 (257)
Q Consensus        88 ~kC~~C~~~i~i~  100 (257)
                      ++|+.|+..|-++
T Consensus        18 irC~~CG~RIlyK   30 (32)
T PF03604_consen   18 IRCPECGHRILYK   30 (32)
T ss_dssp             SSBSSSS-SEEBE
T ss_pred             EECCcCCCeEEEe
Confidence            5788887777665


No 123
>PRK00807 50S ribosomal protein L24e; Validated
Probab=22.58  E-value=28  Score=24.54  Aligned_cols=43  Identities=21%  Similarity=0.443  Sum_probs=28.5

Q ss_pred             ecCCCCcccccc--ceeeeeccccccccceeeEEEEEEcCCCCceeEEeeCCCCC
Q psy10064         54 WCEGCNNHIGMG--VRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIKTDPGNL  106 (257)
Q Consensus        54 ~C~~C~~~I~kG--~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~TDPkn~  106 (257)
                      .|.-||.-|+-|  ..|=..   -|     +  .|+|-|..|...+-.+.+|..-
T Consensus         3 ~C~fcG~~I~pg~G~~~vr~---Dg-----k--v~~Fcs~KC~~~f~~~~nprk~   47 (52)
T PRK00807          3 TCSFCGKEIEPGTGKMYVKK---DG-----T--ILYFCSSKCEKNYKLGRVPRKL   47 (52)
T ss_pred             ccCCCCCeEcCCCCeEEEEe---CC-----c--EEEEeCHHHHHHHHccCCCCcc
Confidence            599999988854  332110   02     1  3566788999888899888653


No 124
>PRK08197 threonine synthase; Validated
Probab=21.61  E-value=65  Score=31.01  Aligned_cols=31  Identities=19%  Similarity=0.454  Sum_probs=22.4

Q ss_pred             eecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEEeeCC
Q psy10064         53 IWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIKTDP  103 (257)
Q Consensus        53 i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~TDP  103 (257)
                      .+|..||...                   ++..+..+| .|++.+.+..|.
T Consensus         8 ~~C~~Cg~~~-------------------~~~~~~~~C-~cg~~l~~~~d~   38 (394)
T PRK08197          8 LECSKCGETY-------------------DADQVHNLC-KCGKPLLVRYDL   38 (394)
T ss_pred             EEECCCCCCC-------------------CCCCcceec-CCCCeeEEEech
Confidence            7899998532                   122334679 899999999884


No 125
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=21.29  E-value=45  Score=30.75  Aligned_cols=17  Identities=18%  Similarity=0.266  Sum_probs=12.1

Q ss_pred             eeeeecCCCCccccccc
Q psy10064         50 PYNIWCEGCNNHIGMGV   66 (257)
Q Consensus        50 Pf~i~C~~C~~~I~kG~   66 (257)
                      .+.+.|.+|+.-.+...
T Consensus       120 l~~~~C~~C~~~~~~~~  136 (250)
T COG0846         120 LKRVRCSKCGNQYYDED  136 (250)
T ss_pred             eeeeEeCCCcCccchhh
Confidence            35678999988776543


No 126
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=21.12  E-value=51  Score=24.97  Aligned_cols=17  Identities=24%  Similarity=0.513  Sum_probs=13.6

Q ss_pred             EEcCCCCceeEEeeCCC
Q psy10064         88 MKCHLCDSHFEIKTDPG  104 (257)
Q Consensus        88 ~kC~~C~~~i~i~TDPk  104 (257)
                      |+||.|++.-.|+|.=.
T Consensus         2 m~CP~Cg~~a~irtSr~   18 (72)
T PRK09678          2 FHCPLCQHAAHARTSRY   18 (72)
T ss_pred             ccCCCCCCccEEEEChh
Confidence            89999999888776543


No 127
>KOG0006|consensus
Probab=21.09  E-value=93  Score=30.39  Aligned_cols=49  Identities=24%  Similarity=0.618  Sum_probs=37.3

Q ss_pred             EEEEeceeeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCC-CceeEEeeCCCCCCeeecc
Q psy10064         44 IIRFELPYNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLC-DSHFEIKTDPGNLDYVIVS  112 (257)
Q Consensus        44 ~VRfe~Pf~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C-~~~i~i~TDPkn~dYv~~~  112 (257)
                      -++.-.-|-|||..|... -+|           +        .+..|..| ++.++++.||++-|=|+.+
T Consensus       126 ~~si~~sFyV~Ck~Cd~v-~~G-----------K--------LRV~C~~C~~~s~tv~~~P~cWdDVLks  175 (446)
T KOG0006|consen  126 GRSILGSFYVWCKNCDDV-KRG-----------K--------LRVYCQKCSSTSVTVKSEPQCWDDVLKS  175 (446)
T ss_pred             cceecceeEEEecchhhc-cCC-----------c--------eEEEeecccCceEEEecCccchhhhhhc
Confidence            346677899999999652 222           1        46789999 5679999999998888876


No 128
>PRK00420 hypothetical protein; Validated
Probab=21.09  E-value=70  Score=26.20  Aligned_cols=33  Identities=18%  Similarity=0.317  Sum_probs=21.4

Q ss_pred             eeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEEee
Q psy10064         51 YNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIKT  101 (257)
Q Consensus        51 f~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~T  101 (257)
                      .+--|..||..+++-        +-|          ...||.|+..+.+..
T Consensus        22 l~~~CP~Cg~pLf~l--------k~g----------~~~Cp~Cg~~~~v~~   54 (112)
T PRK00420         22 LSKHCPVCGLPLFEL--------KDG----------EVVCPVHGKVYIVKS   54 (112)
T ss_pred             ccCCCCCCCCcceec--------CCC----------ceECCCCCCeeeecc
Confidence            457899998766641        011          367999998666544


No 129
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=21.01  E-value=64  Score=26.92  Aligned_cols=43  Identities=14%  Similarity=0.343  Sum_probs=25.2

Q ss_pred             eeeeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEEeeCC
Q psy10064         50 PYNIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIKTDP  103 (257)
Q Consensus        50 Pf~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~TDP  103 (257)
                      .....|..|+.      +|...-  +..+.+ +  .=.|.||.|++.++...+.
T Consensus        97 ~~~Y~Cp~C~~------~y~~~e--a~~~~d-~--~~~f~Cp~Cg~~l~~~dn~  139 (147)
T smart00531       97 NAYYKCPNCQS------KYTFLE--ANQLLD-M--DGTFTCPRCGEELEEDDNS  139 (147)
T ss_pred             CcEEECcCCCC------EeeHHH--HHHhcC-C--CCcEECCCCCCEEEEcCch
Confidence            45678999973      343321  111112 1  1128999999999876553


No 130
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=20.96  E-value=53  Score=22.11  Aligned_cols=15  Identities=53%  Similarity=1.369  Sum_probs=9.6

Q ss_pred             eecCCCCcccccccee
Q psy10064         53 IWCEGCNNHIGMGVRY   68 (257)
Q Consensus        53 i~C~~C~~~I~kG~rf   68 (257)
                      |.|.+|+..| .|.||
T Consensus         1 v~Cd~C~~~i-~G~ry   15 (43)
T cd02340           1 VICDGCQGPI-VGVRY   15 (43)
T ss_pred             CCCCCCCCcC-cCCeE
Confidence            5788887743 55444


No 131
>TIGR00354 polC DNA polymerase, archaeal type II, large subunit. This model represents the large subunit, DP2, of a two subunit novel Archaeal replicative DNA polymerase first characterized for Pyrococcus furiosus. Structure of DP2 appears to be organized as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit.
Probab=20.82  E-value=54  Score=36.04  Aligned_cols=21  Identities=29%  Similarity=0.776  Sum_probs=16.8

Q ss_pred             eecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCce
Q psy10064         53 IWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSH   96 (257)
Q Consensus        53 i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~   96 (257)
                      -+|..||.|.                       |+.+|+.|+..
T Consensus       626 RKCPkCG~yT-----------------------lk~rCP~CG~~  646 (1095)
T TIGR00354       626 RKCPQCGKES-----------------------FWLKCPVCGEL  646 (1095)
T ss_pred             EECCCCCccc-----------------------ccccCCCCCCc
Confidence            5799998654                       55899999995


No 132
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=20.82  E-value=51  Score=26.72  Aligned_cols=13  Identities=23%  Similarity=0.710  Sum_probs=10.9

Q ss_pred             EEcCCCCceeEEe
Q psy10064         88 MKCHLCDSHFEIK  100 (257)
Q Consensus        88 ~kC~~C~~~i~i~  100 (257)
                      +.||.|+..+.+.
T Consensus        27 ivCP~CG~~~~~~   39 (108)
T PF09538_consen   27 IVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCCCccCcc
Confidence            6799999987766


No 133
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=20.75  E-value=35  Score=32.16  Aligned_cols=33  Identities=18%  Similarity=0.366  Sum_probs=23.3

Q ss_pred             eeecCCCCccccccceeeeeccccccccceeeEEEEEEcCCCCceeEEe
Q psy10064         52 NIWCEGCNNHIGMGVRYNAEKKKVGMYYSTPVYQFRMKCHLCDSHFEIK  100 (257)
Q Consensus        52 ~i~C~~C~~~I~kG~rfNA~K~~vg~Y~st~I~~F~~kC~~C~~~i~i~  100 (257)
                      -+.|..|+..||+-        .++..        ..-|+.|+..+.+.
T Consensus        27 ~~~c~~c~~~~~~~--------~l~~~--------~~vc~~c~~h~rl~   59 (292)
T PRK05654         27 WTKCPSCGQVLYRK--------ELEAN--------LNVCPKCGHHMRIS   59 (292)
T ss_pred             eeECCCccchhhHH--------HHHhc--------CCCCCCCCCCeeCC
Confidence            36799999999872        23221        25799999988763


No 134
>PF08996 zf-DNA_Pol:  DNA Polymerase alpha zinc finger;  InterPro: IPR015088 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNA Polymerase alpha zinc finger domain adopts an alpha-helix-like structure, followed by three turns, all of which involve proline. The resulting motif is a helix-turn-helix motif, in contrast to other zinc finger domains, which show anti-parallel sheet and helix conformation. Zinc binding occurs due to the presence of four cysteine residues positioned to bind the metal centre in a tetrahedral coordination geometry. The function of this domain is uncertain: it has been proposed that the zinc finger motif may be an essential part of the DNA binding domain [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0001882 nucleoside binding, 0003887 DNA-directed DNA polymerase activity, 0006260 DNA replication; PDB: 3FLO_D 1N5G_A 1K0P_A 1K18_A.
Probab=20.58  E-value=72  Score=27.77  Aligned_cols=20  Identities=20%  Similarity=0.527  Sum_probs=11.7

Q ss_pred             EEEEEcCCCCceeEEeeCCC
Q psy10064         85 QFRMKCHLCDSHFEIKTDPG  104 (257)
Q Consensus        85 ~F~~kC~~C~~~i~i~TDPk  104 (257)
                      .|.++|+.|++++.|..=-+
T Consensus        16 ~l~~~C~~C~~~~~f~g~~~   35 (188)
T PF08996_consen   16 PLKLTCPSCGTEFEFPGVFE   35 (188)
T ss_dssp             -EEEE-TTT--EEEE-SSS-
T ss_pred             ceEeECCCCCCCcccccccc
Confidence            58899999999999965434


No 135
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated
Probab=20.58  E-value=57  Score=24.03  Aligned_cols=8  Identities=38%  Similarity=1.219  Sum_probs=6.2

Q ss_pred             EcCCCCce
Q psy10064         89 KCHLCDSH   96 (257)
Q Consensus        89 kC~~C~~~   96 (257)
                      .||.|++.
T Consensus        17 ~CP~Cgs~   24 (61)
T PRK08351         17 RCPVCGSR   24 (61)
T ss_pred             cCCCCcCC
Confidence            49999873


No 136
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=20.09  E-value=47  Score=21.20  Aligned_cols=14  Identities=43%  Similarity=0.921  Sum_probs=8.8

Q ss_pred             eeeecCCCCcccccc
Q psy10064         51 YNIWCEGCNNHIGMG   65 (257)
Q Consensus        51 f~i~C~~C~~~I~kG   65 (257)
                      |.+ |..||+.|...
T Consensus         3 yg~-C~~CGe~I~~~   16 (36)
T PF01258_consen    3 YGI-CEDCGEPIPEE   16 (36)
T ss_dssp             -SB--TTTSSBEEHH
T ss_pred             CCC-ccccCChHHHH
Confidence            344 88999888754


Done!