Query         psy10072
Match_columns 84
No_of_seqs    119 out of 1166
Neff          11.2
Searched_HMMs 46136
Date          Fri Aug 16 17:14:45 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10072.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10072hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 6.3E-23 1.4E-27  112.7   3.0   72    1-74    177-249 (279)
  2 KOG2462|consensus               99.9 2.7E-22 5.8E-27  110.3   2.6   62    1-62    203-265 (279)
  3 KOG3623|consensus               99.5 4.1E-15 8.8E-20   91.2   1.5   65   10-74    891-956 (1007)
  4 KOG3623|consensus               99.5 1.2E-14 2.6E-19   89.2   1.3   71    1-71    910-982 (1007)
  5 KOG3576|consensus               99.4 1.3E-14 2.7E-19   77.7  -0.3   60    2-61    134-194 (267)
  6 KOG1074|consensus               99.4 2.4E-14 5.2E-19   88.6   0.0   64    1-64    621-692 (958)
  7 KOG3576|consensus               99.4 1.7E-13 3.7E-18   73.5   1.0   65   11-75    115-180 (267)
  8 PHA00733 hypothetical protein   99.3 3.4E-12 7.5E-17   64.8   4.2   61    3-65     64-124 (128)
  9 PF13465 zf-H2C2_2:  Zinc-finge  99.3 6.2E-13 1.3E-17   50.0   1.1   25    1-25      2-26  (26)
 10 PHA02768 hypothetical protein;  99.3 1.5E-12 3.3E-17   56.4   1.4   44   13-57      5-48  (55)
 11 KOG3608|consensus               99.1 9.8E-11 2.1E-15   67.5   2.8   83    1-83    279-368 (467)
 12 KOG1074|consensus               99.0 5.2E-11 1.1E-15   74.4   0.9   59   14-72    880-939 (958)
 13 KOG3608|consensus               99.0 7.1E-10 1.5E-14   64.0   3.1   70    1-73    253-324 (467)
 14 PHA00616 hypothetical protein   98.7 3.1E-09 6.6E-14   44.2   0.9   30   41-70      2-31  (44)
 15 PF13465 zf-H2C2_2:  Zinc-finge  98.7 1.6E-08 3.4E-13   37.8   2.1   24   28-51      1-25  (26)
 16 PHA00732 hypothetical protein   98.7 2.7E-08 5.8E-13   46.7   3.2   46   13-63      1-47  (79)
 17 PHA00616 hypothetical protein   98.7 7.4E-09 1.6E-13   43.0   0.9   33   13-45      1-34  (44)
 18 PHA02768 hypothetical protein;  98.6   2E-08 4.2E-13   43.7   1.8   29   41-71      6-34  (55)
 19 PLN03086 PRLI-interacting fact  98.6 5.4E-08 1.2E-12   59.7   3.8   57   12-72    452-508 (567)
 20 PF05605 zf-Di19:  Drought indu  98.5 5.4E-07 1.2E-11   39.4   3.9   49   13-64      2-53  (54)
 21 PLN03086 PRLI-interacting fact  98.5 1.9E-07 4.1E-12   57.4   3.2   69    1-74    468-547 (567)
 22 PF00096 zf-C2H2:  Zinc finger,  98.4 2.2E-07 4.8E-12   33.5   1.8   20   42-61      2-21  (23)
 23 PF00096 zf-C2H2:  Zinc finger,  98.4 2.1E-07 4.6E-12   33.6   1.7   23   14-36      1-23  (23)
 24 KOG3993|consensus               98.4 1.7E-07 3.6E-12   55.5   1.2   52   13-64    295-380 (500)
 25 PHA00733 hypothetical protein   98.3 1.7E-07 3.7E-12   47.8   0.0   60   11-72     38-103 (128)
 26 PF13894 zf-C2H2_4:  C2H2-type   98.2 1.6E-06 3.4E-11   31.3   2.2   23   41-63      1-23  (24)
 27 PF13912 zf-C2H2_6:  C2H2-type   98.1 2.7E-06   6E-11   31.8   1.8   24   13-36      1-24  (27)
 28 PF13894 zf-C2H2_4:  C2H2-type   98.0 7.6E-06 1.6E-10   29.4   2.2   23   14-36      1-23  (24)
 29 PF13912 zf-C2H2_6:  C2H2-type   98.0 6.5E-06 1.4E-10   30.7   1.7   25   41-65      2-26  (27)
 30 KOG3993|consensus               98.0 1.2E-06 2.6E-11   52.0  -0.6   52   14-65    268-320 (500)
 31 PF09237 GAGA:  GAGA factor;  I  97.8 3.5E-05 7.5E-10   32.9   2.4   29   41-69     25-53  (54)
 32 COG5189 SFP1 Putative transcri  97.7 1.5E-05 3.3E-10   46.1   1.3   51   11-61    347-419 (423)
 33 smart00355 ZnF_C2H2 zinc finge  97.6   5E-05 1.1E-09   27.5   1.8   20   42-61      2-21  (26)
 34 smart00355 ZnF_C2H2 zinc finge  97.6   7E-05 1.5E-09   27.1   2.0   24   14-37      1-24  (26)
 35 PF12756 zf-C2H2_2:  C2H2 type   97.6 6.2E-05 1.3E-09   36.4   2.2   23   41-63     51-73  (100)
 36 PF09237 GAGA:  GAGA factor;  I  97.4 0.00021 4.5E-09   30.6   2.4   30    9-38     20-49  (54)
 37 PF13909 zf-H2C2_5:  C2H2-type   97.4 0.00015 3.2E-09   26.2   1.8   23   41-64      1-23  (24)
 38 PF12874 zf-met:  Zinc-finger o  97.4 0.00013 2.9E-09   26.5   1.5   21   14-34      1-21  (25)
 39 PRK04860 hypothetical protein;  97.3 0.00027 5.8E-09   37.5   2.7   35   13-51    119-154 (160)
 40 PF12874 zf-met:  Zinc-finger o  97.2 0.00029 6.2E-09   25.6   1.6   23   41-63      1-23  (25)
 41 PRK04860 hypothetical protein;  96.8 0.00063 1.4E-08   36.1   1.3   25    2-26    132-156 (160)
 42 PF12171 zf-C2H2_jaz:  Zinc-fin  96.7 0.00051 1.1E-08   25.5   0.3   21   41-61      2-22  (27)
 43 PF13913 zf-C2HC_2:  zinc-finge  96.4  0.0033 7.3E-08   23.0   1.8   20   14-34      3-22  (25)
 44 COG4049 Uncharacterized protei  96.4  0.0019 4.2E-08   28.1   1.1   29   37-65     13-42  (65)
 45 PHA00732 hypothetical protein   96.4  0.0031 6.7E-08   29.7   1.9   25   41-65      2-27  (79)
 46 smart00451 ZnF_U1 U1-like zinc  96.3  0.0045 9.8E-08   24.2   1.9   22   13-34      3-24  (35)
 47 PF05605 zf-Di19:  Drought indu  95.9  0.0072 1.6E-07   26.2   1.7   34   41-75      3-38  (54)
 48 KOG2186|consensus               95.6  0.0098 2.1E-07   33.8   1.8   50   13-64      3-52  (276)
 49 PF13719 zinc_ribbon_5:  zinc-r  95.3   0.029 6.2E-07   22.4   2.3   34   14-51      3-36  (37)
 50 PF13717 zinc_ribbon_4:  zinc-r  95.2   0.034 7.3E-07   22.1   2.3   33   14-50      3-35  (36)
 51 PF12756 zf-C2H2_2:  C2H2 type   95.0   0.033 7.1E-07   26.7   2.5   24   13-36     50-73  (100)
 52 COG5048 FOG: Zn-finger [Genera  94.7  0.0086 1.9E-07   35.6  -0.0   60   12-71    288-354 (467)
 53 COG4049 Uncharacterized protei  94.6   0.016 3.4E-07   25.3   0.7   30    7-36     11-40  (65)
 54 TIGR02098 MJ0042_CXXC MJ0042 f  94.5   0.053 1.2E-06   21.6   2.2   34   14-51      3-36  (38)
 55 KOG2893|consensus               94.2   0.011 2.4E-07   33.4  -0.2   46   11-60      9-54  (341)
 56 cd00350 rubredoxin_like Rubred  94.1   0.041   9E-07   21.4   1.4   24   14-48      2-25  (33)
 57 COG5189 SFP1 Putative transcri  93.8   0.017 3.6E-07   34.1  -0.1   26    9-34    394-419 (423)
 58 PF09986 DUF2225:  Uncharacteri  92.4   0.037   8E-07   30.9  -0.0   43   11-53      3-61  (214)
 59 KOG1146|consensus               92.3   0.093   2E-06   36.4   1.6   55    8-62    460-540 (1406)
 60 PF10571 UPF0547:  Uncharacteri  92.2    0.14 2.9E-06   18.9   1.4   11   41-51     15-25  (26)
 61 smart00834 CxxC_CXXC_SSSS Puta  92.0   0.052 1.1E-06   21.9   0.2   30   14-49      6-35  (41)
 62 PF09538 FYDLN_acid:  Protein o  91.6    0.19 4.1E-06   25.2   2.0   30   14-53     10-39  (108)
 63 PF04959 ARS2:  Arsenite-resist  91.4    0.15 3.2E-06   28.6   1.6   27   10-36     74-100 (214)
 64 TIGR00373 conserved hypothetic  91.3    0.17 3.8E-06   26.9   1.7   35    9-51    105-139 (158)
 65 PRK00464 nrdR transcriptional   91.2   0.068 1.5E-06   28.4   0.2   12   41-52     29-40  (154)
 66 COG1997 RPL43A Ribosomal prote  91.1     0.2 4.4E-06   24.0   1.7   30   12-51     34-64  (89)
 67 smart00659 RPOLCX RNA polymera  91.1    0.31 6.7E-06   20.3   2.1   26   13-48      2-27  (44)
 68 COG2888 Predicted Zn-ribbon RN  91.1    0.36 7.7E-06   21.5   2.3   11   13-23     27-37  (61)
 69 TIGR02605 CxxC_CxxC_SSSS putat  91.0   0.073 1.6E-06   22.7   0.1   29   14-48      6-34  (52)
 70 PF14353 CpXC:  CpXC protein     91.0    0.47   1E-05   24.2   3.1   43   15-59      3-57  (128)
 71 smart00531 TFIIE Transcription  91.0    0.31 6.7E-06   25.6   2.5   39   10-51     96-134 (147)
 72 PF15269 zf-C2H2_7:  Zinc-finge  91.0    0.21 4.6E-06   20.9   1.5   25   38-62     16-42  (54)
 73 PRK00398 rpoP DNA-directed RNA  90.7    0.28 6.2E-06   20.4   1.8   30   13-51      3-32  (46)
 74 cd00924 Cyt_c_Oxidase_Vb Cytoc  90.1    0.11 2.5E-06   25.4   0.4   20    5-25     72-91  (97)
 75 smart00440 ZnF_C2C2 C2C2 Zinc   89.8    0.08 1.7E-06   21.6  -0.3   35   15-51      2-39  (40)
 76 COG5048 FOG: Zn-finger [Genera  89.2    0.13 2.8E-06   30.7   0.2   43    1-43    305-354 (467)
 77 PRK06266 transcription initiat  88.5    0.34 7.3E-06   26.4   1.5   34   10-51    114-147 (178)
 78 PF12013 DUF3505:  Protein of u  88.1    0.56 1.2E-05   23.3   2.1   25   41-65     81-109 (109)
 79 smart00614 ZnF_BED BED zinc fi  87.7    0.81 1.8E-05   19.4   2.2   21   41-61     19-44  (50)
 80 COG1571 Predicted DNA-binding   87.0    0.47   1E-05   29.3   1.6   29   15-54    352-381 (421)
 81 cd00729 rubredoxin_SM Rubredox  86.5    0.59 1.3E-05   18.3   1.3   25   13-48      2-26  (34)
 82 PLN02294 cytochrome c oxidase   86.0    0.28 6.2E-06   26.5   0.3   21    5-26    134-154 (174)
 83 TIGR01206 lysW lysine biosynth  85.7    0.72 1.6E-05   20.2   1.5   31   14-51      3-33  (54)
 84 KOG4167|consensus               85.6    0.17 3.7E-06   33.2  -0.7   25   41-65    793-817 (907)
 85 KOG2593|consensus               85.0    0.87 1.9E-05   28.2   2.0   37    9-48    124-161 (436)
 86 PRK09678 DNA-binding transcrip  84.4    0.56 1.2E-05   21.8   0.9   39   14-54      2-43  (72)
 87 COG2331 Uncharacterized protei  84.0    0.44 9.5E-06   22.3   0.4   31   14-51     13-44  (82)
 88 PF02892 zf-BED:  BED zinc fing  83.9     1.6 3.4E-05   17.8   2.1   21   41-61     17-41  (45)
 89 TIGR02300 FYDLN_acid conserved  83.6     1.2 2.6E-05   23.0   1.9   32   14-55     10-41  (129)
 90 PRK14890 putative Zn-ribbon RN  82.9     1.4 3.1E-05   19.6   1.8    9   14-22     26-34  (59)
 91 KOG4173|consensus               82.9    0.29 6.3E-06   27.3  -0.4   48   15-62    108-168 (253)
 92 PF01096 TFIIS_C:  Transcriptio  82.8    0.05 1.1E-06   22.0  -2.6   10   41-50     29-38  (39)
 93 smart00734 ZnF_Rad18 Rad18-lik  82.7     1.7 3.7E-05   15.8   1.8   19   15-34      3-21  (26)
 94 PF01780 Ribosomal_L37ae:  Ribo  82.6    0.62 1.4E-05   22.6   0.7   31   12-51     34-64  (90)
 95 PF07754 DUF1610:  Domain of un  82.4     0.8 1.7E-05   16.5   0.8   11   11-21     14-24  (24)
 96 PF05443 ROS_MUCR:  ROS/MUCR tr  82.3    0.92   2E-05   23.6   1.2   25   41-68     73-97  (132)
 97 PRK03824 hypA hydrogenase nick  82.3    0.55 1.2E-05   24.4   0.4   15   12-26     69-83  (135)
 98 PF11672 DUF3268:  Protein of u  81.0     1.1 2.5E-05   22.2   1.3   37   12-48      1-39  (102)
 99 KOG3408|consensus               80.7    0.99 2.1E-05   23.1   1.0   22   41-62     58-79  (129)
100 PF08274 PhnA_Zn_Ribbon:  PhnA   80.7     1.1 2.5E-05   17.0   1.0   25   15-49      4-28  (30)
101 PF03604 DNA_RNApol_7kD:  DNA d  80.5     1.5 3.2E-05   17.0   1.3   25   14-48      1-25  (32)
102 TIGR00280 L37a ribosomal prote  79.1     1.5 3.2E-05   21.4   1.3   30   12-51     34-64  (91)
103 PF13878 zf-C2H2_3:  zinc-finge  79.0     2.5 5.4E-05   17.2   1.8   25   13-37     13-39  (41)
104 PF09845 DUF2072:  Zn-ribbon co  78.4     1.2 2.7E-05   23.1   0.9   15   13-27      1-15  (131)
105 PF08790 zf-LYAR:  LYAR-type C2  78.4     0.7 1.5E-05   17.4   0.1    9   15-23      2-10  (28)
106 PF04959 ARS2:  Arsenite-resist  77.9       1 2.3E-05   25.3   0.7   27   41-67     78-104 (214)
107 PHA00626 hypothetical protein   77.9     1.6 3.6E-05   19.2   1.1   16   12-27     22-37  (59)
108 PRK12380 hydrogenase nickel in  76.8     1.6 3.4E-05   22.0   1.0   25   13-48     70-94  (113)
109 PF13451 zf-trcl:  Probable zin  76.7     1.3 2.8E-05   19.0   0.6   17   11-27      2-18  (49)
110 COG1656 Uncharacterized conser  76.7     5.8 0.00013   21.5   3.1   44   14-57     98-147 (165)
111 COG1996 RPC10 DNA-directed RNA  76.5     2.2 4.7E-05   18.3   1.3   27   12-48      5-32  (49)
112 PF09723 Zn-ribbon_8:  Zinc rib  76.5     1.4 3.1E-05   18.0   0.7   29   14-48      6-34  (42)
113 KOG4167|consensus               76.4    0.45 9.7E-06   31.5  -1.1   26   13-38    792-817 (907)
114 PHA02998 RNA polymerase subuni  76.4     0.9   2E-05   24.9   0.1   39   13-53    143-184 (195)
115 PTZ00255 60S ribosomal protein  75.9     2.8 6.1E-05   20.4   1.7   30   12-51     35-65  (90)
116 PF13453 zf-TFIIB:  Transcripti  75.3     4.7  0.0001   16.2   2.5   21   38-58     16-37  (41)
117 PF10276 zf-CHCC:  Zinc-finger   75.2    0.89 1.9E-05   18.6  -0.0   11   13-23     29-39  (40)
118 KOG1280|consensus               74.1     4.1   9E-05   24.8   2.4   38   11-48     77-117 (381)
119 KOG2907|consensus               73.9     3.1 6.6E-05   21.1   1.6   37   13-51     74-113 (116)
120 TIGR00100 hypA hydrogenase nic  73.8     2.2 4.7E-05   21.6   1.1   25   13-48     70-94  (115)
121 KOG2785|consensus               73.8      15 0.00033   22.8   4.6   60   12-71    165-252 (390)
122 PF01215 COX5B:  Cytochrome c o  73.8     0.7 1.5E-05   24.2  -0.7   21    5-26    105-125 (136)
123 PRK00432 30S ribosomal protein  72.3     4.1 8.8E-05   17.4   1.6   11   41-51     38-48  (50)
124 COG4391 Uncharacterized protei  71.9     1.5 3.2E-05   19.7   0.2   45    4-52     15-60  (62)
125 smart00154 ZnF_AN1 AN1-like Zi  71.8     2.8 6.1E-05   16.9   1.0   14   13-26     12-25  (39)
126 PF01363 FYVE:  FYVE zinc finge  71.6     4.7  0.0001   18.0   1.9   27   14-51     10-36  (69)
127 PF08271 TF_Zn_Ribbon:  TFIIB z  71.2     3.2 6.9E-05   16.9   1.2   29   14-51      1-30  (43)
128 PF09963 DUF2197:  Uncharacteri  71.0     2.2 4.8E-05   18.8   0.7   36   14-49      3-40  (56)
129 KOG2482|consensus               70.5     2.7 5.8E-05   25.6   1.1   22   41-62    196-217 (423)
130 COG4957 Predicted transcriptio  70.2     3.5 7.6E-05   21.6   1.4   26   41-69     77-102 (148)
131 PF10537 WAC_Acf1_DNA_bd:  ATP-  70.2      12 0.00025   18.7   3.2   37   12-48      2-38  (102)
132 PRK00564 hypA hydrogenase nick  70.2     2.9 6.3E-05   21.2   1.1   25   13-48     71-96  (117)
133 PF04780 DUF629:  Protein of un  69.2     4.2 9.1E-05   25.8   1.8   26   13-38     57-83  (466)
134 PRK04351 hypothetical protein;  68.5     4.5 9.8E-05   21.5   1.6   10   41-50    113-122 (149)
135 KOG1146|consensus               67.6       2 4.3E-05   30.5   0.3   52   11-62   1282-1350(1406)
136 KOG0696|consensus               67.5     5.1 0.00011   25.5   1.9   57   10-74     70-127 (683)
137 COG1594 RPB9 DNA-directed RNA   67.3     2.8   6E-05   21.2   0.7   36   14-51     73-111 (113)
138 PF02176 zf-TRAF:  TRAF-type zi  66.6     9.9 0.00021   16.3   2.9   40   11-51      7-53  (60)
139 PF07295 DUF1451:  Protein of u  66.5     1.5 3.3E-05   23.2  -0.3   33    7-48    102-138 (146)
140 COG1592 Rubrerythrin [Energy p  66.2     3.7 8.1E-05   22.3   1.1    8   13-20    134-141 (166)
141 COG3364 Zn-ribbon containing p  66.1     3.2   7E-05   20.6   0.8   15   13-27      2-16  (112)
142 PF01927 Mut7-C:  Mut7-C RNAse   65.7     5.2 0.00011   21.0   1.5   46   13-58     91-142 (147)
143 PF01428 zf-AN1:  AN1-like Zinc  65.6     2.5 5.4E-05   17.3   0.3   15   12-26     12-26  (43)
144 PF04423 Rad50_zn_hook:  Rad50   65.4     2.6 5.6E-05   18.1   0.3   12   15-26     22-33  (54)
145 PF12760 Zn_Tnp_IS1595:  Transp  65.1     5.8 0.00013   16.4   1.4   26   14-48     19-45  (46)
146 KOG2071|consensus               64.6     5.5 0.00012   25.9   1.7   27   11-37    416-442 (579)
147 PF15135 UPF0515:  Uncharacteri  64.2     6.7 0.00014   22.9   1.8   11   41-51    156-166 (278)
148 COG4888 Uncharacterized Zn rib  64.1     2.3 5.1E-05   21.1   0.1   37   11-51     20-57  (104)
149 PRK03681 hypA hydrogenase nick  63.8     3.4 7.4E-05   20.9   0.6   25   13-48     70-95  (114)
150 TIGR01384 TFS_arch transcripti  63.7       2 4.3E-05   21.1  -0.2   11   41-51     91-101 (104)
151 PF03811 Zn_Tnp_IS1:  InsA N-te  63.3     2.4 5.1E-05   16.9  -0.0   29   14-46      6-35  (36)
152 PF01155 HypA:  Hydrogenase exp  62.9       4 8.7E-05   20.5   0.8   25   14-49     71-95  (113)
153 COG3091 SprT Zn-dependent meta  62.4     6.5 0.00014   21.1   1.5    7   41-47    141-147 (156)
154 PF14787 zf-CCHC_5:  GAG-polypr  62.4       6 0.00013   15.8   1.1   15   14-28      3-17  (36)
155 PTZ00043 cytochrome c oxidase   61.8     4.7  0.0001   23.1   1.0   16   11-26    179-194 (268)
156 PF10013 DUF2256:  Uncharacteri  61.1     4.7  0.0001   16.7   0.7   13   15-27     10-22  (42)
157 COG3357 Predicted transcriptio  60.6     4.4 9.5E-05   19.8   0.6   14   12-25     57-70  (97)
158 PF14446 Prok-RING_1:  Prokaryo  60.6      11 0.00023   16.6   1.8   26   14-50      6-31  (54)
159 COG3677 Transposase and inacti  60.5     5.1 0.00011   20.8   0.9   16   11-26     51-66  (129)
160 COG1326 Uncharacterized archae  60.3      20 0.00043   20.2   3.1   35   13-51      6-41  (201)
161 COG1998 RPS31 Ribosomal protei  60.3      11 0.00023   16.3   1.7   26   15-49     21-46  (51)
162 KOG2071|consensus               59.6     6.2 0.00013   25.7   1.3   24   41-64    419-442 (579)
163 PF04780 DUF629:  Protein of un  59.6     8.7 0.00019   24.5   1.9   24   41-64     58-81  (466)
164 PF07282 OrfB_Zn_ribbon:  Putat  59.2      12 0.00027   16.7   2.0   12   41-52     47-58  (69)
165 PRK14892 putative transcriptio  58.6     6.7 0.00014   19.4   1.1   34   12-52     20-54  (99)
166 KOG4118|consensus               57.8     6.1 0.00013   18.0   0.8   31   41-71     39-69  (74)
167 PF02891 zf-MIZ:  MIZ/SP-RING z  57.3     2.7 5.9E-05   17.9  -0.3    7   14-20     42-48  (50)
168 TIGR00686 phnA alkylphosphonat  56.7      10 0.00022   19.1   1.6   28   15-52      4-31  (109)
169 COG1773 Rubredoxin [Energy pro  56.3     5.9 0.00013   17.4   0.6   37   12-48      2-44  (55)
170 PF10263 SprT-like:  SprT-like   56.3     9.5  0.0002   20.0   1.5   11   13-23    123-133 (157)
171 KOG1994|consensus               55.6     5.4 0.00012   22.9   0.6   21   41-61    240-260 (268)
172 smart00731 SprT SprT homologue  55.4     8.1 0.00018   20.2   1.2   11   13-23    112-122 (146)
173 PRK10220 hypothetical protein;  55.4      14 0.00031   18.7   1.9   29   15-53      5-33  (111)
174 TIGR00416 sms DNA repair prote  55.3      12 0.00026   23.7   2.0   10   13-22      7-16  (454)
175 PF11494 Ta0938:  Ta0938;  Inte  54.6     5.5 0.00012   19.6   0.4   40    9-53     10-50  (105)
176 PRK11823 DNA repair protein Ra  53.6      13 0.00029   23.4   2.0   11   13-23      7-17  (446)
177 TIGR01385 TFSII transcription   53.5       5 0.00011   23.9   0.2   37   13-51    258-297 (299)
178 PRK05978 hypothetical protein;  52.2     5.8 0.00013   21.2   0.3   32   14-53     34-65  (148)
179 TIGR00622 ssl1 transcription f  51.9      19 0.00041   18.3   2.1   49   15-65     57-106 (112)
180 PF01286 XPA_N:  XPA protein N-  51.2       7 0.00015   15.4   0.4   14   14-27      4-17  (34)
181 COG0068 HypF Hydrogenase matur  50.9     1.2 2.6E-05   29.5  -2.6   47   15-61    125-172 (750)
182 TIGR00310 ZPR1_znf ZPR1 zinc f  50.6     4.5 9.8E-05   22.5  -0.2   36   15-51      2-41  (192)
183 COG1675 TFA1 Transcription ini  50.4      15 0.00033   20.2   1.7   34    9-50    109-142 (176)
184 PF07975 C1_4:  TFIIH C1-like d  50.4       7 0.00015   16.9   0.4   24   41-64     22-45  (51)
185 PLN03238 probable histone acet  50.3      24 0.00051   21.1   2.6   23   41-63     49-71  (290)
186 KOG1842|consensus               50.2     8.9 0.00019   24.3   0.9   26   41-66     16-41  (505)
187 COG1779 C4-type Zn-finger prot  50.1       4 8.7E-05   22.8  -0.5   38   14-53     15-56  (201)
188 KOG1088|consensus               49.8      10 0.00022   19.5   0.9   20    8-27     93-112 (124)
189 PF14311 DUF4379:  Domain of un  49.7      14 0.00031   15.8   1.3   13   41-53     29-41  (55)
190 PF03966 Trm112p:  Trm112p-like  49.6     6.3 0.00014   17.8   0.2   17    8-24     48-64  (68)
191 KOG2231|consensus               49.0      23 0.00049   23.8   2.5   19   16-34    185-203 (669)
192 PF00301 Rubredoxin:  Rubredoxi  48.8     9.8 0.00021   16.1   0.7   12   41-52      2-13  (47)
193 PF06220 zf-U1:  U1 zinc finger  48.7      16 0.00034   14.6   1.3   12   13-24      3-14  (38)
194 PF05191 ADK_lid:  Adenylate ki  48.4     8.1 0.00017   15.3   0.4   30   14-51      2-32  (36)
195 cd00065 FYVE FYVE domain; Zinc  48.4      17 0.00038   15.4   1.5   11   15-25      4-14  (57)
196 PF09332 Mcm10:  Mcm10 replicat  48.3       9 0.00019   23.4   0.7   40   12-51    251-296 (344)
197 COG4530 Uncharacterized protei  47.9      11 0.00025   19.1   0.9   11   16-26     12-22  (129)
198 KOG4727|consensus               47.8      11 0.00025   20.7   1.0   22   13-34     75-96  (193)
199 KOG0717|consensus               47.3      13 0.00029   23.7   1.4   22   14-35    293-314 (508)
200 KOG3507|consensus               47.3      18 0.00039   16.2   1.4   28   13-50     20-47  (62)
201 cd00730 rubredoxin Rubredoxin;  46.5     9.6 0.00021   16.3   0.5   12   41-52      2-13  (50)
202 PRK00762 hypA hydrogenase nick  46.2     9.8 0.00021   19.5   0.6   31   13-48     70-100 (124)
203 PF04606 Ogr_Delta:  Ogr/Delta-  45.6      12 0.00027   15.5   0.8   36   15-52      1-39  (47)
204 smart00064 FYVE Protein presen  45.6      18 0.00038   16.1   1.3   27   14-51     11-37  (68)
205 COG2879 Uncharacterized small   45.3      25 0.00053   16.0   1.7   19   52-70     24-42  (65)
206 TIGR03831 YgiT_finger YgiT-typ  44.7      11 0.00023   15.1   0.5   13   13-25     32-44  (46)
207 cd01121 Sms Sms (bacterial rad  44.6      20 0.00044   22.1   1.8   13   12-24     13-25  (372)
208 COG4896 Uncharacterized protei  44.3      19 0.00041   16.3   1.2   37   15-51      4-42  (68)
209 COG5112 UFD2 U1-like Zn-finger  44.2      12 0.00026   18.8   0.7   21   41-61     56-76  (126)
210 KOG3352|consensus               44.1      12 0.00026   20.1   0.7   13   13-25    133-145 (153)
211 PF10083 DUF2321:  Uncharacteri  44.0     9.4  0.0002   20.6   0.3   18   11-28     66-83  (158)
212 PF13824 zf-Mss51:  Zinc-finger  44.0      17 0.00038   16.0   1.1   15   10-24     11-25  (55)
213 PF08209 Sgf11:  Sgf11 (transcr  43.9      24 0.00052   13.7   2.5   20   41-61      5-24  (33)
214 PF02591 DUF164:  Putative zinc  43.8      27  0.0006   15.0   1.8    8   41-48     47-54  (56)
215 PRK12860 transcriptional activ  43.3      18 0.00039   20.2   1.3   12   13-24    134-145 (189)
216 KOG2807|consensus               42.7      69  0.0015   19.8   3.7   53   12-64    289-369 (378)
217 PF08792 A2L_zn_ribbon:  A2L zi  42.2      16 0.00034   14.1   0.8   12   13-24     21-32  (33)
218 PRK05452 anaerobic nitric oxid  40.5     7.2 0.00016   24.8  -0.5   16   11-26    423-438 (479)
219 PF14447 Prok-RING_4:  Prokaryo  40.2      18  0.0004   15.9   0.9   15   11-25     37-51  (55)
220 PF04810 zf-Sec23_Sec24:  Sec23  39.7      14  0.0003   14.8   0.5   32   13-50      2-34  (40)
221 PF14369 zf-RING_3:  zinc-finge  39.6      16 0.00035   14.3   0.6   10   15-24     23-32  (35)
222 KOG0227|consensus               39.5      17 0.00037   20.4   0.9   27    5-33     47-73  (222)
223 cd04476 RPA1_DBD_C RPA1_DBD_C:  39.5      22 0.00047   19.0   1.3   10   41-50     52-61  (166)
224 COG4338 Uncharacterized protei  39.4      13 0.00028   15.9   0.4   16   41-56     13-28  (54)
225 KOG2636|consensus               39.1      26 0.00056   22.4   1.7   21   12-32    400-421 (497)
226 PF14690 zf-ISL3:  zinc-finger   39.0      19 0.00042   14.6   0.9    9   13-21      2-10  (47)
227 PF14803 Nudix_N_2:  Nudix N-te  38.7      21 0.00045   13.9   0.9    9   41-49     23-31  (34)
228 KOG2857|consensus               38.6      18 0.00039   19.3   0.8   22   40-61     17-38  (157)
229 PF05180 zf-DNL:  DNL zinc fing  38.0      16 0.00035   16.7   0.6   41   13-56      4-45  (66)
230 PTZ00064 histone acetyltransfe  37.6      35 0.00077   22.3   2.1   23   41-63    281-303 (552)
231 PRK12722 transcriptional activ  37.5      28  0.0006   19.5   1.5   27   14-48    135-162 (187)
232 PF05876 Terminase_GpA:  Phage   37.3      18 0.00039   23.6   0.9   37   14-53    201-242 (557)
233 PRK03976 rpl37ae 50S ribosomal  37.1      17 0.00037   17.7   0.6   13   13-25     54-66  (90)
234 PF05766 NinG:  Bacteriophage L  37.0      14 0.00031   20.6   0.4   17   11-27      4-20  (189)
235 PRK01343 zinc-binding protein;  37.0      36 0.00078   15.1   1.5   10   14-23     10-19  (57)
236 PLN00104 MYST -like histone ac  36.6      33 0.00072   22.0   1.9   23   41-63    199-221 (450)
237 PF06397 Desulfoferrod_N:  Desu  36.5      20 0.00043   14.3   0.7   11   13-23      6-16  (36)
238 PF06044 DRP:  Dam-replacing fa  36.2      20 0.00044   20.9   0.9   35   14-54     32-67  (254)
239 TIGR00244 transcriptional regu  36.1      18  0.0004   19.3   0.7   15   14-28     29-43  (147)
240 KOG3014|consensus               35.9      29 0.00063   20.4   1.5   25   14-38     38-64  (257)
241 PF12907 zf-met2:  Zinc-binding  35.8      14 0.00031   15.1   0.2   20   42-61      3-25  (40)
242 COG0675 Transposase and inacti  35.3      60  0.0013   19.1   2.8   15   41-55    323-337 (364)
243 PRK08222 hydrogenase 4 subunit  34.1      33 0.00071   18.8   1.5   20   11-30    112-131 (181)
244 COG1327 Predicted transcriptio  33.6      20 0.00044   19.3   0.6   15   14-28     29-43  (156)
245 PF07503 zf-HYPF:  HypF finger;  32.0      38 0.00082   13.3   1.1   13   12-24     20-32  (35)
246 COG4306 Uncharacterized protei  31.9      25 0.00053   18.4   0.7   17   11-27     66-82  (160)
247 PTZ00448 hypothetical protein;  31.9      34 0.00073   21.3   1.4   22   41-62    315-336 (373)
248 CHL00174 accD acetyl-CoA carbo  31.8      20 0.00043   21.5   0.4   31   14-53     39-70  (296)
249 COG1066 Sms Predicted ATP-depe  31.6      38 0.00083   21.6   1.6   12   12-23      6-17  (456)
250 PF10071 DUF2310:  Zn-ribbon-co  31.5      36 0.00078   20.1   1.4   31   13-49    220-250 (258)
251 KOG0978|consensus               31.4      16 0.00035   24.6   0.1   47   13-59    643-697 (698)
252 COG5246 PRP11 Splicing factor   31.1      37 0.00081   19.0   1.3   27    6-34     48-74  (222)
253 KOG0782|consensus               30.9      19 0.00042   23.9   0.3   25   28-52    240-265 (1004)
254 PF11789 zf-Nse:  Zinc-finger o  30.7      37 0.00081   14.8   1.1   14   13-26     24-37  (57)
255 TIGR00515 accD acetyl-CoA carb  30.5      22 0.00047   21.2   0.4   30   14-52     27-57  (285)
256 PF00130 C1_1:  Phorbol esters/  30.4      52  0.0011   13.6   2.0   28   11-49      9-37  (53)
257 TIGR03830 CxxCG_CxxCG_HTH puta  30.2      54  0.0012   16.4   1.8   19   12-30     30-48  (127)
258 PRK07218 replication factor A;  30.1      36 0.00079   21.6   1.3   10   14-23    298-307 (423)
259 PF00649 Copper-fist:  Copper f  30.0      52  0.0011   13.5   1.4   15   37-51      5-19  (40)
260 PF02748 PyrI_C:  Aspartate car  29.5      22 0.00048   15.3   0.3   14   11-24     33-46  (52)
261 PTZ00303 phosphatidylinositol   29.3      39 0.00084   23.7   1.4   32   14-51    461-492 (1374)
262 TIGR00319 desulf_FeS4 desulfof  28.6      37 0.00079   12.9   0.8   12   12-23      6-17  (34)
263 KOG2461|consensus               28.6      29 0.00064   21.7   0.8   59    8-66    326-385 (396)
264 PF13240 zinc_ribbon_2:  zinc-r  28.6      34 0.00074   11.9   0.7    6   16-21      2-7   (23)
265 cd00974 DSRD Desulforedoxin (D  28.5      37 0.00079   12.9   0.8   11   13-23      4-14  (34)
266 PF04438 zf-HIT:  HIT zinc fing  28.4      36 0.00078   12.8   0.8   10   41-50     14-23  (30)
267 KOG3277|consensus               28.2      59  0.0013   17.7   1.7   40   13-55     79-119 (165)
268 PRK12387 formate hydrogenlyase  28.2      42  0.0009   18.3   1.3   18   12-29    113-130 (180)
269 PF04032 Rpr2:  RNAse P Rpr2/Rp  28.1     4.2 9.1E-05   19.0  -2.3   18    9-26     42-59  (85)
270 PRK05654 acetyl-CoA carboxylas  27.7      26 0.00056   21.0   0.4   30   14-52     28-58  (292)
271 COG5152 Uncharacterized conser  27.6      31 0.00067   19.6   0.7   16   11-26    194-209 (259)
272 COG1655 Uncharacterized protei  27.6      29 0.00062   20.2   0.6   24   11-34     17-40  (267)
273 KOG2747|consensus               27.2      43 0.00092   21.1   1.3   24   41-64    159-182 (396)
274 PF06170 DUF983:  Protein of un  27.1      27 0.00059   16.8   0.4   12   41-52      9-20  (86)
275 PF03884 DUF329:  Domain of unk  27.0      72  0.0016   14.1   2.3    9   42-50      4-12  (57)
276 COG5236 Uncharacterized conser  26.8      76  0.0017   19.8   2.2   22   41-62    221-242 (493)
277 PLN03239 histone acetyltransfe  26.8      48   0.001   20.5   1.4   22   41-62    107-128 (351)
278 smart00647 IBR In Between Ring  26.5      67  0.0015   13.6   1.7   12   41-52     41-52  (64)
279 KOG0801|consensus               26.3      32 0.00068   18.9   0.6   11   14-24    139-149 (205)
280 TIGR00155 pqiA_fam integral me  26.2      89  0.0019   19.7   2.5   36    8-50      8-43  (403)
281 PF02146 SIR2:  Sir2 family;  I  26.1   1E+02  0.0022   16.6   2.5   35   13-50    105-139 (178)
282 PF05290 Baculo_IE-1:  Baculovi  25.7      39 0.00085   17.9   0.8   49    6-54     73-135 (140)
283 PF13248 zf-ribbon_3:  zinc-rib  25.6      27 0.00058   12.4   0.2    6   16-21     19-24  (26)
284 smart00132 LIM Zinc-binding do  25.6      37 0.00079   12.6   0.6   10   14-23     28-37  (39)
285 smart00661 RPOL9 RNA polymeras  25.4      49  0.0011   13.6   1.0   31   15-53      2-33  (52)
286 PRK07591 threonine synthase; V  25.3      57  0.0012   20.5   1.6   12   13-24     18-29  (421)
287 PF14375 Cys_rich_CWC:  Cystein  25.2      45 0.00098   14.0   0.9    7   17-23      2-8   (50)
288 PRK06260 threonine synthase; V  25.2      68  0.0015   19.9   1.9   10   14-23      4-13  (397)
289 PRK11032 hypothetical protein;  24.6      26 0.00055   19.1   0.1   27   13-48    124-150 (160)
290 COG1198 PriA Primosomal protei  24.5      25 0.00054   23.9   0.0    8   41-48    476-483 (730)
291 KOG1702|consensus               24.4      33 0.00072   19.6   0.4   33   15-47      6-38  (264)
292 PF14255 Cys_rich_CPXG:  Cystei  24.3      38 0.00081   14.7   0.5   12   15-26      2-13  (52)
293 PF04161 Arv1:  Arv1-like famil  24.2      56  0.0012   18.4   1.3   31   14-48      1-32  (208)
294 PF12773 DZR:  Double zinc ribb  23.9      44 0.00095   13.7   0.7    9   41-49     30-38  (50)
295 PLN02748 tRNA dimethylallyltra  23.8      69  0.0015   20.7   1.8   23   12-34    417-440 (468)
296 PF12230 PRP21_like_P:  Pre-mRN  23.7      26 0.00057   19.9   0.0   29   41-70    169-197 (229)
297 PF03145 Sina:  Seven in absent  23.6 1.4E+02  0.0031   16.4   4.0   52   13-66     14-73  (198)
298 PRK14138 NAD-dependent deacety  23.5 1.1E+02  0.0024   17.7   2.5   34   12-48    118-151 (244)
299 PF09855 DUF2082:  Nucleic-acid  23.4      35 0.00076   15.5   0.4    8   41-48      1-8   (64)
300 COG2956 Predicted N-acetylgluc  23.4      57  0.0012   20.3   1.3    8   13-20    354-361 (389)
301 COG3024 Uncharacterized protei  23.3      51  0.0011   15.1   0.8   12   14-25      8-19  (65)
302 COG5151 SSL1 RNA polymerase II  23.2      47   0.001   20.4   0.9   23   41-63    389-411 (421)
303 cd01413 SIR2_Af2 SIR2_Af2: Arc  22.3 1.2E+02  0.0025   17.3   2.4   33   12-48    112-144 (222)
304 PF04216 FdhE:  Protein involve  22.2      14 0.00031   21.7  -1.3    9   14-22    173-181 (290)
305 COG1579 Zn-ribbon protein, pos  22.1      84  0.0018   18.4   1.8    9   41-49    222-230 (239)
306 TIGR03829 YokU_near_AblA uncha  22.0      63  0.0014   15.8   1.1   17   14-30     36-52  (89)
307 PF01194 RNA_pol_N:  RNA polyme  22.0      64  0.0014   14.5   1.0   15   13-27      4-18  (60)
308 PF11931 DUF3449:  Domain of un  21.7      31 0.00066   19.5   0.0   21   41-61    102-123 (196)
309 PF13821 DUF4187:  Domain of un  21.7      42 0.00091   14.6   0.4   19   41-59     28-46  (55)
310 COG0846 SIR2 NAD-dependent pro  21.5      59  0.0013   19.1   1.1   36   10-48    119-154 (250)
311 COG5188 PRP9 Splicing factor 3  21.1 1.9E+02  0.0042   18.3   3.1   24   36-59    369-394 (470)
312 PF05495 zf-CHY:  CHY zinc fing  21.0      64  0.0014   14.7   1.0   11   14-24     11-21  (71)
313 PF11238 DUF3039:  Protein of u  21.0      28  0.0006   15.5  -0.2   10   41-50     45-54  (58)
314 PF03107 C1_2:  C1 domain;  Int  20.9      68  0.0015   11.8   0.9    7   41-47     16-22  (30)
315 PF06524 NOA36:  NOA36 protein;  20.8      19 0.00041   21.3  -0.9   17   41-57    210-226 (314)
316 COG5027 SAS2 Histone acetyltra  20.7      67  0.0014   20.1   1.2   24   41-64    159-182 (395)
317 PF01844 HNH:  HNH endonuclease  20.5      47   0.001   13.2   0.5   10   16-25      1-10  (47)
318 KOG3214|consensus               20.5      60  0.0013   16.3   0.8   40   11-53     21-60  (109)
319 PRK08270 anaerobic ribonucleos  20.4      68  0.0015   21.7   1.3    8   41-48    640-647 (656)
320 PRK12366 replication factor A;  20.2      73  0.0016   21.4   1.4   25   14-49    533-557 (637)

No 1  
>KOG2462|consensus
Probab=99.87  E-value=6.3e-23  Score=112.71  Aligned_cols=72  Identities=26%  Similarity=0.483  Sum_probs=64.2

Q ss_pred             ChhhhhhhcCCCCeecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccccchHHHHHHhhhCCCCChhhhHH
Q psy10072          1 MRNHIRTHTGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVKQKDLNTHIERRHMPGDVLGHIQ   74 (84)
Q Consensus         1 l~~h~~~h~~~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~   74 (84)
                      |+.|+|+|+  -++.|.+||+.|.++.-|+.|+++|+|++ |.|..|++.|.+.++|..||++|.+.+.|.|..+
T Consensus       177 LkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C  249 (279)
T KOG2462|consen  177 LKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRC  249 (279)
T ss_pred             HhhHhhccC--CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcch
Confidence            567888887  57999999999999999999999999988 9999999999999999999999999999988443


No 2  
>KOG2462|consensus
Probab=99.85  E-value=2.7e-22  Score=110.27  Aligned_cols=62  Identities=40%  Similarity=0.779  Sum_probs=59.4

Q ss_pred             ChhhhhhhcCCCCeecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccccchHHHHHHhh
Q psy10072          1 MRNHIRTHTGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVKQKDLNTHIER   62 (84)
Q Consensus         1 l~~h~~~h~~~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~~~~l~~H~~~   62 (84)
                      |+.|+|+|||||||.|+.|++.|.+.++|..|+++|.+.+ |+|..|++.|...+.|.+|...
T Consensus       203 LQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  203 LQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             hhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            6789999999999999999999999999999999999988 9999999999999999999764


No 3  
>KOG3623|consensus
Probab=99.51  E-value=4.1e-15  Score=91.16  Aligned_cols=65  Identities=15%  Similarity=0.225  Sum_probs=52.4

Q ss_pred             CCCCeecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccccchHHHHHHhhhCCCCChhhhHH
Q psy10072         10 GEKPYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVKQKDLNTHIERRHMPGDVLGHIQ   74 (84)
Q Consensus        10 ~~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~   74 (84)
                      .+.+|.|..|++.|.-.+.|.+|.--|+|.+ |+|..|.++|.....|+.|.+.|.||+||+|..+
T Consensus       891 e~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKC  956 (1007)
T KOG3623|consen  891 EDGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKC  956 (1007)
T ss_pred             ccccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhh
Confidence            3457888888888888888888888888877 8888888888888888888888888888888655


No 4  
>KOG3623|consensus
Probab=99.47  E-value=1.2e-14  Score=89.16  Aligned_cols=71  Identities=21%  Similarity=0.492  Sum_probs=61.1

Q ss_pred             ChhhhhhhcCCCCeecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccccchHHHHHHhh-hCCCCChhh
Q psy10072          1 MRNHIRTHTGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVKQKDLNTHIER-RHMPGDVLG   71 (84)
Q Consensus         1 l~~h~~~h~~~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~~~~l~~H~~~-~~~~~~~~~   71 (84)
                      |.+|.=-|+|.+||.|.+|.+.|..+..|.-|.+.|.|.+ |+|..|++.|...+++..||.- -.-=+||..
T Consensus       910 LaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHMNHRYSYCKpyrE  982 (1007)
T KOG3623|consen  910 LARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHMNHRYSYCKPYRE  982 (1007)
T ss_pred             HHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhhccchhcccchhh
Confidence            4567778999999999999999999999999999999999 9999999999999999999863 233344443


No 5  
>KOG3576|consensus
Probab=99.43  E-value=1.3e-14  Score=77.74  Aligned_cols=60  Identities=25%  Similarity=0.535  Sum_probs=31.3

Q ss_pred             hhhhhhhcCCCCeecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccccchHHHHHHh
Q psy10072          2 RNHIRTHTGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVKQKDLNTHIE   61 (84)
Q Consensus         2 ~~h~~~h~~~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~~~~l~~H~~   61 (84)
                      .+|++-|...+.+.|..||+.|...-+|.+|+++|+|.. |+|..|++.|.+.-+|..|.+
T Consensus       134 nrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~  194 (267)
T KOG3576|consen  134 NRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLK  194 (267)
T ss_pred             HHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHH
Confidence            344555555555555555555555555555555555544 555555555555555555544


No 6  
>KOG1074|consensus
Probab=99.42  E-value=2.4e-14  Score=88.63  Aligned_cols=64  Identities=31%  Similarity=0.652  Sum_probs=58.4

Q ss_pred             ChhhhhhhcCCCCeecCCCCccccChhhHHHHHHhcCCce-----eeCC---CCccccccchHHHHHHhhhC
Q psy10072          1 MRNHIRTHTGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLK-----VKCP---HCAYKCVKQKDLNTHIERRH   64 (84)
Q Consensus         1 l~~h~~~h~~~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~-----~~c~---~C~~~f~~~~~l~~H~~~~~   64 (84)
                      |+.|.|+|+|++||+|++|++.|.++.+|..|+..|...+     +.|+   .|.+.|...-.|..|++.|.
T Consensus       621 LqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~lpQhIriH~  692 (958)
T KOG1074|consen  621 LQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTLPQHIRIHL  692 (958)
T ss_pred             hhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhcccccccccccceEEeec
Confidence            6789999999999999999999999999999999887543     7899   89999999999999999987


No 7  
>KOG3576|consensus
Probab=99.36  E-value=1.7e-13  Score=73.46  Aligned_cols=65  Identities=18%  Similarity=0.341  Sum_probs=60.2

Q ss_pred             CCCeecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccccchHHHHHHhhhCCCCChhhhHHH
Q psy10072         11 EKPYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVKQKDLNTHIERRHMPGDVLGHIQQ   75 (84)
Q Consensus        11 ~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~~   75 (84)
                      ...+.|.+|++.|....-|.+|++-|...+ +-|..||+.|.+.-.|++|.++|++..||.|..+.
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~  180 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCE  180 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhh
Confidence            346899999999999999999999999988 99999999999999999999999999999996654


No 8  
>PHA00733 hypothetical protein
Probab=99.32  E-value=3.4e-12  Score=64.84  Aligned_cols=61  Identities=20%  Similarity=0.494  Sum_probs=51.0

Q ss_pred             hhhhhhcCCCCeecCCCCccccChhhHHHHHHhcCCceeeCCCCccccccchHHHHHHhhhCC
Q psy10072          3 NHIRTHTGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCVKQKDLNTHIERRHM   65 (84)
Q Consensus         3 ~h~~~h~~~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f~~~~~l~~H~~~~~~   65 (84)
                      +|+..+ +.+||.|+.|++.|.....|..|++.+. .++.|..|++.|.....|..|+...+.
T Consensus        64 ~~~~~~-~~kPy~C~~Cgk~Fss~s~L~~H~r~h~-~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         64 KLLTSK-AVSPYVCPLCLMPFSSSVSLKQHIRYTE-HSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             hhcccC-CCCCccCCCCCCcCCCHHHHHHHHhcCC-cCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            444444 4789999999999999999999998662 239999999999999999999887654


No 9  
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.31  E-value=6.2e-13  Score=49.99  Aligned_cols=25  Identities=56%  Similarity=1.182  Sum_probs=22.4

Q ss_pred             ChhhhhhhcCCCCeecCCCCccccC
Q psy10072          1 MRNHIRTHTGEKPYKCTFCPFTAAH   25 (84)
Q Consensus         1 l~~h~~~h~~~k~~~c~~C~~~f~~   25 (84)
                      |.+||++|+|++||.|+.|++.|.+
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            5789999999999999999998863


No 10 
>PHA02768 hypothetical protein; Provisional
Probab=99.27  E-value=1.5e-12  Score=56.43  Aligned_cols=44  Identities=23%  Similarity=0.452  Sum_probs=39.0

Q ss_pred             CeecCCCCccccChhhHHHHHHhcCCceeeCCCCccccccchHHH
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCVKQKDLN   57 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f~~~~~l~   57 (84)
                      -|.|++||+.|...+.|..|++.|. .+++|..|++.|.+.+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~-k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN-TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC-CcccCCcccceecccceeE
Confidence            3799999999999999999999998 3489999999999877664


No 11 
>KOG3608|consensus
Probab=99.07  E-value=9.8e-11  Score=67.49  Aligned_cols=83  Identities=24%  Similarity=0.546  Sum_probs=57.5

Q ss_pred             Chhhhh-hhcCCCCeecCCCCccccChhhHHHHHHhcCCceeeCCC--CccccccchHHHHHHhhhC-CCC--ChhhhH-
Q psy10072          1 MRNHIR-THTGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPH--CAYKCVKQKDLNTHIERRH-MPG--DVLGHI-   73 (84)
Q Consensus         1 l~~h~~-~h~~~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~--C~~~f~~~~~l~~H~~~~~-~~~--~~~~~~-   73 (84)
                      |..|++ .|...|||.|..|+..+.+.+.|.+|...|....|+|..  |...+++...+.+|+..++ +..  +|.|.. 
T Consensus       279 L~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~C  358 (467)
T KOG3608|consen  279 LTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHSKTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCC  358 (467)
T ss_pred             HHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhccccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecc
Confidence            356777 477778888888888888888888888877744488866  8888888778888877654 333  456633 


Q ss_pred             HHHHHhccCC
Q psy10072         74 QQMLEIGHNM   83 (84)
Q Consensus        74 ~~~~~~~~~~   83 (84)
                      +..+..|.++
T Consensus       359 dr~ft~G~~L  368 (467)
T KOG3608|consen  359 DRFFTSGKSL  368 (467)
T ss_pred             hhhhccchhH
Confidence            3455555543


No 12 
>KOG1074|consensus
Probab=99.04  E-value=5.2e-11  Score=74.36  Aligned_cols=59  Identities=19%  Similarity=0.339  Sum_probs=54.9

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccccchHHHHHHhhhCCCCChhhh
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVKQKDLNTHIERRHMPGDVLGH   72 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~~   72 (84)
                      ..|..|++.|...+.|..|+++|++.+ |.|..|++.|....+|+.||.+|.+..|..-.
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~w~q~~srr  939 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHMWVQPPSRR  939 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhccccccCCCccC
Confidence            689999999999999999999999999 99999999999999999999999888776543


No 13 
>KOG3608|consensus
Probab=98.95  E-value=7.1e-10  Score=64.04  Aligned_cols=70  Identities=29%  Similarity=0.648  Sum_probs=57.3

Q ss_pred             ChhhhhhhcCCCCeecCCCCccccChhhHHHHHHh-cCCce-eeCCCCccccccchHHHHHHhhhCCCCChhhhH
Q psy10072          1 MRNHIRTHTGEKPYKCTFCPFTAAHSSTMSYHLRI-HQDLK-VKCPHCAYKCVKQKDLNTHIERRHMPGDVLGHI   73 (84)
Q Consensus         1 l~~h~~~h~~~k~~~c~~C~~~f~~~~~l~~h~~~-~~~~~-~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~   73 (84)
                      |+.|++.|..-  |.|+.|+.+....+.|..|++. |...+ |+|+.|++.|...+.|.+|..+|. +..|.|..
T Consensus       253 L~~Hv~rHvn~--ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h  324 (467)
T KOG3608|consen  253 LKSHVVRHVNC--YKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEH  324 (467)
T ss_pred             HHHHHHHhhhc--ccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCC
Confidence            45677777554  8999999999999999999986 66666 999999999999999999998877 56676643


No 14 
>PHA00616 hypothetical protein
Probab=98.75  E-value=3.1e-09  Score=44.17  Aligned_cols=30  Identities=20%  Similarity=0.361  Sum_probs=16.1

Q ss_pred             eeCCCCccccccchHHHHHHhhhCCCCChh
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERRHMPGDVL   70 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~   70 (84)
                      |+|+.||+.|.+.+.+..|++.+++++++.
T Consensus         2 YqC~~CG~~F~~~s~l~~H~r~~hg~~~~~   31 (44)
T PHA00616          2 YQCLRCGGIFRKKKEVIEHLLSVHKQNKLT   31 (44)
T ss_pred             CccchhhHHHhhHHHHHHHHHHhcCCCccc
Confidence            345555555555555555555555555543


No 15 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.70  E-value=1.6e-08  Score=37.82  Aligned_cols=24  Identities=33%  Similarity=0.665  Sum_probs=21.3

Q ss_pred             hHHHHHHhcCCce-eeCCCCccccc
Q psy10072         28 TMSYHLRIHQDLK-VKCPHCAYKCV   51 (84)
Q Consensus        28 ~l~~h~~~~~~~~-~~c~~C~~~f~   51 (84)
                      +|..|++.|++.+ |.|+.|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            4788999999988 99999999886


No 16 
>PHA00732 hypothetical protein
Probab=98.69  E-value=2.7e-08  Score=46.69  Aligned_cols=46  Identities=33%  Similarity=0.612  Sum_probs=38.3

Q ss_pred             CeecCCCCccccChhhHHHHHHh-cCCceeeCCCCccccccchHHHHHHhhh
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRI-HQDLKVKCPHCAYKCVKQKDLNTHIERR   63 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~-~~~~~~~c~~C~~~f~~~~~l~~H~~~~   63 (84)
                      ||.|..|++.|.....|..|++. |.+  +.|..|++.|.   .+..|....
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~--~~C~~CgKsF~---~l~~H~~~~   47 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL--TKCPVCNKSYR---RLNQHFYSQ   47 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC--CccCCCCCEeC---Chhhhhccc
Confidence            68899999999999999999984 554  58999999998   467887553


No 17 
>PHA00616 hypothetical protein
Probab=98.67  E-value=7.4e-09  Score=43.04  Aligned_cols=33  Identities=15%  Similarity=0.158  Sum_probs=29.3

Q ss_pred             CeecCCCCccccChhhHHHHHHhcCCce-eeCCC
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPH   45 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~   45 (84)
                      ||.|..||+.|...+.+..|++.+++.+ +.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            6899999999999999999999998877 77653


No 18 
>PHA02768 hypothetical protein; Provisional
Probab=98.64  E-value=2e-08  Score=43.71  Aligned_cols=29  Identities=24%  Similarity=0.550  Sum_probs=25.5

Q ss_pred             eeCCCCccccccchHHHHHHhhhCCCCChhh
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERRHMPGDVLG   71 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~   71 (84)
                      |.|+.||+.|.+.++|..|++.|+  +++.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc   34 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKL   34 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccC
Confidence            899999999999999999999998  34444


No 19 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.62  E-value=5.4e-08  Score=59.70  Aligned_cols=57  Identities=14%  Similarity=0.332  Sum_probs=23.8

Q ss_pred             CCeecCCCCccccChhhHHHHHHhcCCceeeCCCCccccccchHHHHHHhhhCCCCChhhh
Q psy10072         12 KPYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCVKQKDLNTHIERRHMPGDVLGH   72 (84)
Q Consensus        12 k~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~~   72 (84)
                      +.+.|+.|++.|. ...+..|+..+. .++.|+ |+..+ ....|..|+..+.+++++.|.
T Consensus       452 ~H~~C~~Cgk~f~-~s~LekH~~~~H-kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~  508 (567)
T PLN03086        452 NHVHCEKCGQAFQ-QGEMEKHMKVFH-EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCR  508 (567)
T ss_pred             cCccCCCCCCccc-hHHHHHHHHhcC-CCccCC-CCCCc-chhHHHhhhhccCCCCceeCC
Confidence            3344444444443 233444444432 224444 44322 234444444444444444443


No 20 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.45  E-value=5.4e-07  Score=39.36  Aligned_cols=49  Identities=27%  Similarity=0.616  Sum_probs=37.4

Q ss_pred             CeecCCCCccccChhhHHHHHHh-cCCc-e-eeCCCCccccccchHHHHHHhhhC
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRI-HQDL-K-VKCPHCAYKCVKQKDLNTHIERRH   64 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~-~~~~-~-~~c~~C~~~f~~~~~l~~H~~~~~   64 (84)
                      .|.|+.|++. .....|..|... |... + +.|+.|...+.  .+|..|+..++
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            4789999994 556789999764 6554 3 89999997644  48999988765


No 21 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.45  E-value=1.9e-07  Score=57.41  Aligned_cols=69  Identities=16%  Similarity=0.319  Sum_probs=55.4

Q ss_pred             ChhhhhhhcCCCCeecCCCCccccChhhHHHHHHhcCCce-eeCCCCcccccc----------chHHHHHHhhhCCCCCh
Q psy10072          1 MRNHIRTHTGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVK----------QKDLNTHIERRHMPGDV   69 (84)
Q Consensus         1 l~~h~~~h~~~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~----------~~~l~~H~~~~~~~~~~   69 (84)
                      |..|+.+++  +++.|+ |++.+ ....|..|+..+.+.+ +.|..|++.+..          ...|..|.... +.+++
T Consensus       468 LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~  542 (567)
T PLN03086        468 MEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTA  542 (567)
T ss_pred             HHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcce
Confidence            357888874  789999 99765 5678999998888877 999999998842          34789998774 88899


Q ss_pred             hhhHH
Q psy10072         70 LGHIQ   74 (84)
Q Consensus        70 ~~~~~   74 (84)
                      .|..+
T Consensus       543 ~C~~C  547 (567)
T PLN03086        543 PCDSC  547 (567)
T ss_pred             Ecccc
Confidence            98655


No 22 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.41  E-value=2.2e-07  Score=33.54  Aligned_cols=20  Identities=30%  Similarity=0.762  Sum_probs=9.7

Q ss_pred             eCCCCccccccchHHHHHHh
Q psy10072         42 KCPHCAYKCVKQKDLNTHIE   61 (84)
Q Consensus        42 ~c~~C~~~f~~~~~l~~H~~   61 (84)
                      .|+.|++.|.....|..|++
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~   21 (23)
T PF00096_consen    2 KCPICGKSFSSKSNLKRHMR   21 (23)
T ss_dssp             EETTTTEEESSHHHHHHHHH
T ss_pred             CCCCCCCccCCHHHHHHHHh
Confidence            44444444444444444444


No 23 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.41  E-value=2.1e-07  Score=33.59  Aligned_cols=23  Identities=35%  Similarity=0.743  Sum_probs=21.0

Q ss_pred             eecCCCCccccChhhHHHHHHhc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIH   36 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~   36 (84)
                      |.|+.|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            68999999999999999999764


No 24 
>KOG3993|consensus
Probab=98.35  E-value=1.7e-07  Score=55.53  Aligned_cols=52  Identities=23%  Similarity=0.431  Sum_probs=44.6

Q ss_pred             CeecCCCCccccChhhHHHHHHhcCC---------------------------------ce-eeCCCCccccccchHHHH
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIHQD---------------------------------LK-VKCPHCAYKCVKQKDLNT   58 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~~~---------------------------------~~-~~c~~C~~~f~~~~~l~~   58 (84)
                      -|+|++|++.|.-+.+|.-|.++|..                                 .. |.|..|++.|++...|+.
T Consensus       295 EYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrK  374 (500)
T KOG3993|consen  295 EYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRK  374 (500)
T ss_pred             eecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHH
Confidence            48999999999999999999988731                                 12 789999999999999999


Q ss_pred             HHhhhC
Q psy10072         59 HIERRH   64 (84)
Q Consensus        59 H~~~~~   64 (84)
                      |+.+|+
T Consensus       375 Hqlthq  380 (500)
T KOG3993|consen  375 HQLTHQ  380 (500)
T ss_pred             hHHhhh
Confidence            987765


No 25 
>PHA00733 hypothetical protein
Probab=98.27  E-value=1.7e-07  Score=47.82  Aligned_cols=60  Identities=13%  Similarity=0.119  Sum_probs=44.1

Q ss_pred             CCCeecCCCCccccChhhHHHH------HHhcCCceeeCCCCccccccchHHHHHHhhhCCCCChhhh
Q psy10072         11 EKPYKCTFCPFTAAHSSTMSYH------LRIHQDLKVKCPHCAYKCVKQKDLNTHIERRHMPGDVLGH   72 (84)
Q Consensus        11 ~k~~~c~~C~~~f~~~~~l~~h------~~~~~~~~~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~~   72 (84)
                      .+++.|.+|...|..+..|..+      +..+...+|.|..|++.|.....|..|+..+  +.++.|.
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~  103 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCP  103 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCC
Confidence            5678899999888877665554      2223333399999999999999999999865  2345553


No 26 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.21  E-value=1.6e-06  Score=31.27  Aligned_cols=23  Identities=22%  Similarity=0.634  Sum_probs=11.7

Q ss_pred             eeCCCCccccccchHHHHHHhhh
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERR   63 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~   63 (84)
                      |.|+.|++.|.....|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            45555555555555555555543


No 27 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.09  E-value=2.7e-06  Score=31.78  Aligned_cols=24  Identities=33%  Similarity=0.592  Sum_probs=12.5

Q ss_pred             CeecCCCCccccChhhHHHHHHhc
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIH   36 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~   36 (84)
                      ||.|..|++.|.....|..|++.|
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHh
Confidence            345555555555555555555443


No 28 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.00  E-value=7.6e-06  Score=29.39  Aligned_cols=23  Identities=26%  Similarity=0.670  Sum_probs=19.1

Q ss_pred             eecCCCCccccChhhHHHHHHhc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIH   36 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~   36 (84)
                      |.|+.|++.|.....+..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            68999999999999999999865


No 29 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.97  E-value=6.5e-06  Score=30.73  Aligned_cols=25  Identities=16%  Similarity=0.337  Sum_probs=22.5

Q ss_pred             eeCCCCccccccchHHHHHHhhhCC
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERRHM   65 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~~~   65 (84)
                      |.|..|++.|.....|..|++.|..
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCccCCccCChhHHHHHhHHhcC
Confidence            7899999999999999999987653


No 30 
>KOG3993|consensus
Probab=97.96  E-value=1.2e-06  Score=52.04  Aligned_cols=52  Identities=17%  Similarity=0.314  Sum_probs=45.5

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccccchHHHHHHhhhCC
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVKQKDLNTHIERRHM   65 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~~~~l~~H~~~~~~   65 (84)
                      |.|..|...|.+.-.|.+|.-...... |+|++|+++|.-..+|..|++.|..
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKP  320 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKP  320 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCC
Confidence            889999999999999998876555544 9999999999999999999998864


No 31 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.77  E-value=3.5e-05  Score=32.94  Aligned_cols=29  Identities=28%  Similarity=0.568  Sum_probs=20.9

Q ss_pred             eeCCCCccccccchHHHHHHhhhCCCCCh
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERRHMPGDV   69 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~~~~~~~   69 (84)
                      ..|+.|+..+++..+|.+|+...+..+|.
T Consensus        25 atCP~C~a~~~~srnLrRHle~~H~~k~~   53 (54)
T PF09237_consen   25 ATCPICGAVIRQSRNLRRHLEIRHFKKPG   53 (54)
T ss_dssp             EE-TTT--EESSHHHHHHHHHHHTTTS--
T ss_pred             CCCCcchhhccchhhHHHHHHHHhcccCC
Confidence            78999999999999999999888877763


No 32 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.72  E-value=1.5e-05  Score=46.11  Aligned_cols=51  Identities=27%  Similarity=0.574  Sum_probs=41.3

Q ss_pred             CCCeecCC--CCccccChhhHHHHHHh-c---------C---------Cce-eeCCCCccccccchHHHHHHh
Q psy10072         11 EKPYKCTF--CPFTAAHSSTMSYHLRI-H---------Q---------DLK-VKCPHCAYKCVKQKDLNTHIE   61 (84)
Q Consensus        11 ~k~~~c~~--C~~~f~~~~~l~~h~~~-~---------~---------~~~-~~c~~C~~~f~~~~~l~~H~~   61 (84)
                      +|||.|++  |.+.|...-.|.-|+.. |         .         ..+ |.|++|++.|.....|+-|+.
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            59999986  99999999899888763 3         0         114 899999999999988988853


No 33 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.64  E-value=5e-05  Score=27.52  Aligned_cols=20  Identities=25%  Similarity=0.715  Sum_probs=10.0

Q ss_pred             eCCCCccccccchHHHHHHh
Q psy10072         42 KCPHCAYKCVKQKDLNTHIE   61 (84)
Q Consensus        42 ~c~~C~~~f~~~~~l~~H~~   61 (84)
                      .|..|++.|.....+..|+.
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~   21 (26)
T smart00355        2 RCPECGKVFKSKSALKEHMR   21 (26)
T ss_pred             CCCCCcchhCCHHHHHHHHH
Confidence            34455555555555555544


No 34 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.61  E-value=7e-05  Score=27.11  Aligned_cols=24  Identities=29%  Similarity=0.610  Sum_probs=21.1

Q ss_pred             eecCCCCccccChhhHHHHHHhcC
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQ   37 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~   37 (84)
                      +.|..|++.|.....+..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            579999999999999999988654


No 35 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.59  E-value=6.2e-05  Score=36.36  Aligned_cols=23  Identities=22%  Similarity=0.647  Sum_probs=20.4

Q ss_pred             eeCCCCccccccchHHHHHHhhh
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERR   63 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~   63 (84)
                      +.|..|++.|.....|..|++.+
T Consensus        51 ~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   51 FRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             EEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCccCCCCcCHHHHHHHHcCc
Confidence            78999999999999999999964


No 36 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.42  E-value=0.00021  Score=30.62  Aligned_cols=30  Identities=27%  Similarity=0.512  Sum_probs=21.0

Q ss_pred             cCCCCeecCCCCccccChhhHHHHHHhcCC
Q psy10072          9 TGEKPYKCTFCPFTAAHSSTMSYHLRIHQD   38 (84)
Q Consensus         9 ~~~k~~~c~~C~~~f~~~~~l~~h~~~~~~   38 (84)
                      ..+.|..|++|+..+....+|.+|+....+
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~   49 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHF   49 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTT
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhc
Confidence            456799999999999999999999976544


No 37 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.42  E-value=0.00015  Score=26.20  Aligned_cols=23  Identities=43%  Similarity=1.099  Sum_probs=13.7

Q ss_pred             eeCCCCccccccchHHHHHHhhhC
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERRH   64 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~~   64 (84)
                      |+|..|+.... ...|.+|++.++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            56777776665 667777766643


No 38 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.38  E-value=0.00013  Score=26.51  Aligned_cols=21  Identities=24%  Similarity=0.653  Sum_probs=10.8

Q ss_pred             eecCCCCccccChhhHHHHHH
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLR   34 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~   34 (84)
                      |.|..|++.|.....+..|++
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCCCcCCHHHHHHHHC
Confidence            345555555555555555544


No 39 
>PRK04860 hypothetical protein; Provisional
Probab=97.32  E-value=0.00027  Score=37.52  Aligned_cols=35  Identities=31%  Similarity=0.710  Sum_probs=19.6

Q ss_pred             CeecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccc
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCV   51 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~   51 (84)
                      +|.|. |+.   ....+..|.+.+.+.+ |.|..|+..|.
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~  154 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLV  154 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeE
Confidence            45565 654   3444556666666555 66666665554


No 40 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.22  E-value=0.00029  Score=25.59  Aligned_cols=23  Identities=17%  Similarity=0.481  Sum_probs=20.5

Q ss_pred             eeCCCCccccccchHHHHHHhhh
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERR   63 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~   63 (84)
                      |.|..|.+.|.....+..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            67999999999999999998753


No 41 
>PRK04860 hypothetical protein; Provisional
Probab=96.84  E-value=0.00063  Score=36.12  Aligned_cols=25  Identities=36%  Similarity=0.596  Sum_probs=22.4

Q ss_pred             hhhhhhhcCCCCeecCCCCccccCh
Q psy10072          2 RNHIRTHTGEKPYKCTFCPFTAAHS   26 (84)
Q Consensus         2 ~~h~~~h~~~k~~~c~~C~~~f~~~   26 (84)
                      ++|.++|+++++|.|..|+..|...
T Consensus       132 rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        132 RRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             HHHHHHhcCCccEECCCCCceeEEe
Confidence            6899999999999999999988654


No 42 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.69  E-value=0.00051  Score=25.51  Aligned_cols=21  Identities=19%  Similarity=0.496  Sum_probs=12.6

Q ss_pred             eeCCCCccccccchHHHHHHh
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIE   61 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~   61 (84)
                      |.|..|++.|.....+..|+.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            446666666666666665554


No 43 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.44  E-value=0.0033  Score=22.98  Aligned_cols=20  Identities=15%  Similarity=0.403  Sum_probs=12.5

Q ss_pred             eecCCCCccccChhhHHHHHH
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLR   34 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~   34 (84)
                      ..|+.|++.| ....|.+|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            3577777777 4445666654


No 44 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=96.41  E-value=0.0019  Score=28.15  Aligned_cols=29  Identities=24%  Similarity=0.628  Sum_probs=21.8

Q ss_pred             CCce-eeCCCCccccccchHHHHHHhhhCC
Q psy10072         37 QDLK-VKCPHCAYKCVKQKDLNTHIERRHM   65 (84)
Q Consensus        37 ~~~~-~~c~~C~~~f~~~~~l~~H~~~~~~   65 (84)
                      .|+. +.|+-|+..|+....+.+|....++
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            3555 7888888888888888888776543


No 45 
>PHA00732 hypothetical protein
Probab=96.40  E-value=0.0031  Score=29.68  Aligned_cols=25  Identities=32%  Similarity=0.712  Sum_probs=21.9

Q ss_pred             eeCCCCccccccchHHHHHHhh-hCC
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIER-RHM   65 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~-~~~   65 (84)
                      |.|..|++.|.+...|..|++. |.+
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H~r~~H~~   27 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQHARRNHTL   27 (79)
T ss_pred             ccCCCCCCccCCHHHHHHHhhcccCC
Confidence            6899999999999999999984 554


No 46 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=96.31  E-value=0.0045  Score=24.15  Aligned_cols=22  Identities=23%  Similarity=0.593  Sum_probs=16.5

Q ss_pred             CeecCCCCccccChhhHHHHHH
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLR   34 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~   34 (84)
                      +|.|..|+..|.....+..|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            4778888888887777777765


No 47 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=95.87  E-value=0.0072  Score=26.22  Aligned_cols=34  Identities=26%  Similarity=0.467  Sum_probs=24.2

Q ss_pred             eeCCCCccccccchHHHHHHhhhCC-C-CChhhhHHH
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERRHM-P-GDVLGHIQQ   75 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~~~-~-~~~~~~~~~   75 (84)
                      |.|+.|++. .+...|..|....+. + +.+.|.++.
T Consensus         3 f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~   38 (54)
T PF05605_consen    3 FTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICS   38 (54)
T ss_pred             cCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCch
Confidence            789999995 556789999886543 2 356665554


No 48 
>KOG2186|consensus
Probab=95.59  E-value=0.0098  Score=33.80  Aligned_cols=50  Identities=12%  Similarity=0.321  Sum_probs=38.4

Q ss_pred             CeecCCCCccccChhhHHHHHHhcCCceeeCCCCccccccchHHHHHHhhhC
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCVKQKDLNTHIERRH   64 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f~~~~~l~~H~~~~~   64 (84)
                      .|.|..||....-+ .+.+|+....+..|.|.-|+..|.. ..+..|...-+
T Consensus         3 ~FtCnvCgEsvKKp-~vekH~srCrn~~fSCIDC~k~F~~-~sYknH~kCIT   52 (276)
T KOG2186|consen    3 FFTCNVCGESVKKP-QVEKHMSRCRNAYFSCIDCGKTFER-VSYKNHTKCIT   52 (276)
T ss_pred             EEehhhhhhhcccc-chHHHHHhccCCeeEEeeccccccc-chhhhhhhhcc
Confidence            37899999876654 5788988777755999999999998 55777765433


No 49 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=95.25  E-value=0.029  Score=22.45  Aligned_cols=34  Identities=21%  Similarity=0.357  Sum_probs=23.7

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCceeeCCCCccccc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCV   51 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f~   51 (84)
                      ..|+.|+..|.....    .....+.+.+|+.|+..|.
T Consensus         3 i~CP~C~~~f~v~~~----~l~~~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDD----KLPAGGRKVRCPKCGHVFR   36 (37)
T ss_pred             EECCCCCceEEcCHH----HcccCCcEEECCCCCcEee
Confidence            479999998877653    1223344589999998774


No 50 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=95.19  E-value=0.034  Score=22.14  Aligned_cols=33  Identities=18%  Similarity=0.343  Sum_probs=23.2

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCceeeCCCCcccc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKC   50 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f   50 (84)
                      ..|+.|+..|.-...    +....+.+.+|+.|+..|
T Consensus         3 i~Cp~C~~~y~i~d~----~ip~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDE----KIPPKGRKVRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEEeCCHH----HCCCCCcEEECCCCCCEe
Confidence            479999988877654    222334458999998876


No 51 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=95.00  E-value=0.033  Score=26.69  Aligned_cols=24  Identities=21%  Similarity=0.623  Sum_probs=21.2

Q ss_pred             CeecCCCCccccChhhHHHHHHhc
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIH   36 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~   36 (84)
                      .+.|..|++.|.....|..|++.+
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCc
Confidence            589999999999999999999864


No 52 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.69  E-value=0.0086  Score=35.60  Aligned_cols=60  Identities=27%  Similarity=0.409  Sum_probs=48.9

Q ss_pred             CCeecCCCCccccChhhHHHHHH--hcCCc--e-eeCC--CCccccccchHHHHHHhhhCCCCChhh
Q psy10072         12 KPYKCTFCPFTAAHSSTMSYHLR--IHQDL--K-VKCP--HCAYKCVKQKDLNTHIERRHMPGDVLG   71 (84)
Q Consensus        12 k~~~c~~C~~~f~~~~~l~~h~~--~~~~~--~-~~c~--~C~~~f~~~~~l~~H~~~~~~~~~~~~   71 (84)
                      .++.|..|...|.....+..|.+  .|.+.  + +.|+  .|++.|.+...+..|...+....+..+
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  354 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKE  354 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCcccc
Confidence            36788889999999888888888  78877  6 8888  799999999888888888777665544


No 53 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=94.58  E-value=0.016  Score=25.35  Aligned_cols=30  Identities=17%  Similarity=0.332  Sum_probs=25.3

Q ss_pred             hhcCCCCeecCCCCccccChhhHHHHHHhc
Q psy10072          7 THTGEKPYKCTFCPFTAAHSSTMSYHLRIH   36 (84)
Q Consensus         7 ~h~~~k~~~c~~C~~~f~~~~~l~~h~~~~   36 (84)
                      ...|+.-+.|+.|+..|....+...|+...
T Consensus        11 ~RDGE~~lrCPRC~~~FR~~K~Y~RHVNKa   40 (65)
T COG4049          11 DRDGEEFLRCPRCGMVFRRRKDYIRHVNKA   40 (65)
T ss_pred             ccCCceeeeCCchhHHHHHhHHHHHHhhHH
Confidence            456788899999999999999999998643


No 54 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=94.53  E-value=0.053  Score=21.60  Aligned_cols=34  Identities=18%  Similarity=0.289  Sum_probs=22.5

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCceeeCCCCccccc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCV   51 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f~   51 (84)
                      ..|+.|+..|......    ....+....|+.|+..|.
T Consensus         3 ~~CP~C~~~~~v~~~~----~~~~~~~v~C~~C~~~~~   36 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQ----LGANGGKVRCGKCGHVWY   36 (38)
T ss_pred             EECCCCCCEEEeCHHH----cCCCCCEEECCCCCCEEE
Confidence            5799999888666432    112223489999998764


No 55 
>KOG2893|consensus
Probab=94.20  E-value=0.011  Score=33.44  Aligned_cols=46  Identities=24%  Similarity=0.507  Sum_probs=34.4

Q ss_pred             CCCeecCCCCccccChhhHHHHHHhcCCceeeCCCCccccccchHHHHHH
Q psy10072         11 EKPYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCVKQKDLNTHI   60 (84)
Q Consensus        11 ~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f~~~~~l~~H~   60 (84)
                      .||| |=.|++.|.....|.+|++   .+-|+|-.|.+....-..|..|-
T Consensus         9 ~kpw-cwycnrefddekiliqhqk---akhfkchichkkl~sgpglsihc   54 (341)
T KOG2893|consen    9 DKPW-CWYCNREFDDEKILIQHQK---AKHFKCHICHKKLFSGPGLSIHC   54 (341)
T ss_pred             CCce-eeecccccchhhhhhhhhh---hccceeeeehhhhccCCCceeeh
Confidence            4565 6789999999999988876   33399999987665555566663


No 56 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.11  E-value=0.041  Score=21.38  Aligned_cols=24  Identities=25%  Similarity=0.688  Sum_probs=15.8

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCceeeCCCCcc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAY   48 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~   48 (84)
                      |.|..||..+....           .++.|+.|+.
T Consensus         2 ~~C~~CGy~y~~~~-----------~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEE-----------APWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCc-----------CCCcCcCCCC
Confidence            67888886654332           2378888875


No 57 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=93.79  E-value=0.017  Score=34.10  Aligned_cols=26  Identities=27%  Similarity=0.715  Sum_probs=21.0

Q ss_pred             cCCCCeecCCCCccccChhhHHHHHH
Q psy10072          9 TGEKPYKCTFCPFTAAHSSTMSYHLR   34 (84)
Q Consensus         9 ~~~k~~~c~~C~~~f~~~~~l~~h~~   34 (84)
                      ...|||+|++|++.|.....|.-|..
T Consensus       394 ~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         394 AKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             ccCCceeccccchhhccCccceeccc
Confidence            34599999999999998877776643


No 58 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=92.41  E-value=0.037  Score=30.88  Aligned_cols=43  Identities=23%  Similarity=0.542  Sum_probs=27.7

Q ss_pred             CCCeecCCCCccccChhhHHHHHHh---c-------CC-ce-----eeCCCCccccccc
Q psy10072         11 EKPYKCTFCPFTAAHSSTMSYHLRI---H-------QD-LK-----VKCPHCAYKCVKQ   53 (84)
Q Consensus        11 ~k~~~c~~C~~~f~~~~~l~~h~~~---~-------~~-~~-----~~c~~C~~~f~~~   53 (84)
                      ++...|++|+..|....-.....+.   .       .+ .+     ..|+.||.++...
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            3567999999999877544433321   1       11 12     4899999877643


No 59 
>KOG1146|consensus
Probab=92.28  E-value=0.093  Score=36.38  Aligned_cols=55  Identities=25%  Similarity=0.526  Sum_probs=44.5

Q ss_pred             hcCCCCeecCCCCccccChhhHHHHHHh-c-------------------------CCceeeCCCCccccccchHHHHHHh
Q psy10072          8 HTGEKPYKCTFCPFTAAHSSTMSYHLRI-H-------------------------QDLKVKCPHCAYKCVKQKDLNTHIE   61 (84)
Q Consensus         8 h~~~k~~~c~~C~~~f~~~~~l~~h~~~-~-------------------------~~~~~~c~~C~~~f~~~~~l~~H~~   61 (84)
                      +.-.+.+.|+.|+..|.....|..|++. |                         .+.+|.|..|...+....+|.+|+.
T Consensus       460 ~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  460 HSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             ecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHH
Confidence            4445789999999999999999999987 1                         0122788999999999999999987


Q ss_pred             h
Q psy10072         62 R   62 (84)
Q Consensus        62 ~   62 (84)
                      .
T Consensus       540 S  540 (1406)
T KOG1146|consen  540 S  540 (1406)
T ss_pred             H
Confidence            5


No 60 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=92.15  E-value=0.14  Score=18.89  Aligned_cols=11  Identities=45%  Similarity=1.141  Sum_probs=7.3

Q ss_pred             eeCCCCccccc
Q psy10072         41 VKCPHCAYKCV   51 (84)
Q Consensus        41 ~~c~~C~~~f~   51 (84)
                      -.|+.||..|.
T Consensus        15 ~~Cp~CG~~F~   25 (26)
T PF10571_consen   15 KFCPHCGYDFE   25 (26)
T ss_pred             CcCCCCCCCCc
Confidence            36777777664


No 61 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=91.95  E-value=0.052  Score=21.87  Aligned_cols=30  Identities=27%  Similarity=0.615  Sum_probs=19.1

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCceeeCCCCccc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYK   49 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~   49 (84)
                      |.|..||..|......      ..+....|+.|+..
T Consensus         6 y~C~~Cg~~fe~~~~~------~~~~~~~CP~Cg~~   35 (41)
T smart00834        6 YRCEDCGHTFEVLQKI------SDDPLATCPECGGD   35 (41)
T ss_pred             EEcCCCCCEEEEEEec------CCCCCCCCCCCCCc
Confidence            7899999887654332      11223678888863


No 62 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=91.61  E-value=0.19  Score=25.15  Aligned_cols=30  Identities=17%  Similarity=0.404  Sum_probs=21.7

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCceeeCCCCccccccc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCVKQ   53 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f~~~   53 (84)
                      ..|+.||..|....          ..+..|+.||..|...
T Consensus        10 R~Cp~CG~kFYDLn----------k~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYDLN----------KDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhccCC----------CCCccCCCCCCccCcc
Confidence            38999998886531          2336899999888755


No 63 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=91.43  E-value=0.15  Score=28.61  Aligned_cols=27  Identities=15%  Similarity=0.326  Sum_probs=20.7

Q ss_pred             CCCCeecCCCCccccChhhHHHHHHhc
Q psy10072         10 GEKPYKCTFCPFTAAHSSTMSYHLRIH   36 (84)
Q Consensus        10 ~~k~~~c~~C~~~f~~~~~l~~h~~~~   36 (84)
                      .+..|.|+.|+|.|.-...+.+|+...
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nK  100 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNK  100 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhc
Confidence            445699999999999999999998763


No 64 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=91.27  E-value=0.17  Score=26.93  Aligned_cols=35  Identities=20%  Similarity=0.373  Sum_probs=23.6

Q ss_pred             cCCCCeecCCCCccccChhhHHHHHHhcCCceeeCCCCccccc
Q psy10072          9 TGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCV   51 (84)
Q Consensus         9 ~~~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f~   51 (84)
                      ....-|.|+.|+..|+....+.        ..|.|+.||....
T Consensus       105 ~~~~~Y~Cp~c~~r~tf~eA~~--------~~F~Cp~Cg~~L~  139 (158)
T TIGR00373       105 TNNMFFICPNMCVRFTFNEAME--------LNFTCPRCGAMLD  139 (158)
T ss_pred             cCCCeEECCCCCcEeeHHHHHH--------cCCcCCCCCCEee
Confidence            3445688999988876655442        1389999987543


No 65 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=91.17  E-value=0.068  Score=28.39  Aligned_cols=12  Identities=17%  Similarity=0.542  Sum_probs=9.1

Q ss_pred             eeCCCCcccccc
Q psy10072         41 VKCPHCAYKCVK   52 (84)
Q Consensus        41 ~~c~~C~~~f~~   52 (84)
                      ++|+.|++.|..
T Consensus        29 ~~c~~c~~~f~~   40 (154)
T PRK00464         29 RECLACGKRFTT   40 (154)
T ss_pred             eeccccCCcceE
Confidence            788888887754


No 66 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=91.15  E-value=0.2  Score=24.00  Aligned_cols=30  Identities=30%  Similarity=0.485  Sum_probs=20.3

Q ss_pred             CCeecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccc
Q psy10072         12 KPYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCV   51 (84)
Q Consensus        12 k~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~   51 (84)
                      .+|.|+.|++. ..       .+  .+.. |.|..|+..|.
T Consensus        34 ~~~~Cp~C~~~-~V-------kR--~a~GIW~C~kCg~~fA   64 (89)
T COG1997          34 AKHVCPFCGRT-TV-------KR--IATGIWKCRKCGAKFA   64 (89)
T ss_pred             cCCcCCCCCCc-ce-------ee--eccCeEEcCCCCCeec
Confidence            46899999865 11       12  1233 99999998875


No 67 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=91.12  E-value=0.31  Score=20.31  Aligned_cols=26  Identities=27%  Similarity=0.586  Sum_probs=18.3

Q ss_pred             CeecCCCCccccChhhHHHHHHhcCCceeeCCCCcc
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAY   48 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~   48 (84)
                      .|.|..||..|...          .+....|+.|+.
T Consensus         2 ~Y~C~~Cg~~~~~~----------~~~~irC~~CG~   27 (44)
T smart00659        2 IYICGECGRENEIK----------SKDVVRCRECGY   27 (44)
T ss_pred             EEECCCCCCEeecC----------CCCceECCCCCc
Confidence            37899999877543          223378999985


No 68 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=91.12  E-value=0.36  Score=21.49  Aligned_cols=11  Identities=18%  Similarity=0.558  Sum_probs=5.8

Q ss_pred             CeecCCCCccc
Q psy10072         13 PYKCTFCPFTA   23 (84)
Q Consensus        13 ~~~c~~C~~~f   23 (84)
                      .|.|+.||..-
T Consensus        27 ~F~CPnCGe~~   37 (61)
T COG2888          27 KFPCPNCGEVE   37 (61)
T ss_pred             EeeCCCCCcee
Confidence            35566665443


No 69 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=91.01  E-value=0.073  Score=22.73  Aligned_cols=29  Identities=31%  Similarity=0.675  Sum_probs=18.7

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCceeeCCCCcc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAY   48 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~   48 (84)
                      |.|..|+..|......      .......|+.|+.
T Consensus         6 y~C~~Cg~~fe~~~~~------~~~~~~~CP~Cg~   34 (52)
T TIGR02605         6 YRCTACGHRFEVLQKM------SDDPLATCPECGG   34 (52)
T ss_pred             EEeCCCCCEeEEEEec------CCCCCCCCCCCCC
Confidence            7899999888754321      1122267888885


No 70 
>PF14353 CpXC:  CpXC protein
Probab=90.98  E-value=0.47  Score=24.21  Aligned_cols=43  Identities=21%  Similarity=0.380  Sum_probs=25.4

Q ss_pred             ecCCCCccccChh----------hHHHHHHhcCCce--eeCCCCccccccchHHHHH
Q psy10072         15 KCTFCPFTAAHSS----------TMSYHLRIHQDLK--VKCPHCAYKCVKQKDLNTH   59 (84)
Q Consensus        15 ~c~~C~~~f~~~~----------~l~~h~~~~~~~~--~~c~~C~~~f~~~~~l~~H   59 (84)
                      .|+.|+..|...-          .+..-  .-.|.-  +.|+.||..|.-...+.-|
T Consensus         3 tCP~C~~~~~~~v~~~I~~~~~p~l~e~--il~g~l~~~~CP~Cg~~~~~~~p~lY~   57 (128)
T PF14353_consen    3 TCPHCGHEFEFEVWTSINADEDPELKEK--ILDGSLFSFTCPSCGHKFRLEYPLLYH   57 (128)
T ss_pred             CCCCCCCeeEEEEEeEEcCcCCHHHHHH--HHcCCcCEEECCCCCCceecCCCEEEE
Confidence            6888887765331          12211  223433  8999999888755554444


No 71 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=90.96  E-value=0.31  Score=25.61  Aligned_cols=39  Identities=21%  Similarity=0.433  Sum_probs=24.5

Q ss_pred             CCCCeecCCCCccccChhhHHHHHHhcCCceeeCCCCccccc
Q psy10072         10 GEKPYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCV   51 (84)
Q Consensus        10 ~~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f~   51 (84)
                      ...-|.|+.|+..|.....+..   ......|.|+.|+....
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~---~d~~~~f~Cp~Cg~~l~  134 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQL---LDMDGTFTCPRCGEELE  134 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHh---cCCCCcEECCCCCCEEE
Confidence            3456899999988875432211   12222299999997554


No 72 
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=90.95  E-value=0.21  Score=20.87  Aligned_cols=25  Identities=24%  Similarity=0.630  Sum_probs=20.1

Q ss_pred             Cce--eeCCCCccccccchHHHHHHhh
Q psy10072         38 DLK--VKCPHCAYKCVKQKDLNTHIER   62 (84)
Q Consensus        38 ~~~--~~c~~C~~~f~~~~~l~~H~~~   62 (84)
                      |++  |+|-+|.......+.|..||..
T Consensus        16 gkp~~ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   16 GKPFKYKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             CCCccceeecCCcccchHHHHHHHHHH
Confidence            455  7899998888888888888865


No 73 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=90.73  E-value=0.28  Score=20.41  Aligned_cols=30  Identities=30%  Similarity=0.743  Sum_probs=20.1

Q ss_pred             CeecCCCCccccChhhHHHHHHhcCCceeeCCCCccccc
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCV   51 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f~   51 (84)
                      .|.|+.||..|.....         ...+.|+.|+..+.
T Consensus         3 ~y~C~~CG~~~~~~~~---------~~~~~Cp~CG~~~~   32 (46)
T PRK00398          3 EYKCARCGREVELDEY---------GTGVRCPYCGYRIL   32 (46)
T ss_pred             EEECCCCCCEEEECCC---------CCceECCCCCCeEE
Confidence            5889999987755332         11379999986443


No 74 
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=90.05  E-value=0.11  Score=25.42  Aligned_cols=20  Identities=25%  Similarity=0.517  Sum_probs=14.5

Q ss_pred             hhhhcCCCCeecCCCCccccC
Q psy10072          5 IRTHTGEKPYKCTFCPFTAAH   25 (84)
Q Consensus         5 ~~~h~~~k~~~c~~C~~~f~~   25 (84)
                      +..+.| +|.+|.+||..|..
T Consensus        72 ~~l~~g-~~~rC~eCG~~fkL   91 (97)
T cd00924          72 MWLEKG-KPKRCPECGHVFKL   91 (97)
T ss_pred             EEEeCC-CceeCCCCCcEEEE
Confidence            445566 68889889888754


No 75 
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=89.77  E-value=0.08  Score=21.56  Aligned_cols=35  Identities=17%  Similarity=0.322  Sum_probs=18.6

Q ss_pred             ecCCCCccccChhhHHHHHHh-cCC-ce-eeCCCCccccc
Q psy10072         15 KCTFCPFTAAHSSTMSYHLRI-HQD-LK-VKCPHCAYKCV   51 (84)
Q Consensus        15 ~c~~C~~~f~~~~~l~~h~~~-~~~-~~-~~c~~C~~~f~   51 (84)
                      .|+.|+..-.....+  .++. ..+ .. |.|..|+..+.
T Consensus         2 ~Cp~C~~~~a~~~q~--Q~RsaDE~mT~fy~C~~C~~~w~   39 (40)
T smart00440        2 PCPKCGNREATFFQL--QTRSADEPMTVFYVCTKCGHRWR   39 (40)
T ss_pred             cCCCCCCCeEEEEEE--cccCCCCCCeEEEEeCCCCCEeC
Confidence            578887543222222  2232 222 23 79999987654


No 76 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=89.18  E-value=0.13  Score=30.67  Aligned_cols=43  Identities=28%  Similarity=0.706  Sum_probs=36.1

Q ss_pred             Chhhhh--hhcCC--CCeecC--CCCccccChhhHHHHHHhcCCce-eeC
Q psy10072          1 MRNHIR--THTGE--KPYKCT--FCPFTAAHSSTMSYHLRIHQDLK-VKC   43 (84)
Q Consensus         1 l~~h~~--~h~~~--k~~~c~--~C~~~f~~~~~l~~h~~~~~~~~-~~c   43 (84)
                      |..|.+  .|+++  +|+.|+  .|++.|.+...+..|...+.+.. +.+
T Consensus       305 l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  354 (467)
T COG5048         305 LTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKE  354 (467)
T ss_pred             ccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCcccc
Confidence            356777  79999  999999  79999999999999988888766 444


No 77 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=88.48  E-value=0.34  Score=26.40  Aligned_cols=34  Identities=18%  Similarity=0.472  Sum_probs=23.1

Q ss_pred             CCCCeecCCCCccccChhhHHHHHHhcCCceeeCCCCccccc
Q psy10072         10 GEKPYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCV   51 (84)
Q Consensus        10 ~~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f~   51 (84)
                      ...-|.|+.|+..|+....+.        ..|.|+.||....
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~--------~~F~Cp~Cg~~L~  147 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME--------YGFRCPQCGEMLE  147 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh--------cCCcCCCCCCCCe
Confidence            345688999998876654321        1389999987543


No 78 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=88.11  E-value=0.56  Score=23.25  Aligned_cols=25  Identities=32%  Similarity=0.801  Sum_probs=22.0

Q ss_pred             eeC----CCCccccccchHHHHHHhhhCC
Q psy10072         41 VKC----PHCAYKCVKQKDLNTHIERRHM   65 (84)
Q Consensus        41 ~~c----~~C~~~f~~~~~l~~H~~~~~~   65 (84)
                      |.|    ..|+........+..|.+.+|+
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            789    9999999999999999987664


No 79 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=87.68  E-value=0.81  Score=19.36  Aligned_cols=21  Identities=29%  Similarity=0.653  Sum_probs=14.0

Q ss_pred             eeCCCCccccccc-----hHHHHHHh
Q psy10072         41 VKCPHCAYKCVKQ-----KDLNTHIE   61 (84)
Q Consensus        41 ~~c~~C~~~f~~~-----~~l~~H~~   61 (84)
                      -.|..|++.+...     ++|.+|+.
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            5777777766543     57777776


No 80 
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=87.04  E-value=0.47  Score=29.32  Aligned_cols=29  Identities=14%  Similarity=0.382  Sum_probs=20.9

Q ss_pred             ecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccccch
Q psy10072         15 KCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVKQK   54 (84)
Q Consensus        15 ~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~~~   54 (84)
                      .|+.||....+           .|.. |.|+.|+..+....
T Consensus       352 ~Cp~Cg~~m~S-----------~G~~g~rC~kCg~~~~~~~  381 (421)
T COG1571         352 VCPRCGGRMKS-----------AGRNGFRCKKCGTRARETL  381 (421)
T ss_pred             CCCccCCchhh-----------cCCCCcccccccccCCccc
Confidence            79999875332           2554 99999998877553


No 81 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=86.52  E-value=0.59  Score=18.27  Aligned_cols=25  Identities=24%  Similarity=0.681  Sum_probs=14.8

Q ss_pred             CeecCCCCccccChhhHHHHHHhcCCceeeCCCCcc
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAY   48 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~   48 (84)
                      .|.|..||..+....           .+..|+.|+.
T Consensus         2 ~~~C~~CG~i~~g~~-----------~p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEGEE-----------APEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeECCc-----------CCCcCcCCCC
Confidence            478888886543221           1157777765


No 82 
>PLN02294 cytochrome c oxidase subunit Vb
Probab=86.03  E-value=0.28  Score=26.49  Aligned_cols=21  Identities=19%  Similarity=0.476  Sum_probs=13.4

Q ss_pred             hhhhcCCCCeecCCCCccccCh
Q psy10072          5 IRTHTGEKPYKCTFCPFTAAHS   26 (84)
Q Consensus         5 ~~~h~~~k~~~c~~C~~~f~~~   26 (84)
                      +..+.| +|.+|++||..|...
T Consensus       134 f~L~kG-kp~RCpeCG~~fkL~  154 (174)
T PLN02294        134 FWLEKG-KSFECPVCTQYFELE  154 (174)
T ss_pred             EEecCC-CceeCCCCCCEEEEE
Confidence            334444 577888888777543


No 83 
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=85.72  E-value=0.72  Score=20.16  Aligned_cols=31  Identities=16%  Similarity=0.361  Sum_probs=21.5

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCceeeCCCCccccc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCV   51 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f~   51 (84)
                      +.|+.|+..+.....       ..+....|+.|+..+.
T Consensus         3 ~~CP~CG~~iev~~~-------~~GeiV~Cp~CGaele   33 (54)
T TIGR01206         3 FECPDCGAEIELENP-------ELGELVICDECGAELE   33 (54)
T ss_pred             cCCCCCCCEEecCCC-------ccCCEEeCCCCCCEEE
Confidence            689999987755432       1244489999997664


No 84 
>KOG4167|consensus
Probab=85.63  E-value=0.17  Score=33.22  Aligned_cols=25  Identities=24%  Similarity=0.466  Sum_probs=22.5

Q ss_pred             eeCCCCccccccchHHHHHHhhhCC
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERRHM   65 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~~~   65 (84)
                      |.|..|++.|.-..++..||+.|.-
T Consensus       793 FpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  793 FPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             eehHHHHHHHHHHhhhhHHHHHHHH
Confidence            8999999999999999999988753


No 85 
>KOG2593|consensus
Probab=85.04  E-value=0.87  Score=28.23  Aligned_cols=37  Identities=16%  Similarity=0.402  Sum_probs=25.1

Q ss_pred             cCCCCeecCCCCccccChhhHHHHHHhcCCce-eeCCCCcc
Q psy10072          9 TGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAY   48 (84)
Q Consensus         9 ~~~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~   48 (84)
                      +...-|.|+.|.+.|.....++   ......- |.|..|+-
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~~---L~~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEALQ---LLDNETGEFHCENCGG  161 (436)
T ss_pred             cccccccCCccccchhhhHHHH---hhcccCceEEEecCCC
Confidence            4456799999999987755432   3333333 89998875


No 86 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=84.44  E-value=0.56  Score=21.75  Aligned_cols=39  Identities=13%  Similarity=0.435  Sum_probs=22.3

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCce-eeCC--CCccccccch
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCP--HCAYKCVKQK   54 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~--~C~~~f~~~~   54 (84)
                      +.|+.|+..-....+....  ....+. ++|.  .|+..|....
T Consensus         2 m~CP~Cg~~a~irtSr~~s--~~~~~~Y~qC~N~eCg~tF~t~e   43 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYIT--DTTKERYHQCQNVNCSATFITYE   43 (72)
T ss_pred             ccCCCCCCccEEEEChhcC--hhhheeeeecCCCCCCCEEEEEE
Confidence            5799998765333321111  112233 6897  8999887543


No 87 
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=84.00  E-value=0.44  Score=22.29  Aligned_cols=31  Identities=23%  Similarity=0.485  Sum_probs=20.4

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCV   51 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~   51 (84)
                      |.|..|+..|    .+.+++.   +.+ -.|+.|+..++
T Consensus        13 Y~c~~cg~~~----dvvq~~~---ddplt~ce~c~a~~k   44 (82)
T COG2331          13 YECTECGNRF----DVVQAMT---DDPLTTCEECGARLK   44 (82)
T ss_pred             EeecccchHH----HHHHhcc---cCccccChhhChHHH
Confidence            7899998765    3344433   555 68888876543


No 88 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=83.93  E-value=1.6  Score=17.80  Aligned_cols=21  Identities=24%  Similarity=0.512  Sum_probs=11.4

Q ss_pred             eeCCCCcccccc----chHHHHHHh
Q psy10072         41 VKCPHCAYKCVK----QKDLNTHIE   61 (84)
Q Consensus        41 ~~c~~C~~~f~~----~~~l~~H~~   61 (84)
                      ..|..|++.+..    .++|..|+.
T Consensus        17 a~C~~C~~~~~~~~~~ts~l~~HL~   41 (45)
T PF02892_consen   17 AKCKYCGKVIKYSSGGTSNLKRHLK   41 (45)
T ss_dssp             EEETTTTEE-----SSTHHHHHHHH
T ss_pred             EEeCCCCeEEeeCCCcHHHHHHhhh
Confidence            567777765543    456666663


No 89 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=83.58  E-value=1.2  Score=23.04  Aligned_cols=32  Identities=6%  Similarity=-0.065  Sum_probs=22.0

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCceeeCCCCccccccchH
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCVKQKD   55 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f~~~~~   55 (84)
                      ..|+.||+.|....          ..+..|+.||..|.....
T Consensus        10 r~Cp~cg~kFYDLn----------k~p~vcP~cg~~~~~~~~   41 (129)
T TIGR02300        10 RICPNTGSKFYDLN----------RRPAVSPYTGEQFPPEEA   41 (129)
T ss_pred             ccCCCcCccccccC----------CCCccCCCcCCccCcchh
Confidence            47999998885431          223789999988765533


No 90 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=82.94  E-value=1.4  Score=19.59  Aligned_cols=9  Identities=22%  Similarity=0.648  Sum_probs=4.2

Q ss_pred             eecCCCCcc
Q psy10072         14 YKCTFCPFT   22 (84)
Q Consensus        14 ~~c~~C~~~   22 (84)
                      |.|+.||..
T Consensus        26 F~CPnCG~~   34 (59)
T PRK14890         26 FLCPNCGEV   34 (59)
T ss_pred             eeCCCCCCe
Confidence            445555443


No 91 
>KOG4173|consensus
Probab=82.89  E-value=0.29  Score=27.35  Aligned_cols=48  Identities=23%  Similarity=0.498  Sum_probs=35.7

Q ss_pred             ecCCCCccccChhhHHHHHHh-c---------CCce-eeCC--CCccccccchHHHHHHhh
Q psy10072         15 KCTFCPFTAAHSSTMSYHLRI-H---------QDLK-VKCP--HCAYKCVKQKDLNTHIER   62 (84)
Q Consensus        15 ~c~~C~~~f~~~~~l~~h~~~-~---------~~~~-~~c~--~C~~~f~~~~~l~~H~~~   62 (84)
                      .|..|.+.|++..-|..|+.. |         .|.. |+|.  .|+..|........|+-.
T Consensus       108 sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~RkdH~I~  168 (253)
T KOG4173|consen  108 SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRKDHMIR  168 (253)
T ss_pred             hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhhhHHHH
Confidence            788999999988888888753 2         2445 8884  488888887777777654


No 92 
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=82.77  E-value=0.05  Score=22.03  Aligned_cols=10  Identities=20%  Similarity=0.610  Sum_probs=8.0

Q ss_pred             eeCCCCcccc
Q psy10072         41 VKCPHCAYKC   50 (84)
Q Consensus        41 ~~c~~C~~~f   50 (84)
                      |.|..|+..+
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            7898898765


No 93 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=82.75  E-value=1.7  Score=15.83  Aligned_cols=19  Identities=21%  Similarity=0.485  Sum_probs=9.7

Q ss_pred             ecCCCCccccChhhHHHHHH
Q psy10072         15 KCTFCPFTAAHSSTMSYHLR   34 (84)
Q Consensus        15 ~c~~C~~~f~~~~~l~~h~~   34 (84)
                      .|+.|++.+ ....+..|..
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            466666665 3334444443


No 94 
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=82.62  E-value=0.62  Score=22.56  Aligned_cols=31  Identities=32%  Similarity=0.761  Sum_probs=19.0

Q ss_pred             CCeecCCCCccccChhhHHHHHHhcCCceeeCCCCccccc
Q psy10072         12 KPYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCV   51 (84)
Q Consensus        12 k~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f~   51 (84)
                      ..|.|+.|++.-..        +...|. |.|..|++.|.
T Consensus        34 ~ky~Cp~Cgk~~vk--------R~a~GI-W~C~~C~~~~A   64 (90)
T PF01780_consen   34 AKYTCPFCGKTSVK--------RVATGI-WKCKKCGKKFA   64 (90)
T ss_dssp             S-BEESSSSSSEEE--------EEETTE-EEETTTTEEEE
T ss_pred             CCCcCCCCCCceeE--------EeeeEE-eecCCCCCEEe
Confidence            35889999875211        112222 89999998774


No 95 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=82.44  E-value=0.8  Score=16.54  Aligned_cols=11  Identities=36%  Similarity=1.083  Sum_probs=8.2

Q ss_pred             CCCeecCCCCc
Q psy10072         11 EKPYKCTFCPF   21 (84)
Q Consensus        11 ~k~~~c~~C~~   21 (84)
                      ..+|.|+.||.
T Consensus        14 ~v~f~CPnCG~   24 (24)
T PF07754_consen   14 AVPFPCPNCGF   24 (24)
T ss_pred             CceEeCCCCCC
Confidence            34788999874


No 96 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=82.28  E-value=0.92  Score=23.61  Aligned_cols=25  Identities=24%  Similarity=0.453  Sum_probs=16.0

Q ss_pred             eeCCCCccccccchHHHHHHhhhCCCCC
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERRHMPGD   68 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~~~~~~   68 (84)
                      ..|.+||+.|..   |.+|+..|++-.|
T Consensus        73 i~clecGk~~k~---LkrHL~~~~gltp   97 (132)
T PF05443_consen   73 IICLECGKKFKT---LKRHLRTHHGLTP   97 (132)
T ss_dssp             EE-TBT--EESB---HHHHHHHTT-S-H
T ss_pred             eEEccCCcccch---HHHHHHHccCCCH
Confidence            689999998875   4799999876554


No 97 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=82.28  E-value=0.55  Score=24.42  Aligned_cols=15  Identities=20%  Similarity=0.259  Sum_probs=11.8

Q ss_pred             CCeecCCCCccccCh
Q psy10072         12 KPYKCTFCPFTAAHS   26 (84)
Q Consensus        12 k~~~c~~C~~~f~~~   26 (84)
                      ..+.|..||..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            458999999887654


No 98 
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=80.98  E-value=1.1  Score=22.20  Aligned_cols=37  Identities=22%  Similarity=0.300  Sum_probs=20.0

Q ss_pred             CCeecCCCCccccChhhHHHHHHhcCCce--eeCCCCcc
Q psy10072         12 KPYKCTFCPFTAAHSSTMSYHLRIHQDLK--VKCPHCAY   48 (84)
Q Consensus        12 k~~~c~~C~~~f~~~~~l~~h~~~~~~~~--~~c~~C~~   48 (84)
                      ||-.|+.||..-.....-...-......+  |.|..|+.
T Consensus         1 ~p~~CpYCg~~~~l~~~~~iYg~~~~~~~~~y~C~~C~A   39 (102)
T PF11672_consen    1 KPIICPYCGGPAELVDGSEIYGHRYDDGPYLYVCTPCDA   39 (102)
T ss_pred             CCcccCCCCCeeEEcccchhcCccCCCCceeEECCCCCc
Confidence            57789999975433322111111111223  89999875


No 99 
>KOG3408|consensus
Probab=80.72  E-value=0.99  Score=23.11  Aligned_cols=22  Identities=32%  Similarity=0.578  Sum_probs=20.2

Q ss_pred             eeCCCCccccccchHHHHHHhh
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIER   62 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~   62 (84)
                      |-|..|.+-|.....|..|.+.
T Consensus        58 fyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   58 FYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             eehhhhhhhhcchHHHHHHHhc
Confidence            8999999999999999999764


No 100
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=80.71  E-value=1.1  Score=17.04  Aligned_cols=25  Identities=24%  Similarity=0.628  Sum_probs=10.9

Q ss_pred             ecCCCCccccChhhHHHHHHhcCCceeeCCCCccc
Q psy10072         15 KCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYK   49 (84)
Q Consensus        15 ~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~   49 (84)
                      .|+.|+..+..          ..+..+.|+.|+..
T Consensus         4 ~Cp~C~se~~y----------~D~~~~vCp~C~~e   28 (30)
T PF08274_consen    4 KCPLCGSEYTY----------EDGELLVCPECGHE   28 (30)
T ss_dssp             --TTT-----E----------E-SSSEEETTTTEE
T ss_pred             CCCCCCCccee----------ccCCEEeCCccccc
Confidence            57788766554          22333888888753


No 101
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=80.48  E-value=1.5  Score=16.96  Aligned_cols=25  Identities=24%  Similarity=0.654  Sum_probs=13.6

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCceeeCCCCcc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAY   48 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~   48 (84)
                      |.|..|+..+....          +.+..|..||.
T Consensus         1 Y~C~~Cg~~~~~~~----------~~~irC~~CG~   25 (32)
T PF03604_consen    1 YICGECGAEVELKP----------GDPIRCPECGH   25 (32)
T ss_dssp             EBESSSSSSE-BST----------SSTSSBSSSS-
T ss_pred             CCCCcCCCeeEcCC----------CCcEECCcCCC
Confidence            46777877654221          22267777774


No 102
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=79.11  E-value=1.5  Score=21.35  Aligned_cols=30  Identities=23%  Similarity=0.584  Sum_probs=19.0

Q ss_pred             CCeecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccc
Q psy10072         12 KPYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCV   51 (84)
Q Consensus        12 k~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~   51 (84)
                      ..|.|+.|++.--         . -.+.- |.|..|++.|.
T Consensus        34 a~y~CpfCgk~~v---------k-R~a~GIW~C~~C~~~~A   64 (91)
T TIGR00280        34 AKYVCPFCGKKTV---------K-RGSTGIWTCRKCGAKFA   64 (91)
T ss_pred             cCccCCCCCCCce---------E-EEeeEEEEcCCCCCEEe
Confidence            3588999985310         1 11223 89999998775


No 103
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=79.02  E-value=2.5  Score=17.22  Aligned_cols=25  Identities=16%  Similarity=0.367  Sum_probs=16.7

Q ss_pred             CeecCCCCccccCh--hhHHHHHHhcC
Q psy10072         13 PYKCTFCPFTAAHS--STMSYHLRIHQ   37 (84)
Q Consensus        13 ~~~c~~C~~~f~~~--~~l~~h~~~~~   37 (84)
                      .-.|+.||..|...  .+-..|.+.|.
T Consensus        13 ~~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   13 ATTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             CcCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            35899999877644  45566666553


No 104
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=78.45  E-value=1.2  Score=23.09  Aligned_cols=15  Identities=33%  Similarity=0.556  Sum_probs=12.8

Q ss_pred             CeecCCCCccccChh
Q psy10072         13 PYKCTFCPFTAAHSS   27 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~   27 (84)
                      |+.|..||+.|...+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            689999999998754


No 105
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=78.45  E-value=0.7  Score=17.35  Aligned_cols=9  Identities=22%  Similarity=0.475  Sum_probs=4.3

Q ss_pred             ecCCCCccc
Q psy10072         15 KCTFCPFTA   23 (84)
Q Consensus        15 ~c~~C~~~f   23 (84)
                      .|..|++.|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            344455554


No 106
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=77.88  E-value=1  Score=25.35  Aligned_cols=27  Identities=22%  Similarity=0.388  Sum_probs=20.7

Q ss_pred             eeCCCCccccccchHHHHHHhhhCCCC
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERRHMPG   67 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~~~~~   67 (84)
                      |.|..|+|.|.-......|+..-|.+.
T Consensus        78 ~~C~lc~KlFkg~eFV~KHI~nKH~e~  104 (214)
T PF04959_consen   78 WRCPLCGKLFKGPEFVRKHIFNKHPEK  104 (214)
T ss_dssp             EEE-SSS-EESSHHHHHHHHHHH-HHH
T ss_pred             ECCCCCCcccCChHHHHHHHhhcCHHH
Confidence            999999999999999999998655443


No 107
>PHA00626 hypothetical protein
Probab=77.88  E-value=1.6  Score=19.20  Aligned_cols=16  Identities=19%  Similarity=0.644  Sum_probs=12.0

Q ss_pred             CCeecCCCCccccChh
Q psy10072         12 KPYKCTFCPFTAAHSS   27 (84)
Q Consensus        12 k~~~c~~C~~~f~~~~   27 (84)
                      ..|.|+.|+..|+...
T Consensus        22 nrYkCkdCGY~ft~~~   37 (59)
T PHA00626         22 DDYVCCDCGYNDSKDA   37 (59)
T ss_pred             cceEcCCCCCeechhh
Confidence            4689999988876543


No 108
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=76.79  E-value=1.6  Score=22.03  Aligned_cols=25  Identities=24%  Similarity=0.492  Sum_probs=15.5

Q ss_pred             CeecCCCCccccChhhHHHHHHhcCCceeeCCCCcc
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAY   48 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~   48 (84)
                      ...|..|+..|....           ..+.|+.|+.
T Consensus        70 ~~~C~~Cg~~~~~~~-----------~~~~CP~Cgs   94 (113)
T PRK12380         70 QAWCWDCSQVVEIHQ-----------HDAQCPHCHG   94 (113)
T ss_pred             EEEcccCCCEEecCC-----------cCccCcCCCC
Confidence            367888886664432           1156888874


No 109
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=76.72  E-value=1.3  Score=18.99  Aligned_cols=17  Identities=18%  Similarity=0.413  Sum_probs=12.3

Q ss_pred             CCCeecCCCCccccChh
Q psy10072         11 EKPYKCTFCPFTAAHSS   27 (84)
Q Consensus        11 ~k~~~c~~C~~~f~~~~   27 (84)
                      .+++.|..||..|....
T Consensus         2 Dk~l~C~dCg~~FvfTa   18 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTA   18 (49)
T ss_pred             CeeEEcccCCCeEEEeh
Confidence            45678888888776554


No 110
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=76.67  E-value=5.8  Score=21.55  Aligned_cols=44  Identities=16%  Similarity=0.328  Sum_probs=25.0

Q ss_pred             eecCCCCccccChh--hHHHHHH--h-cCCce-eeCCCCccccccchHHH
Q psy10072         14 YKCTFCPFTAAHSS--TMSYHLR--I-HQDLK-VKCPHCAYKCVKQKDLN   57 (84)
Q Consensus        14 ~~c~~C~~~f~~~~--~l~~h~~--~-~~~~~-~~c~~C~~~f~~~~~l~   57 (84)
                      -.|++|+......+  ....-+.  . -.... +.|+.|++.|.-.+++.
T Consensus        98 ~RCp~CN~~L~~vs~eev~~~Vp~~~~~~~~~f~~C~~CgkiYW~GsHw~  147 (165)
T COG1656          98 SRCPECNGELEKVSREEVKEKVPEKVYRNYEEFYRCPKCGKIYWKGSHWR  147 (165)
T ss_pred             ccCcccCCEeccCcHHHHhhccchhhhhcccceeECCCCcccccCchHHH
Confidence            57999997654332  2111111  1 11223 68999999998765543


No 111
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=76.52  E-value=2.2  Score=18.30  Aligned_cols=27  Identities=30%  Similarity=0.776  Sum_probs=17.4

Q ss_pred             CCeecCCCCccccChhhHHHHHHhcCCce-eeCCCCcc
Q psy10072         12 KPYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAY   48 (84)
Q Consensus        12 k~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~   48 (84)
                      ..|.|-.||+.|...          .... ..|+.|+.
T Consensus         5 ~~Y~C~~Cg~~~~~~----------~~~~~irCp~Cg~   32 (49)
T COG1996           5 MEYKCARCGREVELD----------QETRGIRCPYCGS   32 (49)
T ss_pred             EEEEhhhcCCeeehh----------hccCceeCCCCCc
Confidence            358899999887211          1223 68888875


No 112
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=76.47  E-value=1.4  Score=17.98  Aligned_cols=29  Identities=28%  Similarity=0.684  Sum_probs=19.6

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCceeeCCCCcc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAY   48 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~   48 (84)
                      |.|..||..|......      .......|+.|+.
T Consensus         6 y~C~~Cg~~fe~~~~~------~~~~~~~CP~Cg~   34 (42)
T PF09723_consen    6 YRCEECGHEFEVLQSI------SEDDPVPCPECGS   34 (42)
T ss_pred             EEeCCCCCEEEEEEEc------CCCCCCcCCCCCC
Confidence            7899999888765432      1122278888886


No 113
>KOG4167|consensus
Probab=76.43  E-value=0.45  Score=31.46  Aligned_cols=26  Identities=15%  Similarity=0.360  Sum_probs=22.7

Q ss_pred             CeecCCCCccccChhhHHHHHHhcCC
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIHQD   38 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~~~   38 (84)
                      .|.|++|++.|.--..+..|++.|..
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            58999999999888889999988764


No 114
>PHA02998 RNA polymerase subunit; Provisional
Probab=76.41  E-value=0.9  Score=24.86  Aligned_cols=39  Identities=15%  Similarity=0.297  Sum_probs=22.6

Q ss_pred             CeecCCCCccccChhhHHHHHHhcC-C-ce-eeCCCCccccccc
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIHQ-D-LK-VKCPHCAYKCVKQ   53 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~~-~-~~-~~c~~C~~~f~~~   53 (84)
                      .-.|+.|+..-.....+  +++..- + .. |.|..|+..|.-+
T Consensus       143 ~v~CPkCg~~~A~f~ql--QTRSADEPmT~FYkC~~CG~~wkpp  184 (195)
T PHA02998        143 NTPCPNCKSKNTTPMMI--QTRAADEPPLVRHACRDCKKHFKPP  184 (195)
T ss_pred             CCCCCCCCCCceEEEEE--eeccCCCCceEEEEcCCCCCccCCc
Confidence            45789998653333222  233221 2 23 7999999887644


No 115
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=75.89  E-value=2.8  Score=20.35  Aligned_cols=30  Identities=27%  Similarity=0.624  Sum_probs=19.1

Q ss_pred             CCeecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccc
Q psy10072         12 KPYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCV   51 (84)
Q Consensus        12 k~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~   51 (84)
                      ..|.|+.|++.--         . -.+.- |.|..|++.|.
T Consensus        35 a~y~CpfCgk~~v---------k-R~a~GIW~C~~C~~~~A   65 (90)
T PTZ00255         35 AKYFCPFCGKHAV---------K-RQAVGIWRCKGCKKTVA   65 (90)
T ss_pred             CCccCCCCCCCce---------e-eeeeEEEEcCCCCCEEe
Confidence            4688999985311         1 11223 89999998775


No 116
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=75.34  E-value=4.7  Score=16.21  Aligned_cols=21  Identities=24%  Similarity=0.539  Sum_probs=14.4

Q ss_pred             Cce-eeCCCCccccccchHHHH
Q psy10072         38 DLK-VKCPHCAYKCVKQKDLNT   58 (84)
Q Consensus        38 ~~~-~~c~~C~~~f~~~~~l~~   58 (84)
                      +.. ..|..|+-.+.....|.+
T Consensus        16 ~~~id~C~~C~G~W~d~~el~~   37 (41)
T PF13453_consen   16 DVEIDVCPSCGGIWFDAGELEK   37 (41)
T ss_pred             CEEEEECCCCCeEEccHHHHHH
Confidence            344 788888877776666554


No 117
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=75.21  E-value=0.89  Score=18.57  Aligned_cols=11  Identities=27%  Similarity=0.812  Sum_probs=6.5

Q ss_pred             CeecCCCCccc
Q psy10072         13 PYKCTFCPFTA   23 (84)
Q Consensus        13 ~~~c~~C~~~f   23 (84)
                      +-.|+.|+..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            45666666554


No 118
>KOG1280|consensus
Probab=74.11  E-value=4.1  Score=24.80  Aligned_cols=38  Identities=24%  Similarity=0.641  Sum_probs=27.8

Q ss_pred             CCCeecCCCCccccChhhHHHHHHh-cCCce--eeCCCCcc
Q psy10072         11 EKPYKCTFCPFTAAHSSTMSYHLRI-HQDLK--VKCPHCAY   48 (84)
Q Consensus        11 ~k~~~c~~C~~~f~~~~~l~~h~~~-~~~~~--~~c~~C~~   48 (84)
                      ..-|.|+.|+++-.+...+..|+.. |....  ..|+.|..
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~~  117 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCAA  117 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcCcccCcceeeecccc
Confidence            3468999999988888888888764 55433  57777764


No 119
>KOG2907|consensus
Probab=73.89  E-value=3.1  Score=21.10  Aligned_cols=37  Identities=30%  Similarity=0.626  Sum_probs=21.1

Q ss_pred             CeecCCCCccccChhhHHHHHHh-cCCce--eeCCCCccccc
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRI-HQDLK--VKCPHCAYKCV   51 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~-~~~~~--~~c~~C~~~f~   51 (84)
                      -..|+.||-.--.-..+  .++. ..|..  |.|+.|++.|.
T Consensus        74 ~~kCpkCghe~m~Y~T~--QlRSADEGQTVFYTC~kC~~k~~  113 (116)
T KOG2907|consen   74 KHKCPKCGHEEMSYHTL--QLRSADEGQTVFYTCPKCKYKFT  113 (116)
T ss_pred             hccCcccCCchhhhhhh--hcccccCCceEEEEcCccceeee
Confidence            35788888532111111  2333 34555  79999998775


No 120
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=73.78  E-value=2.2  Score=21.56  Aligned_cols=25  Identities=20%  Similarity=0.526  Sum_probs=15.9

Q ss_pred             CeecCCCCccccChhhHHHHHHhcCCceeeCCCCcc
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAY   48 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~   48 (84)
                      ...|..|+..|.....           .+.|+.|+.
T Consensus        70 ~~~C~~Cg~~~~~~~~-----------~~~CP~Cgs   94 (115)
T TIGR00100        70 ECECEDCSEEVSPEID-----------LYRCPKCHG   94 (115)
T ss_pred             EEEcccCCCEEecCCc-----------CccCcCCcC
Confidence            4678888876654321           257888874


No 121
>KOG2785|consensus
Probab=73.76  E-value=15  Score=22.80  Aligned_cols=60  Identities=17%  Similarity=0.284  Sum_probs=41.5

Q ss_pred             CCeecCCCCccccChhhHHHHHHhcCCc-----------------------e-eeCCCCc---cccccchHHHHHHhh-h
Q psy10072         12 KPYKCTFCPFTAAHSSTMSYHLRIHQDL-----------------------K-VKCPHCA---YKCVKQKDLNTHIER-R   63 (84)
Q Consensus        12 k~~~c~~C~~~f~~~~~l~~h~~~~~~~-----------------------~-~~c~~C~---~~f~~~~~l~~H~~~-~   63 (84)
                      .|-.|-.|++.+.....-..||..+.+-                       . +.|..|.   +.|........||.. .
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~K~  244 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRDKG  244 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhhcc
Confidence            4556777888877776666777543221                       2 6788887   899999999999974 4


Q ss_pred             CCCCChhh
Q psy10072         64 HMPGDVLG   71 (84)
Q Consensus        64 ~~~~~~~~   71 (84)
                      |..-+|-.
T Consensus       245 HCkl~yd~  252 (390)
T KOG2785|consen  245 HCKLPYDG  252 (390)
T ss_pred             CcccCCCh
Confidence            55556633


No 122
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=73.76  E-value=0.7  Score=24.16  Aligned_cols=21  Identities=29%  Similarity=0.526  Sum_probs=13.9

Q ss_pred             hhhhcCCCCeecCCCCccccCh
Q psy10072          5 IRTHTGEKPYKCTFCPFTAAHS   26 (84)
Q Consensus         5 ~~~h~~~k~~~c~~C~~~f~~~   26 (84)
                      +..+.| +|.+|++||..|...
T Consensus       105 ~~l~~g-~~~RCpeCG~~fkL~  125 (136)
T PF01215_consen  105 FWLHKG-KPQRCPECGQVFKLK  125 (136)
T ss_dssp             EEEETT-SEEEETTTEEEEEEE
T ss_pred             EEEeCC-CccCCCCCCeEEEEE
Confidence            344555 477888888877654


No 123
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=72.34  E-value=4.1  Score=17.43  Aligned_cols=11  Identities=27%  Similarity=0.773  Sum_probs=8.4

Q ss_pred             eeCCCCccccc
Q psy10072         41 VKCPHCAYKCV   51 (84)
Q Consensus        41 ~~c~~C~~~f~   51 (84)
                      +.|..|+..+.
T Consensus        38 ~~C~~Cgyt~~   48 (50)
T PRK00432         38 WHCGKCGYTEF   48 (50)
T ss_pred             EECCCcCCEEe
Confidence            88999987543


No 124
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=71.90  E-value=1.5  Score=19.70  Aligned_cols=45  Identities=22%  Similarity=0.366  Sum_probs=28.0

Q ss_pred             hhhhhcCCCCeecCCCCccccChhhHHHHHHhcCCce-eeCCCCcccccc
Q psy10072          4 HIRTHTGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVK   52 (84)
Q Consensus         4 h~~~h~~~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~   52 (84)
                      |..++.+..++.|+--+..|..+.-+.   .. .... ..|+.|+..|+.
T Consensus        15 ~~~I~~~~~~l~C~g~~~p~~HPrV~L---~m-g~~gev~CPYC~t~y~l   60 (62)
T COG4391          15 HETIEIGDLPLMCPGPEPPNDHPRVFL---DM-GDEGEVVCPYCSTRYRL   60 (62)
T ss_pred             ceEEEeCCeeEEcCCCCCCCCCCEEEE---Ec-CCCCcEecCccccEEEe
Confidence            445677888889987666555443211   11 1223 799999998864


No 125
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=71.83  E-value=2.8  Score=16.88  Aligned_cols=14  Identities=21%  Similarity=0.486  Sum_probs=10.8

Q ss_pred             CeecCCCCccccCh
Q psy10072         13 PYKCTFCPFTAAHS   26 (84)
Q Consensus        13 ~~~c~~C~~~f~~~   26 (84)
                      |+.|..|++.|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            78888888887554


No 126
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=71.55  E-value=4.7  Score=18.03  Aligned_cols=27  Identities=15%  Similarity=0.380  Sum_probs=11.8

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCceeeCCCCccccc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCV   51 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f~   51 (84)
                      -.|..|++.|...           ..++.|..||..|-
T Consensus        10 ~~C~~C~~~F~~~-----------~rrhhCr~CG~~vC   36 (69)
T PF01363_consen   10 SNCMICGKKFSLF-----------RRRHHCRNCGRVVC   36 (69)
T ss_dssp             SB-TTT--B-BSS-----------S-EEE-TTT--EEE
T ss_pred             CcCcCcCCcCCCc-----------eeeEccCCCCCEEC
Confidence            4688899888431           22377777777664


No 127
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=71.18  E-value=3.2  Score=16.90  Aligned_cols=29  Identities=21%  Similarity=0.504  Sum_probs=16.4

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCV   51 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~   51 (84)
                      +.|+.|+....         ....... +.|..||....
T Consensus         1 m~Cp~Cg~~~~---------~~D~~~g~~vC~~CG~Vl~   30 (43)
T PF08271_consen    1 MKCPNCGSKEI---------VFDPERGELVCPNCGLVLE   30 (43)
T ss_dssp             ESBTTTSSSEE---------EEETTTTEEEETTT-BBEE
T ss_pred             CCCcCCcCCce---------EEcCCCCeEECCCCCCEee
Confidence            46888886541         1122223 78999987543


No 128
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=70.97  E-value=2.2  Score=18.81  Aligned_cols=36  Identities=19%  Similarity=0.364  Sum_probs=20.6

Q ss_pred             eecCCCCccccChhh--HHHHHHhcCCceeeCCCCccc
Q psy10072         14 YKCTFCPFTAAHSST--MSYHLRIHQDLKVKCPHCAYK   49 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~--l~~h~~~~~~~~~~c~~C~~~   49 (84)
                      -.|..|++.+.-...  ..+.++...-..|.|..|...
T Consensus         3 vkC~lCdk~~~Id~~~~~aKrLrnrPi~tYmC~eC~~R   40 (56)
T PF09963_consen    3 VKCILCDKKEEIDEDTPEAKRLRNRPIHTYMCDECKER   40 (56)
T ss_pred             eEEEecCCEEEeccCCHHHHHhhcCCCcceeChhHHHH
Confidence            368888887664433  333333332222999998643


No 129
>KOG2482|consensus
Probab=70.52  E-value=2.7  Score=25.60  Aligned_cols=22  Identities=18%  Similarity=0.532  Sum_probs=20.5

Q ss_pred             eeCCCCccccccchHHHHHHhh
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIER   62 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~   62 (84)
                      +.|..|.+.|+....|..||+.
T Consensus       196 ~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  196 LRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             heeeeeccccCCcHHHHHHHHh
Confidence            6899999999999999999985


No 130
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=70.25  E-value=3.5  Score=21.62  Aligned_cols=26  Identities=15%  Similarity=0.105  Sum_probs=20.2

Q ss_pred             eeCCCCccccccchHHHHHHhhhCCCCCh
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERRHMPGDV   69 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~~~~~~~   69 (84)
                      ..|.++|+.|.   +|++|+.+|.+-.|.
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~gmTPd  102 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYGLTPD  102 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccCCCHH
Confidence            47888999887   578999888776653


No 131
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=70.23  E-value=12  Score=18.68  Aligned_cols=37  Identities=5%  Similarity=-0.028  Sum_probs=29.0

Q ss_pred             CCeecCCCCccccChhhHHHHHHhcCCceeeCCCCcc
Q psy10072         12 KPYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAY   48 (84)
Q Consensus        12 k~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~   48 (84)
                      ..|.|+.-+..|.+-......+.......|.|...|+
T Consensus         2 eVf~i~~T~EiF~dYe~Y~~R~~~y~~~vwtC~~TGk   38 (102)
T PF10537_consen    2 EVFYIPFTGEIFRDYEEYLKRMILYNQRVWTCEITGK   38 (102)
T ss_pred             ceEEeCCCCcccCCHHHHHHHHHHHhCCeeEEecCCC
Confidence            4578888888998888777777766655599998886


No 132
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=70.23  E-value=2.9  Score=21.20  Aligned_cols=25  Identities=16%  Similarity=0.433  Sum_probs=15.7

Q ss_pred             CeecCCCCccccChhhHHHHHHhcCCce-eeCCCCcc
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAY   48 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~   48 (84)
                      ...|..|+..|.....           . +.|+.|+.
T Consensus        71 ~~~C~~Cg~~~~~~~~-----------~~~~CP~Cgs   96 (117)
T PRK00564         71 ELECKDCSHVFKPNAL-----------DYGVCEKCHS   96 (117)
T ss_pred             EEEhhhCCCccccCCc-----------cCCcCcCCCC
Confidence            4678888876654321           2 35888874


No 133
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=69.16  E-value=4.2  Score=25.78  Aligned_cols=26  Identities=15%  Similarity=0.324  Sum_probs=22.0

Q ss_pred             CeecCCCCccccChhhHHHHHHh-cCC
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRI-HQD   38 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~-~~~   38 (84)
                      -|.|+.|.+.|.....+..|+.. |.+
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhhhh
Confidence            47899999999999999999874 554


No 134
>PRK04351 hypothetical protein; Provisional
Probab=68.55  E-value=4.5  Score=21.51  Aligned_cols=10  Identities=20%  Similarity=0.750  Sum_probs=4.9

Q ss_pred             eeCCCCcccc
Q psy10072         41 VKCPHCAYKC   50 (84)
Q Consensus        41 ~~c~~C~~~f   50 (84)
                      |.|..|+..+
T Consensus       113 Y~C~~Cg~~~  122 (149)
T PRK04351        113 YECQSCGQQY  122 (149)
T ss_pred             EECCCCCCEe
Confidence            4555555433


No 135
>KOG1146|consensus
Probab=67.63  E-value=2  Score=30.51  Aligned_cols=52  Identities=19%  Similarity=0.414  Sum_probs=40.5

Q ss_pred             CCCeecCCCCccccChhhHHHHHHhc-----------------CCceeeCCCCccccccchHHHHHHhh
Q psy10072         11 EKPYKCTFCPFTAAHSSTMSYHLRIH-----------------QDLKVKCPHCAYKCVKQKDLNTHIER   62 (84)
Q Consensus        11 ~k~~~c~~C~~~f~~~~~l~~h~~~~-----------------~~~~~~c~~C~~~f~~~~~l~~H~~~   62 (84)
                      ..+|.|..|...|.....+..|.+.-                 ....+.|..|...|.....|..|++.
T Consensus      1282 ~~~~~~~~~~~~~~~~~~l~~~~~k~~~~~~~~~~~~~~~l~~~d~~~~c~~c~~~~~~~~alqihm~~ 1350 (1406)
T KOG1146|consen 1282 THRYLCRQCKMAFDGEAPLTAHQRKFCFAGRGSGGSMPPPLRVPDCTYHCLACEVLLSGREALQIHMRS 1350 (1406)
T ss_pred             chhHHHHHHHhhhcchhHHHHHHHHHHhccCccccCCCCcccCccccccchHHHhhcchhHHHHHHHHH
Confidence            35688999999999888888887521                 11233399999999999999999986


No 136
>KOG0696|consensus
Probab=67.52  E-value=5.1  Score=25.52  Aligned_cols=57  Identities=16%  Similarity=0.285  Sum_probs=35.2

Q ss_pred             CCCCeecCCCCccccChhhHHHHHHhcCCceeeCCCCccccccchHHHHHHh-hhCCCCChhhhHH
Q psy10072         10 GEKPYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCVKQKDLNTHIE-RRHMPGDVLGHIQ   74 (84)
Q Consensus        10 ~~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f~~~~~l~~H~~-~~~~~~~~~~~~~   74 (84)
                      |..-++|.+|.        +..|.+-|.-..|.|+--++.+...+....|.. .|+-..|.-|.-+
T Consensus        70 gKQGfQCqvC~--------fvvHkrChefVtF~CPGadkg~dtDdpr~kHkf~~~tYssPTFCDhC  127 (683)
T KOG0696|consen   70 GKQGFQCQVCC--------FVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYSSPTFCDHC  127 (683)
T ss_pred             ccCceeeeEEe--------ehhhhhhcceEEEECCCCCCCCCCCCcccccceeeeecCCCchhhhH
Confidence            34456666663        456777666666888877777776666666643 3555555555443


No 137
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=67.32  E-value=2.8  Score=21.21  Aligned_cols=36  Identities=25%  Similarity=0.488  Sum_probs=19.0

Q ss_pred             eecCCCCccccChhhHHHHHHh-cCC-ce-eeCCCCccccc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRI-HQD-LK-VKCPHCAYKCV   51 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~-~~~-~~-~~c~~C~~~f~   51 (84)
                      ..|+.|+..=..-  ...+.+. ..+ .. |.|..|+..++
T Consensus        73 ~~CpkCg~~ea~y--~~~QtRsaDEp~T~Fy~C~~Cg~~wr  111 (113)
T COG1594          73 EKCPKCGNKEAYY--WQLQTRSADEPETRFYKCTRCGYRWR  111 (113)
T ss_pred             ccCCCCCCceeEE--EeeehhccCCCceEEEEecccCCEee
Confidence            4577777532222  2222332 222 33 79999997764


No 138
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=66.61  E-value=9.9  Score=16.33  Aligned_cols=40  Identities=23%  Similarity=0.419  Sum_probs=21.7

Q ss_pred             CCCeecCC--CCccccChhhHHHHHHhcCC-ceeeCCC----Cccccc
Q psy10072         11 EKPYKCTF--CPFTAAHSSTMSYHLRIHQD-LKVKCPH----CAYKCV   51 (84)
Q Consensus        11 ~k~~~c~~--C~~~f~~~~~l~~h~~~~~~-~~~~c~~----C~~~f~   51 (84)
                      ..+..|+.  |...+. ...|..|....-. ....|..    |...+.
T Consensus         7 ~~~v~C~~~cc~~~i~-r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen    7 FRPVPCPNGCCNEMIP-RKELDDHLENECPKRPVPCPYSPYGCKERVP   53 (60)
T ss_dssp             TSEEE-TT--S-BEEE-CCCHHHHHHTTSTTSEEE-SS----S--EEE
T ss_pred             CCEeeCCCCCccccee-HHHHHHHHHccCCCCcEECCCCCCCCCCccc
Confidence            34667877  444444 4578889884333 3478888    776554


No 139
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=66.55  E-value=1.5  Score=23.19  Aligned_cols=33  Identities=27%  Similarity=0.600  Sum_probs=19.1

Q ss_pred             hhcCCC----CeecCCCCccccChhhHHHHHHhcCCceeeCCCCcc
Q psy10072          7 THTGEK----PYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAY   48 (84)
Q Consensus         7 ~h~~~k----~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~   48 (84)
                      -++|++    .+.|..||.....         .+++.-..|+.|+.
T Consensus       102 Y~sGE~~g~G~l~C~~Cg~~~~~---------~~~~~l~~Cp~C~~  138 (146)
T PF07295_consen  102 YHSGEVVGPGTLVCENCGHEVEL---------THPERLPPCPKCGH  138 (146)
T ss_pred             eecCcEecCceEecccCCCEEEe---------cCCCcCCCCCCCCC
Confidence            345554    4888889864321         12222268888875


No 140
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=66.18  E-value=3.7  Score=22.28  Aligned_cols=8  Identities=25%  Similarity=0.924  Sum_probs=4.8

Q ss_pred             CeecCCCC
Q psy10072         13 PYKCTFCP   20 (84)
Q Consensus        13 ~~~c~~C~   20 (84)
                      .|.|++||
T Consensus       134 ~~vC~vCG  141 (166)
T COG1592         134 VWVCPVCG  141 (166)
T ss_pred             EEEcCCCC
Confidence            46666665


No 141
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=66.14  E-value=3.2  Score=20.65  Aligned_cols=15  Identities=33%  Similarity=0.536  Sum_probs=12.5

Q ss_pred             CeecCCCCccccChh
Q psy10072         13 PYKCTFCPFTAAHSS   27 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~   27 (84)
                      |+.|..||..|..-+
T Consensus         2 pH~CtrCG~vf~~g~   16 (112)
T COG3364           2 PHQCTRCGEVFDDGS   16 (112)
T ss_pred             Cceeccccccccccc
Confidence            789999999998753


No 142
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=65.73  E-value=5.2  Score=21.04  Aligned_cols=46  Identities=13%  Similarity=0.179  Sum_probs=26.8

Q ss_pred             CeecCCCCccccChhh--HHHHHHh---cCCce-eeCCCCccccccchHHHH
Q psy10072         13 PYKCTFCPFTAAHSST--MSYHLRI---HQDLK-VKCPHCAYKCVKQKDLNT   58 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~--l~~h~~~---~~~~~-~~c~~C~~~f~~~~~l~~   58 (84)
                      ...|..|+..+...+.  ...-+..   ..... +.|+.|++.|..-+.+..
T Consensus        91 ~sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiyW~GsH~~~  142 (147)
T PF01927_consen   91 FSRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIYWEGSHWRR  142 (147)
T ss_pred             CCccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEecccccHHH
Confidence            3679999986543321  1111111   11233 799999999987765543


No 143
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=65.58  E-value=2.5  Score=17.29  Aligned_cols=15  Identities=27%  Similarity=0.662  Sum_probs=8.5

Q ss_pred             CCeecCCCCccccCh
Q psy10072         12 KPYKCTFCPFTAAHS   26 (84)
Q Consensus        12 k~~~c~~C~~~f~~~   26 (84)
                      .|+.|+.|++.|-..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            477888888877543


No 144
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=65.43  E-value=2.6  Score=18.12  Aligned_cols=12  Identities=17%  Similarity=0.465  Sum_probs=6.1

Q ss_pred             ecCCCCccccCh
Q psy10072         15 KCTFCPFTAAHS   26 (84)
Q Consensus        15 ~c~~C~~~f~~~   26 (84)
                      .|+.|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            889998887654


No 145
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=65.07  E-value=5.8  Score=16.40  Aligned_cols=26  Identities=19%  Similarity=0.550  Sum_probs=14.4

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCce-eeCCCCcc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAY   48 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~   48 (84)
                      +.|+.|+..  ....+.       ... |+|..|.+
T Consensus        19 ~~CP~Cg~~--~~~~~~-------~~~~~~C~~C~~   45 (46)
T PF12760_consen   19 FVCPHCGST--KHYRLK-------TRGRYRCKACRK   45 (46)
T ss_pred             CCCCCCCCe--eeEEeC-------CCCeEECCCCCC
Confidence            568888864  111111       133 88888864


No 146
>KOG2071|consensus
Probab=64.58  E-value=5.5  Score=25.93  Aligned_cols=27  Identities=30%  Similarity=0.604  Sum_probs=21.9

Q ss_pred             CCCeecCCCCccccChhhHHHHHHhcC
Q psy10072         11 EKPYKCTFCPFTAAHSSTMSYHLRIHQ   37 (84)
Q Consensus        11 ~k~~~c~~C~~~f~~~~~l~~h~~~~~   37 (84)
                      ..|-.|..||..|........|+..|.
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhh
Confidence            356889999999999988887777654


No 147
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=64.24  E-value=6.7  Score=22.86  Aligned_cols=11  Identities=27%  Similarity=0.821  Sum_probs=9.0

Q ss_pred             eeCCCCccccc
Q psy10072         41 VKCPHCAYKCV   51 (84)
Q Consensus        41 ~~c~~C~~~f~   51 (84)
                      |.|+.|+..|.
T Consensus       156 f~C~~C~h~F~  166 (278)
T PF15135_consen  156 FHCPKCRHNFR  166 (278)
T ss_pred             eecccccccch
Confidence            78888888776


No 148
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=64.14  E-value=2.3  Score=21.05  Aligned_cols=37  Identities=19%  Similarity=0.460  Sum_probs=21.8

Q ss_pred             CCCeecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccc
Q psy10072         11 EKPYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCV   51 (84)
Q Consensus        11 ~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~   51 (84)
                      .+.|.|+.|+..-.....+.    .-...- ..|..|+..|.
T Consensus        20 ~k~FtCp~Cghe~vs~ctvk----k~~~~g~~~Cg~CGls~e   57 (104)
T COG4888          20 PKTFTCPRCGHEKVSSCTVK----KTVNIGTAVCGNCGLSFE   57 (104)
T ss_pred             CceEecCccCCeeeeEEEEE----ecCceeEEEcccCcceEE
Confidence            45689999996543332211    111122 68999998775


No 149
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=63.84  E-value=3.4  Score=20.85  Aligned_cols=25  Identities=20%  Similarity=0.514  Sum_probs=15.2

Q ss_pred             CeecCCCCccccChhhHHHHHHhcCCce-eeCCCCcc
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAY   48 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~   48 (84)
                      ...|..|+..|....           .. +.|+.|+.
T Consensus        70 ~~~C~~Cg~~~~~~~-----------~~~~~CP~Cgs   95 (114)
T PRK03681         70 ECWCETCQQYVTLLT-----------QRVRRCPQCHG   95 (114)
T ss_pred             EEEcccCCCeeecCC-----------ccCCcCcCcCC
Confidence            467888886554321           11 56888874


No 150
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=63.74  E-value=2  Score=21.09  Aligned_cols=11  Identities=36%  Similarity=0.890  Sum_probs=7.2

Q ss_pred             eeCCCCccccc
Q psy10072         41 VKCPHCAYKCV   51 (84)
Q Consensus        41 ~~c~~C~~~f~   51 (84)
                      |.|..|+..++
T Consensus        91 y~C~~C~~~w~  101 (104)
T TIGR01384        91 YKCTKCGYVWR  101 (104)
T ss_pred             EEeCCCCCeeE
Confidence            67777776543


No 151
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=63.31  E-value=2.4  Score=16.87  Aligned_cols=29  Identities=17%  Similarity=0.441  Sum_probs=15.6

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCce-eeCCCC
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHC   46 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C   46 (84)
                      ..|+.|...-    .+.+|-....|.. |.|..|
T Consensus         6 v~CP~C~s~~----~v~k~G~~~~G~qryrC~~C   35 (36)
T PF03811_consen    6 VHCPRCQSTE----GVKKNGKSPSGHQRYRCKDC   35 (36)
T ss_pred             eeCCCCCCCC----cceeCCCCCCCCEeEecCcC
Confidence            4577776431    1334444445555 777766


No 152
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=62.94  E-value=4  Score=20.51  Aligned_cols=25  Identities=20%  Similarity=0.514  Sum_probs=13.8

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCceeeCCCCccc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYK   49 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~   49 (84)
                      ..|..|+..|......           +.|+.|+..
T Consensus        71 ~~C~~Cg~~~~~~~~~-----------~~CP~Cgs~   95 (113)
T PF01155_consen   71 ARCRDCGHEFEPDEFD-----------FSCPRCGSP   95 (113)
T ss_dssp             EEETTTS-EEECHHCC-----------HH-SSSSSS
T ss_pred             EECCCCCCEEecCCCC-----------CCCcCCcCC
Confidence            6688888777554321           347777653


No 153
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=62.41  E-value=6.5  Score=21.11  Aligned_cols=7  Identities=29%  Similarity=1.146  Sum_probs=3.7

Q ss_pred             eeCCCCc
Q psy10072         41 VKCPHCA   47 (84)
Q Consensus        41 ~~c~~C~   47 (84)
                      |.|..|+
T Consensus       141 YrC~~C~  147 (156)
T COG3091         141 YRCGKCG  147 (156)
T ss_pred             EEeccCC
Confidence            5555554


No 154
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=62.40  E-value=6  Score=15.76  Aligned_cols=15  Identities=20%  Similarity=0.160  Sum_probs=8.8

Q ss_pred             eecCCCCccccChhh
Q psy10072         14 YKCTFCPFTAAHSST   28 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~   28 (84)
                      -.|+.|++.|.+...
T Consensus         3 ~~CprC~kg~Hwa~~   17 (36)
T PF14787_consen    3 GLCPRCGKGFHWASE   17 (36)
T ss_dssp             -C-TTTSSSCS-TTT
T ss_pred             ccCcccCCCcchhhh
Confidence            358888888876654


No 155
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=61.77  E-value=4.7  Score=23.12  Aligned_cols=16  Identities=19%  Similarity=0.258  Sum_probs=12.7

Q ss_pred             CCCeecCCCCccccCh
Q psy10072         11 EKPYKCTFCPFTAAHS   26 (84)
Q Consensus        11 ~k~~~c~~C~~~f~~~   26 (84)
                      .++.+|.+||..|...
T Consensus       179 GkpqRCpECGqVFKLV  194 (268)
T PTZ00043        179 GFLYRCGECDQIFMLV  194 (268)
T ss_pred             CCCccCCCCCcEEEEE
Confidence            3588999999888653


No 156
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=61.10  E-value=4.7  Score=16.68  Aligned_cols=13  Identities=15%  Similarity=0.355  Sum_probs=10.1

Q ss_pred             ecCCCCccccChh
Q psy10072         15 KCTFCPFTAAHSS   27 (84)
Q Consensus        15 ~c~~C~~~f~~~~   27 (84)
                      .|..|++.|....
T Consensus        10 ~C~~C~rpf~WRK   22 (42)
T PF10013_consen   10 ICPVCGRPFTWRK   22 (42)
T ss_pred             cCcccCCcchHHH
Confidence            4889999987653


No 157
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=60.59  E-value=4.4  Score=19.75  Aligned_cols=14  Identities=29%  Similarity=0.795  Sum_probs=11.6

Q ss_pred             CCeecCCCCccccC
Q psy10072         12 KPYKCTFCPFTAAH   25 (84)
Q Consensus        12 k~~~c~~C~~~f~~   25 (84)
                      +|-.|..||..|..
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            67899999988865


No 158
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=60.58  E-value=11  Score=16.56  Aligned_cols=26  Identities=27%  Similarity=0.609  Sum_probs=15.1

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCceeeCCCCcccc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKC   50 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f   50 (84)
                      ..|..|++.|.....           ...|+.|+..+
T Consensus         6 ~~C~~Cg~~~~~~dD-----------iVvCp~Cgapy   31 (54)
T PF14446_consen    6 CKCPVCGKKFKDGDD-----------IVVCPECGAPY   31 (54)
T ss_pred             ccChhhCCcccCCCC-----------EEECCCCCCcc
Confidence            367788877643321           15677776544


No 159
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=60.45  E-value=5.1  Score=20.75  Aligned_cols=16  Identities=31%  Similarity=0.561  Sum_probs=12.1

Q ss_pred             CCCeecCCCCccccCh
Q psy10072         11 EKPYKCTFCPFTAAHS   26 (84)
Q Consensus        11 ~k~~~c~~C~~~f~~~   26 (84)
                      ...|.|+.|++.|...
T Consensus        51 ~qRyrC~~C~~tf~~~   66 (129)
T COG3677          51 HQRYKCKSCGSTFTVE   66 (129)
T ss_pred             ccccccCCcCcceeee
Confidence            4568888888888755


No 160
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=60.30  E-value=20  Score=20.16  Aligned_cols=35  Identities=17%  Similarity=0.388  Sum_probs=20.3

Q ss_pred             CeecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccc
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCV   51 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~   51 (84)
                      .+.|+.|+ .-.....+   ++.-.... ..|..||..+.
T Consensus         6 y~~Cp~Cg-~eev~hEV---ik~~g~~~lvrC~eCG~V~~   41 (201)
T COG1326           6 YIECPSCG-SEEVSHEV---IKERGREPLVRCEECGTVHP   41 (201)
T ss_pred             EEECCCCC-cchhhHHH---HHhcCCceEEEccCCCcEee
Confidence            46899998 22111111   22223345 89999998773


No 161
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=60.29  E-value=11  Score=16.27  Aligned_cols=26  Identities=27%  Similarity=0.554  Sum_probs=15.1

Q ss_pred             ecCCCCccccChhhHHHHHHhcCCceeeCCCCccc
Q psy10072         15 KCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYK   49 (84)
Q Consensus        15 ~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~   49 (84)
                      .|+.||...    .+..|     ...+.|..|+..
T Consensus        21 ~CPrCG~gv----fmA~H-----~dR~~CGkCgyT   46 (51)
T COG1998          21 FCPRCGPGV----FMADH-----KDRWACGKCGYT   46 (51)
T ss_pred             cCCCCCCcc----hhhhc-----CceeEeccccce
Confidence            588888521    22222     224888888864


No 162
>KOG2071|consensus
Probab=59.62  E-value=6.2  Score=25.72  Aligned_cols=24  Identities=13%  Similarity=0.476  Sum_probs=20.7

Q ss_pred             eeCCCCccccccchHHHHHHhhhC
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERRH   64 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~~   64 (84)
                      -+|..||..|.+......||..|-
T Consensus       419 nqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  419 NQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             chhcccccccccchhhhhHhhhhh
Confidence            589999999999988888887664


No 163
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=59.57  E-value=8.7  Score=24.47  Aligned_cols=24  Identities=29%  Similarity=0.638  Sum_probs=21.2

Q ss_pred             eeCCCCccccccchHHHHHHhhhC
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERRH   64 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~~   64 (84)
                      |.|+.|.+.|.....+..|+..-|
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~eH   81 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQEH   81 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHHhh
Confidence            699999999999999999998533


No 164
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=59.19  E-value=12  Score=16.67  Aligned_cols=12  Identities=25%  Similarity=1.046  Sum_probs=9.2

Q ss_pred             eeCCCCcccccc
Q psy10072         41 VKCPHCAYKCVK   52 (84)
Q Consensus        41 ~~c~~C~~~f~~   52 (84)
                      |.|+.|+.....
T Consensus        47 ~~C~~Cg~~~~r   58 (69)
T PF07282_consen   47 FTCPNCGFEMDR   58 (69)
T ss_pred             EEcCCCCCEECc
Confidence            899999876543


No 165
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=58.64  E-value=6.7  Score=19.43  Aligned_cols=34  Identities=18%  Similarity=0.485  Sum_probs=20.7

Q ss_pred             CCeecCCCCccccChhhHHHHHHhcCCce-eeCCCCcccccc
Q psy10072         12 KPYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVK   52 (84)
Q Consensus        12 k~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~   52 (84)
                      ..+.|+.|+. ....-.+.      .+.. ..|..|+..+..
T Consensus        20 t~f~CP~Cge-~~v~v~~~------k~~~h~~C~~CG~y~~~   54 (99)
T PRK14892         20 KIFECPRCGK-VSISVKIK------KNIAIITCGNCGLYTEF   54 (99)
T ss_pred             cEeECCCCCC-eEeeeecC------CCcceEECCCCCCccCE
Confidence            4588999993 22221211      1444 799999986653


No 166
>KOG4118|consensus
Probab=57.78  E-value=6.1  Score=18.01  Aligned_cols=31  Identities=23%  Similarity=0.425  Sum_probs=24.4

Q ss_pred             eeCCCCccccccchHHHHHHhhhCCCCChhh
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERRHMPGDVLG   71 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~   71 (84)
                      +.|.+|.........+..|...-+...|++.
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~kHpk~~~P~   69 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFENKHPKEPLPE   69 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhhcCCCCCCCH
Confidence            7899998888888888888877666666654


No 167
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=57.29  E-value=2.7  Score=17.88  Aligned_cols=7  Identities=43%  Similarity=1.450  Sum_probs=1.9

Q ss_pred             eecCCCC
Q psy10072         14 YKCTFCP   20 (84)
Q Consensus        14 ~~c~~C~   20 (84)
                      |.|+.|+
T Consensus        42 W~CPiC~   48 (50)
T PF02891_consen   42 WKCPICN   48 (50)
T ss_dssp             -B-TTT-
T ss_pred             eECcCCc
Confidence            4444443


No 168
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=56.74  E-value=10  Score=19.14  Aligned_cols=28  Identities=21%  Similarity=0.573  Sum_probs=18.3

Q ss_pred             ecCCCCccccChhhHHHHHHhcCCceeeCCCCcccccc
Q psy10072         15 KCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCVK   52 (84)
Q Consensus        15 ~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f~~   52 (84)
                      .|+.|...|.+..          +..|.|+.|+.....
T Consensus         4 ~CP~C~seytY~d----------g~~~iCpeC~~EW~~   31 (109)
T TIGR00686         4 PCPKCNSEYTYHD----------GTQLICPSCLYEWNE   31 (109)
T ss_pred             cCCcCCCcceEec----------CCeeECccccccccc
Confidence            6888876665432          333888888876553


No 169
>COG1773 Rubredoxin [Energy production and conversion]
Probab=56.34  E-value=5.9  Score=17.41  Aligned_cols=37  Identities=22%  Similarity=0.499  Sum_probs=20.8

Q ss_pred             CCeecCCCCccccChhhHHHHHHh----cCCce--eeCCCCcc
Q psy10072         12 KPYKCTFCPFTAAHSSTMSYHLRI----HQDLK--VKCPHCAY   48 (84)
Q Consensus        12 k~~~c~~C~~~f~~~~~l~~h~~~----~~~~~--~~c~~C~~   48 (84)
                      +.|+|..||-.|.-...-...-..    ....+  +.|+.|+.
T Consensus         2 ~~~~C~~CG~vYd~e~Gdp~~gi~pgT~fedlPd~w~CP~Cg~   44 (55)
T COG1773           2 KRWRCSVCGYVYDPEKGDPRCGIAPGTPFEDLPDDWVCPECGV   44 (55)
T ss_pred             CceEecCCceEeccccCCccCCCCCCCchhhCCCccCCCCCCC
Confidence            358999999877654322211110    01122  78999984


No 170
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=56.29  E-value=9.5  Score=19.98  Aligned_cols=11  Identities=27%  Similarity=0.664  Sum_probs=6.5

Q ss_pred             CeecCCCCccc
Q psy10072         13 PYKCTFCPFTA   23 (84)
Q Consensus        13 ~~~c~~C~~~f   23 (84)
                      .|.|..|+..+
T Consensus       123 ~~~C~~C~~~~  133 (157)
T PF10263_consen  123 VYRCPSCGREY  133 (157)
T ss_pred             EEEcCCCCCEe
Confidence            35666666554


No 171
>KOG1994|consensus
Probab=55.57  E-value=5.4  Score=22.90  Aligned_cols=21  Identities=29%  Similarity=0.504  Sum_probs=18.9

Q ss_pred             eeCCCCccccccchHHHHHHh
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIE   61 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~   61 (84)
                      |-|..||..|.....|..|-.
T Consensus       240 ~YC~fCG~~y~~~edl~ehCP  260 (268)
T KOG1994|consen  240 YYCFFCGIKYKDEEDLYEHCP  260 (268)
T ss_pred             eEEEEeccccCCHHHHHHhCC
Confidence            999999999999999998843


No 172
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=55.44  E-value=8.1  Score=20.23  Aligned_cols=11  Identities=45%  Similarity=0.963  Sum_probs=6.2

Q ss_pred             CeecCCCCccc
Q psy10072         13 PYKCTFCPFTA   23 (84)
Q Consensus        13 ~~~c~~C~~~f   23 (84)
                      .|.|..|+..+
T Consensus       112 ~y~C~~C~~~~  122 (146)
T smart00731      112 PYRCTGCGQRY  122 (146)
T ss_pred             EEECCCCCCCC
Confidence            45666666544


No 173
>PRK10220 hypothetical protein; Provisional
Probab=55.41  E-value=14  Score=18.67  Aligned_cols=29  Identities=21%  Similarity=0.417  Sum_probs=18.7

Q ss_pred             ecCCCCccccChhhHHHHHHhcCCceeeCCCCccccccc
Q psy10072         15 KCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCVKQ   53 (84)
Q Consensus        15 ~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f~~~   53 (84)
                      .|+.|...|.+..          +..|.|+.|+..+...
T Consensus         5 ~CP~C~seytY~d----------~~~~vCpeC~hEW~~~   33 (111)
T PRK10220          5 HCPKCNSEYTYED----------NGMYICPECAHEWNDA   33 (111)
T ss_pred             cCCCCCCcceEcC----------CCeEECCcccCcCCcc
Confidence            6888876665432          2338899998766533


No 174
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=55.26  E-value=12  Score=23.66  Aligned_cols=10  Identities=20%  Similarity=0.726  Sum_probs=7.0

Q ss_pred             CeecCCCCcc
Q psy10072         13 PYKCTFCPFT   22 (84)
Q Consensus        13 ~~~c~~C~~~   22 (84)
                      .|.|..||..
T Consensus         7 ~y~C~~Cg~~   16 (454)
T TIGR00416         7 KFVCQHCGAD   16 (454)
T ss_pred             eEECCcCCCC
Confidence            4778888754


No 175
>PF11494 Ta0938:  Ta0938;  InterPro: IPR021585  Ta0938 is a protein of unknown function however the structure has been determined. The protein has a novel fold and a putative Zn-binding motif. The structure has two different parts, one region contains a beta sheet flanked by two alpha helices and the other contains a bundle of loops which contain all cysteines in the protein. ; PDB: 2FQH_A.
Probab=54.56  E-value=5.5  Score=19.64  Aligned_cols=40  Identities=20%  Similarity=0.364  Sum_probs=15.8

Q ss_pred             cCCCCeecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccccc
Q psy10072          9 TGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVKQ   53 (84)
Q Consensus         9 ~~~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~~   53 (84)
                      .|.|--.|..|+.+...-.     +......- |.|..|.+.|...
T Consensus        10 ag~ke~~CalCG~tWg~~y-----~Ev~G~rLfFCCd~ca~EF~nm   50 (105)
T PF11494_consen   10 AGTKEMGCALCGATWGDYY-----EEVDGERLFFCCDDCAKEFKNM   50 (105)
T ss_dssp             --SGGGS-SS---S---SS------B-TT--BSSS--SSSS-TTS-
T ss_pred             cccccccccccCCcHHHHH-----HhhcCCEEEEEcHHHHHHHHHH
Confidence            4556678999998765322     23333334 7899999999764


No 176
>PRK11823 DNA repair protein RadA; Provisional
Probab=53.56  E-value=13  Score=23.40  Aligned_cols=11  Identities=27%  Similarity=0.685  Sum_probs=7.7

Q ss_pred             CeecCCCCccc
Q psy10072         13 PYKCTFCPFTA   23 (84)
Q Consensus        13 ~~~c~~C~~~f   23 (84)
                      .|.|..||...
T Consensus         7 ~y~C~~Cg~~~   17 (446)
T PRK11823          7 AYVCQECGAES   17 (446)
T ss_pred             eEECCcCCCCC
Confidence            58888887543


No 177
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=53.51  E-value=5  Score=23.92  Aligned_cols=37  Identities=16%  Similarity=0.395  Sum_probs=19.7

Q ss_pred             CeecCCCCccccChhhHHHHHHhcC-C-ce-eeCCCCccccc
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIHQ-D-LK-VKCPHCAYKCV   51 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~~-~-~~-~~c~~C~~~f~   51 (84)
                      .+.|+.|+..=.....+  +.+... + .. |.|..|+..+.
T Consensus       258 ~~~C~~C~~~~~~~~q~--QtrsaDEpmT~f~~C~~Cg~~w~  297 (299)
T TIGR01385       258 LFTCGKCKQKKCTYYQL--QTRSADEPMTTFVTCEECGNRWK  297 (299)
T ss_pred             cccCCCCCCccceEEEe--cccCCCCCCeEEEEcCCCCCeee
Confidence            47899998543222222  222211 2 33 68988987543


No 178
>PRK05978 hypothetical protein; Provisional
Probab=52.17  E-value=5.8  Score=21.16  Aligned_cols=32  Identities=13%  Similarity=0.300  Sum_probs=17.6

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCceeeCCCCccccccc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCVKQ   53 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f~~~   53 (84)
                      -+|+.|++.=.....|        ...-.|+.|+..|...
T Consensus        34 grCP~CG~G~LF~g~L--------kv~~~C~~CG~~~~~~   65 (148)
T PRK05978         34 GRCPACGEGKLFRAFL--------KPVDHCAACGEDFTHH   65 (148)
T ss_pred             CcCCCCCCCccccccc--------ccCCCccccCCccccC
Confidence            4688888652222111        1115788888776543


No 179
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=51.88  E-value=19  Score=18.34  Aligned_cols=49  Identities=14%  Similarity=0.170  Sum_probs=32.8

Q ss_pred             ecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccccchHHHHHHhhhCC
Q psy10072         15 KCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVKQKDLNTHIERRHM   65 (84)
Q Consensus        15 ~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~~~~l~~H~~~~~~   65 (84)
                      .|--|...|.......+-  .-.... |+|..|...|-..-....|...|.-
T Consensus        57 ~C~~C~~~f~~~~~~~~~--~~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh~C  106 (112)
T TIGR00622        57 FCFGCQGPFPKPPVSPFD--ELKDSHRYVCAVCKNVFCVDCDVFVHESLHCC  106 (112)
T ss_pred             cccCcCCCCCCccccccc--ccccccceeCCCCCCccccccchhhhhhccCC
Confidence            388888888765321111  122333 9999999999988888888776653


No 180
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=51.17  E-value=7  Score=15.37  Aligned_cols=14  Identities=29%  Similarity=0.289  Sum_probs=6.9

Q ss_pred             eecCCCCccccChh
Q psy10072         14 YKCTFCPFTAAHSS   27 (84)
Q Consensus        14 ~~c~~C~~~f~~~~   27 (84)
                      -.|.+|++.|..+.
T Consensus         4 ~~C~eC~~~f~dSy   17 (34)
T PF01286_consen    4 PKCDECGKPFMDSY   17 (34)
T ss_dssp             EE-TTT--EES-SS
T ss_pred             chHhHhCCHHHHHH
Confidence            36888888886653


No 181
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=50.85  E-value=1.2  Score=29.46  Aligned_cols=47  Identities=17%  Similarity=0.300  Sum_probs=27.1

Q ss_pred             ecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccccchHHHHHHh
Q psy10072         15 KCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVKQKDLNTHIE   61 (84)
Q Consensus        15 ~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~~~~l~~H~~   61 (84)
                      .|..||..|+--..+.--...-+... ..|+.|.+.|.+..+..-|.+
T Consensus       125 ~CT~CGPRfTIi~alPYDR~nTsM~~F~lC~~C~~EY~dP~nRRfHAQ  172 (750)
T COG0068         125 NCTNCGPRFTIIEALPYDRENTSMADFPLCPFCDKEYKDPLNRRFHAQ  172 (750)
T ss_pred             ccCCCCcceeeeccCCCCcccCccccCcCCHHHHHHhcCccccccccc
Confidence            37888888775544332222222333 467777777777766555544


No 182
>TIGR00310 ZPR1_znf ZPR1 zinc finger domain.
Probab=50.62  E-value=4.5  Score=22.47  Aligned_cols=36  Identities=17%  Similarity=0.299  Sum_probs=19.9

Q ss_pred             ecCCCCccccChhhHHHHHHhcCCc---e-eeCCCCccccc
Q psy10072         15 KCTFCPFTAAHSSTMSYHLRIHQDL---K-VKCPHCAYKCV   51 (84)
Q Consensus        15 ~c~~C~~~f~~~~~l~~h~~~~~~~---~-~~c~~C~~~f~   51 (84)
                      .|+.|+........+..+ -.+.+.   . |.|+.||....
T Consensus         2 ~Cp~C~~~~~~~~~~~~~-IP~F~evii~sf~C~~CGyr~~   41 (192)
T TIGR00310         2 DCPSCGGECETVMKTVND-IPYFGEVLETSTICEHCGYRSN   41 (192)
T ss_pred             cCCCCCCCCEEEEEEEcC-CCCcceEEEEEEECCCCCCccc
Confidence            488888654443332222 222332   2 78999987654


No 183
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=50.40  E-value=15  Score=20.24  Aligned_cols=34  Identities=21%  Similarity=0.542  Sum_probs=20.1

Q ss_pred             cCCCCeecCCCCccccChhhHHHHHHhcCCceeeCCCCcccc
Q psy10072          9 TGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKC   50 (84)
Q Consensus         9 ~~~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f   50 (84)
                      +...-|.|+.|...|+....      ...+  |.|+.||...
T Consensus       109 ~~~~~y~C~~~~~r~sfdeA------~~~~--F~Cp~Cg~~L  142 (176)
T COG1675         109 TENNYYVCPNCHVKYSFDEA------MELG--FTCPKCGEDL  142 (176)
T ss_pred             ccCCceeCCCCCCcccHHHH------HHhC--CCCCCCCchh
Confidence            44556888887766544321      1111  8899998643


No 184
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=50.36  E-value=7  Score=16.87  Aligned_cols=24  Identities=21%  Similarity=0.451  Sum_probs=12.5

Q ss_pred             eeCCCCccccccchHHHHHHhhhC
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERRH   64 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~~   64 (84)
                      |.|+.|...|-..-....|...|.
T Consensus        22 y~C~~C~~~FC~dCD~fiHE~LH~   45 (51)
T PF07975_consen   22 YRCPKCKNHFCIDCDVFIHETLHN   45 (51)
T ss_dssp             E--TTTT--B-HHHHHTTTTTS-S
T ss_pred             EECCCCCCccccCcChhhhccccC
Confidence            888888888876666666655554


No 185
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=50.31  E-value=24  Score=21.15  Aligned_cols=23  Identities=26%  Similarity=0.397  Sum_probs=20.1

Q ss_pred             eeCCCCccccccchHHHHHHhhh
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERR   63 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~   63 (84)
                      |.|..|-+-|.....+.+|+...
T Consensus        49 yiCe~Clky~~~~~~l~~H~~~C   71 (290)
T PLN03238         49 YICEYCLKYMRKKKSLLRHLAKC   71 (290)
T ss_pred             EEcCCCcchhCCHHHHHHHHHhC
Confidence            89999999999999999998753


No 186
>KOG1842|consensus
Probab=50.22  E-value=8.9  Score=24.32  Aligned_cols=26  Identities=27%  Similarity=0.593  Sum_probs=21.1

Q ss_pred             eeCCCCccccccchHHHHHHhhhCCC
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERRHMP   66 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~~~~   66 (84)
                      |.|+.|...|..-..|.-|...-|.+
T Consensus        16 flCPiC~~dl~~~~~L~~H~d~eH~~   41 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLDVEHFE   41 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHhhhccc
Confidence            88999999898888888888765543


No 187
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=50.13  E-value=4  Score=22.82  Aligned_cols=38  Identities=16%  Similarity=0.207  Sum_probs=23.0

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCce----eeCCCCccccccc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLK----VKCPHCAYKCVKQ   53 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~----~~c~~C~~~f~~~   53 (84)
                      ..|+.|+..+.....+  ....|.|.-    +.|..|++.+..-
T Consensus        15 ~~CPvCg~~l~~~~~~--~~IPyFG~V~i~t~~C~~CgYR~~DV   56 (201)
T COG1779          15 IDCPVCGGTLKAHMYL--YDIPYFGEVLISTGVCERCGYRSTDV   56 (201)
T ss_pred             ecCCcccceeeEEEee--ecCCccceEEEEEEEccccCCcccce
Confidence            5799999855433221  122344533    6899999876543


No 188
>KOG1088|consensus
Probab=49.75  E-value=10  Score=19.47  Aligned_cols=20  Identities=15%  Similarity=-0.046  Sum_probs=12.7

Q ss_pred             hcCCCCeecCCCCccccChh
Q psy10072          8 HTGEKPYKCTFCPFTAAHSS   27 (84)
Q Consensus         8 h~~~k~~~c~~C~~~f~~~~   27 (84)
                      +.-+....|++||+.|+-+.
T Consensus        93 ~v~EG~l~CpetG~vfpI~~  112 (124)
T KOG1088|consen   93 DVIEGELVCPETGRVFPISD  112 (124)
T ss_pred             hhccceEecCCCCcEeeccc
Confidence            34445567888887776543


No 189
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=49.65  E-value=14  Score=15.80  Aligned_cols=13  Identities=31%  Similarity=0.728  Sum_probs=9.0

Q ss_pred             eeCCCCccccccc
Q psy10072         41 VKCPHCAYKCVKQ   53 (84)
Q Consensus        41 ~~c~~C~~~f~~~   53 (84)
                      +.|..|+..|...
T Consensus        29 W~C~~Cgh~w~~~   41 (55)
T PF14311_consen   29 WKCPKCGHEWKAS   41 (55)
T ss_pred             EECCCCCCeeEcc
Confidence            6888887766544


No 190
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=49.62  E-value=6.3  Score=17.80  Aligned_cols=17  Identities=18%  Similarity=0.174  Sum_probs=9.5

Q ss_pred             hcCCCCeecCCCCcccc
Q psy10072          8 HTGEKPYKCTFCPFTAA   24 (84)
Q Consensus         8 h~~~k~~~c~~C~~~f~   24 (84)
                      +..+....|+.|++.|.
T Consensus        48 ~i~eg~L~Cp~c~r~YP   64 (68)
T PF03966_consen   48 EIVEGELICPECGREYP   64 (68)
T ss_dssp             ETTTTEEEETTTTEEEE
T ss_pred             cccCCEEEcCCCCCEEe
Confidence            33444556666666654


No 191
>KOG2231|consensus
Probab=48.96  E-value=23  Score=23.85  Aligned_cols=19  Identities=32%  Similarity=0.641  Sum_probs=8.7

Q ss_pred             cCCCCccccChhhHHHHHH
Q psy10072         16 CTFCPFTAAHSSTMSYHLR   34 (84)
Q Consensus        16 c~~C~~~f~~~~~l~~h~~   34 (84)
                      |+.|...|.....+.+|++
T Consensus       185 C~~C~~~fld~~el~rH~~  203 (669)
T KOG2231|consen  185 CKFCHERFLDDDELYRHLR  203 (669)
T ss_pred             chhhhhhhccHHHHHHhhc
Confidence            4444444444444444443


No 192
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=48.80  E-value=9.8  Score=16.07  Aligned_cols=12  Identities=33%  Similarity=0.877  Sum_probs=8.7

Q ss_pred             eeCCCCcccccc
Q psy10072         41 VKCPHCAYKCVK   52 (84)
Q Consensus        41 ~~c~~C~~~f~~   52 (84)
                      |+|..|+..|.-
T Consensus         2 y~C~~CgyvYd~   13 (47)
T PF00301_consen    2 YQCPVCGYVYDP   13 (47)
T ss_dssp             EEETTTSBEEET
T ss_pred             cCCCCCCEEEcC
Confidence            678888877653


No 193
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=48.74  E-value=16  Score=14.61  Aligned_cols=12  Identities=25%  Similarity=0.736  Sum_probs=4.3

Q ss_pred             CeecCCCCcccc
Q psy10072         13 PYKCTFCPFTAA   24 (84)
Q Consensus        13 ~~~c~~C~~~f~   24 (84)
                      .|-|..|...+.
T Consensus         3 ryyCdyC~~~~~   14 (38)
T PF06220_consen    3 RYYCDYCKKYLT   14 (38)
T ss_dssp             S-B-TTT--B-S
T ss_pred             Ceecccccceec
Confidence            356777777663


No 194
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=48.41  E-value=8.1  Score=15.27  Aligned_cols=30  Identities=17%  Similarity=0.194  Sum_probs=17.5

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCV   51 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~   51 (84)
                      +.|+.||..|....        ..... -.|..|+-.+.
T Consensus         2 r~C~~Cg~~Yh~~~--------~pP~~~~~Cd~cg~~L~   32 (36)
T PF05191_consen    2 RICPKCGRIYHIEF--------NPPKVEGVCDNCGGELV   32 (36)
T ss_dssp             EEETTTTEEEETTT--------B--SSTTBCTTTTEBEB
T ss_pred             cCcCCCCCcccccc--------CCCCCCCccCCCCCeeE
Confidence            46888888875432        22233 57787875443


No 195
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=48.40  E-value=17  Score=15.37  Aligned_cols=11  Identities=18%  Similarity=0.271  Sum_probs=6.7

Q ss_pred             ecCCCCccccC
Q psy10072         15 KCTFCPFTAAH   25 (84)
Q Consensus        15 ~c~~C~~~f~~   25 (84)
                      .|..|++.|..
T Consensus         4 ~C~~C~~~F~~   14 (57)
T cd00065           4 SCMGCGKPFTL   14 (57)
T ss_pred             cCcccCccccC
Confidence            46667766654


No 196
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=48.30  E-value=9  Score=23.41  Aligned_cols=40  Identities=30%  Similarity=0.580  Sum_probs=18.1

Q ss_pred             CCeecCCCCccccChhhHH---HHHH-hcCCce--eeCCCCccccc
Q psy10072         12 KPYKCTFCPFTAAHSSTMS---YHLR-IHQDLK--VKCPHCAYKCV   51 (84)
Q Consensus        12 k~~~c~~C~~~f~~~~~l~---~h~~-~~~~~~--~~c~~C~~~f~   51 (84)
                      +.+.|..|..+.-.....-   .|.. .+.+.+  |+|..|+....
T Consensus       251 kav~C~~C~yt~~~~~~~C~~~~H~l~~~~a~KRFFkC~~C~~Rt~  296 (344)
T PF09332_consen  251 KAVTCKQCKYTAFKPSDRCKEEGHPLKWHDAVKRFFKCKDCGNRTI  296 (344)
T ss_dssp             EEEEETTT--EESS--HHHHHTT--EEEEEEE-EEEE-T-TS-EEE
T ss_pred             EEEEcCCCCCcccCcchhHHhcCCceEEeeeeeeeEECCCCCCeee
Confidence            4588999987655554433   2221 233444  79999987544


No 197
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=47.87  E-value=11  Score=19.06  Aligned_cols=11  Identities=0%  Similarity=-0.556  Sum_probs=5.2

Q ss_pred             cCCCCccccCh
Q psy10072         16 CTFCPFTAAHS   26 (84)
Q Consensus        16 c~~C~~~f~~~   26 (84)
                      |+.|++.|...
T Consensus        12 dPetg~KFYDL   22 (129)
T COG4530          12 DPETGKKFYDL   22 (129)
T ss_pred             Cccccchhhcc
Confidence            44555544433


No 198
>KOG4727|consensus
Probab=47.84  E-value=11  Score=20.65  Aligned_cols=22  Identities=23%  Similarity=0.493  Sum_probs=19.2

Q ss_pred             CeecCCCCccccChhhHHHHHH
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLR   34 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~   34 (84)
                      -|-|.+|+-+|..+.++..|+.
T Consensus        75 GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   75 GYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             ceeeeecceeehhhHHHHHHhc
Confidence            4889999999999988888875


No 199
>KOG0717|consensus
Probab=47.34  E-value=13  Score=23.72  Aligned_cols=22  Identities=14%  Similarity=0.288  Sum_probs=17.5

Q ss_pred             eecCCCCccccChhhHHHHHHh
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRI   35 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~   35 (84)
                      +.|..|+++|.+...+..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            6789999999888777777653


No 200
>KOG3507|consensus
Probab=47.29  E-value=18  Score=16.18  Aligned_cols=28  Identities=21%  Similarity=0.587  Sum_probs=17.0

Q ss_pred             CeecCCCCccccChhhHHHHHHhcCCceeeCCCCcccc
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKC   50 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f   50 (84)
                      .|.|.+|+..-..          ..+..+.|..||...
T Consensus        20 iYiCgdC~~en~l----------k~~D~irCReCG~RI   47 (62)
T KOG3507|consen   20 IYICGDCGQENTL----------KRGDVIRCRECGYRI   47 (62)
T ss_pred             EEEeccccccccc----------cCCCcEehhhcchHH
Confidence            4788888753221          113338999998644


No 201
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=46.54  E-value=9.6  Score=16.32  Aligned_cols=12  Identities=25%  Similarity=0.617  Sum_probs=9.0

Q ss_pred             eeCCCCcccccc
Q psy10072         41 VKCPHCAYKCVK   52 (84)
Q Consensus        41 ~~c~~C~~~f~~   52 (84)
                      |+|..|+..|.-
T Consensus         2 y~C~~CgyiYd~   13 (50)
T cd00730           2 YECRICGYIYDP   13 (50)
T ss_pred             cCCCCCCeEECC
Confidence            678888887763


No 202
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=46.20  E-value=9.8  Score=19.53  Aligned_cols=31  Identities=19%  Similarity=0.520  Sum_probs=16.4

Q ss_pred             CeecCCCCccccChhhHHHHHHhcCCceeeCCCCcc
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAY   48 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~   48 (84)
                      ...| .|+..|.....-..    +..-.+.|+.|+.
T Consensus        70 ~~~C-~Cg~~~~~~~~~~~----~~~~~~~CP~Cgs  100 (124)
T PRK00762         70 EIEC-ECGYEGVVDEDEID----HYAAVIECPVCGN  100 (124)
T ss_pred             eEEe-eCcCcccccccchh----ccccCCcCcCCCC
Confidence            4678 89877665421000    0111157888873


No 203
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=45.60  E-value=12  Score=15.53  Aligned_cols=36  Identities=17%  Similarity=0.360  Sum_probs=18.4

Q ss_pred             ecCCCCccccChhhHHHHHHhcCCce-eeCCC--Ccccccc
Q psy10072         15 KCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPH--CAYKCVK   52 (84)
Q Consensus        15 ~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~--C~~~f~~   52 (84)
                      .|+.||....-......+  ....+. ++|..  ||..|..
T Consensus         1 ~CP~Cg~~a~ir~S~~~s--~~~~~~Y~qC~N~~Cg~tfv~   39 (47)
T PF04606_consen    1 RCPHCGSKARIRTSRQLS--PLTRELYCQCTNPECGHTFVA   39 (47)
T ss_pred             CcCCCCCeeEEEEchhhC--cceEEEEEEECCCcCCCEEEE
Confidence            378888654433322211  111223 68855  8887753


No 204
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the COG2879 Uncharacterized small protein [Function unknown]
Probab=45.30  E-value=25  Score=15.98  Aligned_cols=19  Identities=11%  Similarity=0.275  Sum_probs=14.8

Q ss_pred             cchHHHHHHhhhCCCCChh
Q psy10072         52 KQKDLNTHIERRHMPGDVL   70 (84)
Q Consensus        52 ~~~~l~~H~~~~~~~~~~~   70 (84)
                      +=+++..||+.++..+|.-
T Consensus        24 dYdnYVehmr~~hPd~p~m   42 (65)
T COG2879          24 DYDNYVEHMRKKHPDKPPM   42 (65)
T ss_pred             cHHHHHHHHHHhCcCCCcc
Confidence            4467889999998888763


No 206
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=44.73  E-value=11  Score=15.13  Aligned_cols=13  Identities=15%  Similarity=0.271  Sum_probs=9.1

Q ss_pred             CeecCCCCccccC
Q psy10072         13 PYKCTFCPFTAAH   25 (84)
Q Consensus        13 ~~~c~~C~~~f~~   25 (84)
                      .+.|+.||..+..
T Consensus        32 ~~~C~~CGE~~~~   44 (46)
T TIGR03831        32 ALVCPQCGEEYLD   44 (46)
T ss_pred             ccccccCCCEeeC
Confidence            4678888876543


No 207
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=44.61  E-value=20  Score=22.08  Aligned_cols=13  Identities=23%  Similarity=0.102  Sum_probs=7.4

Q ss_pred             CCeecCCCCcccc
Q psy10072         12 KPYKCTFCPFTAA   24 (84)
Q Consensus        12 k~~~c~~C~~~f~   24 (84)
                      ..++|+.|+.+-+
T Consensus        13 ~~g~cp~c~~w~~   25 (372)
T cd01121          13 WLGKCPECGEWNT   25 (372)
T ss_pred             ccEECcCCCCcee
Confidence            3466666665433


No 208
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=44.30  E-value=19  Score=16.25  Aligned_cols=37  Identities=24%  Similarity=0.498  Sum_probs=19.1

Q ss_pred             ecCCCCcc-ccChhhHH-HHHHhcCCceeeCCCCccccc
Q psy10072         15 KCTFCPFT-AAHSSTMS-YHLRIHQDLKVKCPHCAYKCV   51 (84)
Q Consensus        15 ~c~~C~~~-f~~~~~l~-~h~~~~~~~~~~c~~C~~~f~   51 (84)
                      .|..|++. +.....+. +.++...-..|.|+.|.-...
T Consensus         4 kCiiCd~v~~iD~rt~~tKrLrN~PIrtymC~eC~~Rva   42 (68)
T COG4896           4 KCIICDRVDEIDNRTFKTKRLRNKPIRTYMCPECEHRVA   42 (68)
T ss_pred             eEEEecceeeecchhHHHHHhhCCCceeEechhhHhhhc
Confidence            57777763 33333333 333322223399999975433


No 209
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=44.23  E-value=12  Score=18.83  Aligned_cols=21  Identities=29%  Similarity=0.461  Sum_probs=18.4

Q ss_pred             eeCCCCccccccchHHHHHHh
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIE   61 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~   61 (84)
                      +-|..|.+-|.....|..|.+
T Consensus        56 hYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          56 HYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             eeeehhHHHHHHHHHHHHHhc
Confidence            789999999999999998864


No 210
>KOG3352|consensus
Probab=44.12  E-value=12  Score=20.10  Aligned_cols=13  Identities=15%  Similarity=0.311  Sum_probs=9.4

Q ss_pred             CeecCCCCccccC
Q psy10072         13 PYKCTFCPFTAAH   25 (84)
Q Consensus        13 ~~~c~~C~~~f~~   25 (84)
                      ..+|.+||..|..
T Consensus       133 ~~rc~eCG~~fkL  145 (153)
T KOG3352|consen  133 TQRCPECGHYFKL  145 (153)
T ss_pred             cccCCcccceEEe
Confidence            4578888877754


No 211
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=44.00  E-value=9.4  Score=20.58  Aligned_cols=18  Identities=22%  Similarity=0.392  Sum_probs=14.6

Q ss_pred             CCCeecCCCCccccChhh
Q psy10072         11 EKPYKCTFCPFTAAHSST   28 (84)
Q Consensus        11 ~k~~~c~~C~~~f~~~~~   28 (84)
                      +.|.-|..||+.|++...
T Consensus        66 ~~PsYC~~CGkpyPWt~~   83 (158)
T PF10083_consen   66 EAPSYCHNCGKPYPWTEN   83 (158)
T ss_pred             CCChhHHhCCCCCchHHH
Confidence            468889999999988754


No 212
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=43.98  E-value=17  Score=15.97  Aligned_cols=15  Identities=13%  Similarity=0.501  Sum_probs=9.4

Q ss_pred             CCCCeecCCCCcccc
Q psy10072         10 GEKPYKCTFCPFTAA   24 (84)
Q Consensus        10 ~~k~~~c~~C~~~f~   24 (84)
                      +...|.|+.||..+.
T Consensus        11 ~~v~~~Cp~cGipth   25 (55)
T PF13824_consen   11 AHVNFECPDCGIPTH   25 (55)
T ss_pred             cccCCcCCCCCCcCc
Confidence            345677888876543


No 213
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=43.90  E-value=24  Score=13.72  Aligned_cols=20  Identities=30%  Similarity=0.806  Sum_probs=9.8

Q ss_pred             eeCCCCccccccchHHHHHHh
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIE   61 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~   61 (84)
                      +.|+.|++... .+.+..|+.
T Consensus         5 ~~C~nC~R~v~-a~RfA~HLe   24 (33)
T PF08209_consen    5 VECPNCGRPVA-ASRFAPHLE   24 (33)
T ss_dssp             EE-TTTSSEEE-GGGHHHHHH
T ss_pred             EECCCCcCCcc-hhhhHHHHH
Confidence            56777766443 223445544


No 214
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=43.76  E-value=27  Score=14.97  Aligned_cols=8  Identities=50%  Similarity=1.273  Sum_probs=3.8

Q ss_pred             eeCCCCcc
Q psy10072         41 VKCPHCAY   48 (84)
Q Consensus        41 ~~c~~C~~   48 (84)
                      ..|+.|++
T Consensus        47 ~~Cp~CgR   54 (56)
T PF02591_consen   47 VFCPNCGR   54 (56)
T ss_pred             EECcCCCc
Confidence            44555543


No 215
>PRK12860 transcriptional activator FlhC; Provisional
Probab=43.31  E-value=18  Score=20.21  Aligned_cols=12  Identities=17%  Similarity=0.240  Sum_probs=7.3

Q ss_pred             CeecCCCCcccc
Q psy10072         13 PYKCTFCPFTAA   24 (84)
Q Consensus        13 ~~~c~~C~~~f~   24 (84)
                      ...|..|+..|.
T Consensus       134 l~~C~~Cgg~fv  145 (189)
T PRK12860        134 LARCCRCGGKFV  145 (189)
T ss_pred             eccCCCCCCCee
Confidence            345667766664


No 216
>KOG2807|consensus
Probab=42.65  E-value=69  Score=19.81  Aligned_cols=53  Identities=17%  Similarity=0.331  Sum_probs=31.5

Q ss_pred             CCeecCCCCccccChhhHHHHHHh--c-------------------------CCce-eeCCCCccccccchHHHHHHhhh
Q psy10072         12 KPYKCTFCPFTAAHSSTMSYHLRI--H-------------------------QDLK-VKCPHCAYKCVKQKDLNTHIERR   63 (84)
Q Consensus        12 k~~~c~~C~~~f~~~~~l~~h~~~--~-------------------------~~~~-~~c~~C~~~f~~~~~l~~H~~~~   63 (84)
                      -|..|+.|+-+......|.+.-..  .                         .+.. |.|..|...|-..-....|-..|
T Consensus       289 LP~eCpiC~ltLVss~hLARSyhhL~PL~~F~Eip~~~~~~~~~Cf~C~~~~~~~~~y~C~~Ck~~FCldCDv~iHesLh  368 (378)
T KOG2807|consen  289 LPIECPICSLTLVSSPHLARSYHHLFPLKPFVEIPETEYNGSRFCFACQGELLSSGRYRCESCKNVFCLDCDVFIHESLH  368 (378)
T ss_pred             CCccCCccceeEecchHHHHHHHhhcCCcchhhccccccCCCcceeeeccccCCCCcEEchhccceeeccchHHHHhhhh
Confidence            467788888776666665543220  0                         0112 66777777777666666665555


Q ss_pred             C
Q psy10072         64 H   64 (84)
Q Consensus        64 ~   64 (84)
                      .
T Consensus       369 ~  369 (378)
T KOG2807|consen  369 N  369 (378)
T ss_pred             c
Confidence            4


No 217
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=42.17  E-value=16  Score=14.15  Aligned_cols=12  Identities=25%  Similarity=0.473  Sum_probs=7.8

Q ss_pred             CeecCCCCcccc
Q psy10072         13 PYKCTFCPFTAA   24 (84)
Q Consensus        13 ~~~c~~C~~~f~   24 (84)
                      .+.|..|+..|.
T Consensus        21 ~~~C~~Cg~~~~   32 (33)
T PF08792_consen   21 YEVCIFCGSSFP   32 (33)
T ss_pred             eEEcccCCcEee
Confidence            456777776653


No 218
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=40.50  E-value=7.2  Score=24.75  Aligned_cols=16  Identities=13%  Similarity=0.499  Sum_probs=11.8

Q ss_pred             CCCeecCCCCccccCh
Q psy10072         11 EKPYKCTFCPFTAAHS   26 (84)
Q Consensus        11 ~k~~~c~~C~~~f~~~   26 (84)
                      .+.|.|..|+..|...
T Consensus       423 ~~~~~c~~c~~~yd~~  438 (479)
T PRK05452        423 GPRMQCSVCQWIYDPA  438 (479)
T ss_pred             CCeEEECCCCeEECCC
Confidence            3568999999777654


No 219
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=40.17  E-value=18  Score=15.90  Aligned_cols=15  Identities=27%  Similarity=0.549  Sum_probs=7.6

Q ss_pred             CCCeecCCCCccccC
Q psy10072         11 EKPYKCTFCPFTAAH   25 (84)
Q Consensus        11 ~k~~~c~~C~~~f~~   25 (84)
                      ++--.|+.|++.|..
T Consensus        37 ~rYngCPfC~~~~~~   51 (55)
T PF14447_consen   37 ERYNGCPFCGTPFEF   51 (55)
T ss_pred             hhccCCCCCCCcccC
Confidence            344455666655543


No 220
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=39.74  E-value=14  Score=14.82  Aligned_cols=32  Identities=22%  Similarity=0.412  Sum_probs=13.2

Q ss_pred             CeecCCCCccccChhhHHHHHHhcCCce-eeCCCCcccc
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKC   50 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f   50 (84)
                      |.+|..|+. +..+.     .....+.+ |.|..|+..-
T Consensus         2 p~rC~~C~a-ylNp~-----~~~~~~~~~w~C~~C~~~N   34 (40)
T PF04810_consen    2 PVRCRRCRA-YLNPF-----CQFDDGGKTWICNFCGTKN   34 (40)
T ss_dssp             S-B-TTT---BS-TT-----SEEETTTTEEEETTT--EE
T ss_pred             ccccCCCCC-EECCc-----ceEcCCCCEEECcCCCCcC
Confidence            456777753 32222     23333433 8888887643


No 221
>PF14369 zf-RING_3:  zinc-finger
Probab=39.63  E-value=16  Score=14.29  Aligned_cols=10  Identities=20%  Similarity=0.331  Sum_probs=8.1

Q ss_pred             ecCCCCcccc
Q psy10072         15 KCTFCPFTAA   24 (84)
Q Consensus        15 ~c~~C~~~f~   24 (84)
                      .|+.|+..|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            5999998874


No 222
>KOG0227|consensus
Probab=39.54  E-value=17  Score=20.42  Aligned_cols=27  Identities=22%  Similarity=0.604  Sum_probs=15.3

Q ss_pred             hhhhcCCCCeecCCCCccccChhhHHHHH
Q psy10072          5 IRTHTGEKPYKCTFCPFTAAHSSTMSYHL   33 (84)
Q Consensus         5 ~~~h~~~k~~~c~~C~~~f~~~~~l~~h~   33 (84)
                      |+.|.|.  |.|..|.-.-.+..+...|.
T Consensus        47 mkNh~G~--yeCkLClT~H~ne~Syl~Ht   73 (222)
T KOG0227|consen   47 MKNHLGK--YECKLCLTLHNNEGSYLAHT   73 (222)
T ss_pred             hhccCcc--eeehhhhhhhcchhhhhhhh
Confidence            4556664  77777765544444444443


No 223
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=39.48  E-value=22  Score=18.97  Aligned_cols=10  Identities=20%  Similarity=0.747  Sum_probs=6.8

Q ss_pred             eeCCCCcccc
Q psy10072         41 VKCPHCAYKC   50 (84)
Q Consensus        41 ~~c~~C~~~f   50 (84)
                      |.|..|+..+
T Consensus        52 ~~C~~C~~~~   61 (166)
T cd04476          52 YRCEKCNKSV   61 (166)
T ss_pred             EECCCCCCcC
Confidence            7777777653


No 224
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=39.44  E-value=13  Score=15.86  Aligned_cols=16  Identities=25%  Similarity=0.447  Sum_probs=11.0

Q ss_pred             eeCCCCccccccchHH
Q psy10072         41 VKCPHCAYKCVKQKDL   56 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l   56 (84)
                      -.|+.|++.|......
T Consensus        13 KICpvCqRPFsWRkKW   28 (54)
T COG4338          13 KICPVCQRPFSWRKKW   28 (54)
T ss_pred             hhhhhhcCchHHHHHH
Confidence            3688888888765443


No 225
>KOG2636|consensus
Probab=39.08  E-value=26  Score=22.43  Aligned_cols=21  Identities=19%  Similarity=0.575  Sum_probs=10.2

Q ss_pred             CCeecCCCC-ccccChhhHHHH
Q psy10072         12 KPYKCTFCP-FTAAHSSTMSYH   32 (84)
Q Consensus        12 k~~~c~~C~-~~f~~~~~l~~h   32 (84)
                      +-|.|..|| .++.-+..+.+|
T Consensus       400 ~ey~CEICGNy~Y~GrkaF~RH  421 (497)
T KOG2636|consen  400 IEYNCEICGNYVYKGRKAFDRH  421 (497)
T ss_pred             cccceeeccCccccCcHHHHHH
Confidence            345555555 344444444444


No 226
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=39.02  E-value=19  Score=14.58  Aligned_cols=9  Identities=33%  Similarity=0.954  Sum_probs=6.5

Q ss_pred             CeecCCCCc
Q psy10072         13 PYKCTFCPF   21 (84)
Q Consensus        13 ~~~c~~C~~   21 (84)
                      |..|+.||.
T Consensus         2 ~~~Cp~Cg~   10 (47)
T PF14690_consen    2 PPRCPHCGS   10 (47)
T ss_pred             CccCCCcCC
Confidence            567888884


No 227
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=38.65  E-value=21  Score=13.93  Aligned_cols=9  Identities=33%  Similarity=1.235  Sum_probs=6.5

Q ss_pred             eeCCCCccc
Q psy10072         41 VKCPHCAYK   49 (84)
Q Consensus        41 ~~c~~C~~~   49 (84)
                      +.|+.|+..
T Consensus        23 ~vC~~Cg~I   31 (34)
T PF14803_consen   23 LVCPACGFI   31 (34)
T ss_dssp             EEETTTTEE
T ss_pred             eECCCCCCE
Confidence            788888753


No 228
>KOG2857|consensus
Probab=38.58  E-value=18  Score=19.28  Aligned_cols=22  Identities=27%  Similarity=0.552  Sum_probs=18.2

Q ss_pred             eeeCCCCccccccchHHHHHHh
Q psy10072         40 KVKCPHCAYKCVKQKDLNTHIE   61 (84)
Q Consensus        40 ~~~c~~C~~~f~~~~~l~~H~~   61 (84)
                      +|+|+.|...|.+..-++.|..
T Consensus        17 KYKCpkC~vPYCSl~CfKiHk~   38 (157)
T KOG2857|consen   17 KYKCPKCSVPYCSLPCFKIHKS   38 (157)
T ss_pred             hccCCCCCCccccchhhhhccC
Confidence            4899999988888888888865


No 229
>PF05180 zf-DNL:  DNL zinc finger;  InterPro: IPR007853 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNL-type zinc finger is found in Tim15, a zinc finger protein essential for protein import into mitochondria. Mitochondrial functions rely on the correct transport of resident proteins synthesized in the cytosol to mitochondria. Protein import into mitochondria is mediated by membrane protein complexes, protein translocators, in the outer and inner mitochondrial membranes, in cooperation with their assistant proteins in the cytosol, intermembrane space and matrix. Proteins destined to the mitochondrial matrix cross the outer membrane with the aid of the outer membrane translocator, the tOM40 complex, and then the inner membrane with the aid of the inner membrane translocator, the TIM23 complex, and mitochondrial motor and chaperone (MMC) proteins including mitochondrial heat- shock protein 70 (mtHsp70), and translocase in the inner mitochondrial membrane (Tim)15. Tim15 is also known as zinc finger motif (Zim)17 or mtHsp70 escort protein (Hep)1. Tim15 contains a zinc-finger motif (CXXC and CXXC) of ~100 residues, which has been named DNL after a short C-terminal motif of D(N/H)L [, , ]. The DNL-type zinc finger is an L-shaped molecule. The two CXXC motifs are located at the end of the L, and are sandwiched by two- stranded antiparallel beta-sheets. Two short alpha-helices constitute another leg of the L. The outer (convex) face of the L has a large acidic groove, which is lined with five acidic residues, whereas the inner (concave) face of the L has two positively charged residues, next to the CXXC motifs []. This entry represents the DNL-type zinc finger.; GO: 0008270 zinc ion binding; PDB: 2E2Z_A.
Probab=37.98  E-value=16  Score=16.71  Aligned_cols=41  Identities=24%  Similarity=0.597  Sum_probs=21.0

Q ss_pred             CeecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccccchHH
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVKQKDL   56 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~~~~l   56 (84)
                      .|.|..|+..-...  +.++ ..+.|.- .+|+.|.....-.++|
T Consensus         4 ~FTC~~C~~Rs~~~--~sk~-aY~~GvViv~C~gC~~~HlIaDnL   45 (66)
T PF05180_consen    4 TFTCNKCGTRSAKM--FSKQ-AYHKGVVIVQCPGCKNRHLIADNL   45 (66)
T ss_dssp             EEEETTTTEEEEEE--EEHH-HHHTSEEEEE-TTS--EEES--SS
T ss_pred             EEEcCCCCCcccee--eCHH-HHhCCeEEEECCCCcceeeehhhh
Confidence            37899998543322  2222 3456666 7999998755444443


No 230
>PTZ00064 histone acetyltransferase; Provisional
Probab=37.57  E-value=35  Score=22.27  Aligned_cols=23  Identities=22%  Similarity=0.306  Sum_probs=20.4

Q ss_pred             eeCCCCccccccchHHHHHHhhh
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERR   63 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~   63 (84)
                      |.|..|.+-|.....|.+|+...
T Consensus       281 YICEfCLkY~~s~~~l~rH~~~C  303 (552)
T PTZ00064        281 HFCEYCLDFFCFEDELIRHLSRC  303 (552)
T ss_pred             EEccchhhhhCCHHHHHHHHhcC
Confidence            89999999999999999998753


No 231
>PRK12722 transcriptional activator FlhC; Provisional
Probab=37.49  E-value=28  Score=19.46  Aligned_cols=27  Identities=15%  Similarity=0.339  Sum_probs=14.7

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCce-eeCCCCcc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAY   48 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~   48 (84)
                      ..|..|+..|.....        .... |.|+.|..
T Consensus       135 ~~C~~Cgg~fv~~~~--------e~~~~f~CplC~~  162 (187)
T PRK12722        135 SSCNCCGGHFVTHAH--------DPVGSFVCGLCQP  162 (187)
T ss_pred             ccCCCCCCCeecccc--------ccCCCCcCCCCCC
Confidence            457777766653321        1222 67777754


No 232
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=37.27  E-value=18  Score=23.57  Aligned_cols=37  Identities=19%  Similarity=0.486  Sum_probs=22.3

Q ss_pred             eecCCCCccccChhhHHHHHHhcC----Cce-eeCCCCccccccc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQ----DLK-VKCPHCAYKCVKQ   53 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~----~~~-~~c~~C~~~f~~~   53 (84)
                      ..|+.|+..+...-.   .++...    ..- |.|+.|+......
T Consensus       201 vpCPhCg~~~~l~~~---~l~w~~~~~~~~a~y~C~~Cg~~i~e~  242 (557)
T PF05876_consen  201 VPCPHCGEEQVLEWE---NLKWDKGEAPETARYVCPHCGCEIEEH  242 (557)
T ss_pred             ccCCCCCCCcccccc---ceeecCCCCccceEEECCCCcCCCCHH
Confidence            569999987664411   122221    222 8999999876643


No 233
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=37.06  E-value=17  Score=17.74  Aligned_cols=13  Identities=23%  Similarity=0.439  Sum_probs=8.6

Q ss_pred             CeecCCCCccccC
Q psy10072         13 PYKCTFCPFTAAH   25 (84)
Q Consensus        13 ~~~c~~C~~~f~~   25 (84)
                      .|.|..|++.|.-
T Consensus        54 IW~C~~C~~~~AG   66 (90)
T PRK03976         54 IWECRKCGAKFAG   66 (90)
T ss_pred             EEEcCCCCCEEeC
Confidence            4777777776653


No 234
>PF05766 NinG:  Bacteriophage Lambda NinG protein;  InterPro: IPR008713 The ninR region of phage lambda contains two recombination genes, ninB (also known as orf) and ninG (also known as rap). These genes are involved in the RecF and RecBCD recombination pathways of Escherichia coli that operate on phage lambda [, ]. NinB and NinG participate in Red recombination, the primary pathway operating when wild-type lambda grows lytically in rec+ cells [].
Probab=37.04  E-value=14  Score=20.58  Aligned_cols=17  Identities=24%  Similarity=0.296  Sum_probs=12.4

Q ss_pred             CCCeecCCCCccccChh
Q psy10072         11 EKPYKCTFCPFTAAHSS   27 (84)
Q Consensus        11 ~k~~~c~~C~~~f~~~~   27 (84)
                      .++-.|..|+..|....
T Consensus         4 ~k~rKCKvCg~~F~P~~   20 (189)
T PF05766_consen    4 PKRRKCKVCGEWFVPAR   20 (189)
T ss_pred             CCCCcCcccCCccccCC
Confidence            35668999998887543


No 235
>PRK01343 zinc-binding protein; Provisional
Probab=36.95  E-value=36  Score=15.12  Aligned_cols=10  Identities=20%  Similarity=0.437  Sum_probs=6.3

Q ss_pred             eecCCCCccc
Q psy10072         14 YKCTFCPFTA   23 (84)
Q Consensus        14 ~~c~~C~~~f   23 (84)
                      ..|+.|++.+
T Consensus        10 ~~CP~C~k~~   19 (57)
T PRK01343         10 RPCPECGKPS   19 (57)
T ss_pred             CcCCCCCCcC
Confidence            4577777654


No 236
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=36.55  E-value=33  Score=21.95  Aligned_cols=23  Identities=17%  Similarity=0.433  Sum_probs=20.3

Q ss_pred             eeCCCCccccccchHHHHHHhhh
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERR   63 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~   63 (84)
                      |.|..|.+-|.....|.+|+...
T Consensus       199 yiCe~Cl~y~~~~~~~~~H~~~C  221 (450)
T PLN00104        199 YFCEFCLKFMKRKEQLQRHMKKC  221 (450)
T ss_pred             EEchhhhhhhcCHHHHHHHHhcC
Confidence            89999999999999999998743


No 237
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=36.54  E-value=20  Score=14.27  Aligned_cols=11  Identities=36%  Similarity=0.751  Sum_probs=5.5

Q ss_pred             CeecCCCCccc
Q psy10072         13 PYKCTFCPFTA   23 (84)
Q Consensus        13 ~~~c~~C~~~f   23 (84)
                      .|.|..||...
T Consensus         6 ~YkC~~CGniV   16 (36)
T PF06397_consen    6 FYKCEHCGNIV   16 (36)
T ss_dssp             EEE-TTT--EE
T ss_pred             EEEccCCCCEE
Confidence            57788887654


No 238
>PF06044 DRP:  Dam-replacing family;  InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements. The replacement of Dam-methylase by DRP allows phase variation through slippage-like mechanisms in several pathogenic isolates of Neisseria meningitidis [].; PDB: 4ESJ_A.
Probab=36.16  E-value=20  Score=20.91  Aligned_cols=35  Identities=14%  Similarity=0.341  Sum_probs=12.9

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccccch
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVKQK   54 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~~~   54 (84)
                      ..|+.||.......      ....... |.|..|...|...+
T Consensus        32 ~yCP~Cg~~~L~~f------~NN~PVaDF~C~~C~eeyELKS   67 (254)
T PF06044_consen   32 MYCPNCGSKPLSKF------ENNRPVADFYCPNCNEEYELKS   67 (254)
T ss_dssp             ---TTT--SS-EE--------------EEE-TTT--EEEEEE
T ss_pred             CcCCCCCChhHhhc------cCCCccceeECCCCchHHhhhh
Confidence            57999986532221      1222333 99999998886544


No 239
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=36.12  E-value=18  Score=19.33  Aligned_cols=15  Identities=13%  Similarity=0.162  Sum_probs=12.1

Q ss_pred             eecCCCCccccChhh
Q psy10072         14 YKCTFCPFTAAHSST   28 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~   28 (84)
                      =.|..|++.|++-..
T Consensus        29 ReC~~C~~RFTTyEr   43 (147)
T TIGR00244        29 RECLECHERFTTFER   43 (147)
T ss_pred             ccCCccCCccceeee
Confidence            479999999987654


No 240
>KOG3014|consensus
Probab=35.87  E-value=29  Score=20.36  Aligned_cols=25  Identities=20%  Similarity=0.426  Sum_probs=19.2

Q ss_pred             eecCCCCccccCh--hhHHHHHHhcCC
Q psy10072         14 YKCTFCPFTAAHS--STMSYHLRIHQD   38 (84)
Q Consensus        14 ~~c~~C~~~f~~~--~~l~~h~~~~~~   38 (84)
                      -.|.+|+..|+..  .+-..|.++|+.
T Consensus        38 ~~C~~Cgm~Yt~~s~EDe~~H~~fH~~   64 (257)
T KOG3014|consen   38 VKCKECGMKYTVTSPEDEALHEKFHNR   64 (257)
T ss_pred             eehhhcCceecCCCHHHHHHHHHHHHh
Confidence            4799999877654  567789898874


No 241
>PF12907 zf-met2:  Zinc-binding
Probab=35.77  E-value=14  Score=15.06  Aligned_cols=20  Identities=25%  Similarity=0.551  Sum_probs=8.4

Q ss_pred             eCCCCccccc---cchHHHHHHh
Q psy10072         42 KCPHCAYKCV---KQKDLNTHIE   61 (84)
Q Consensus        42 ~c~~C~~~f~---~~~~l~~H~~   61 (84)
                      .|..|...|.   ....|..|-.
T Consensus         3 ~C~iC~qtF~~t~~~~~L~eH~e   25 (40)
T PF12907_consen    3 ICKICRQTFMQTTNEPQLKEHAE   25 (40)
T ss_pred             CcHHhhHHHHhcCCHHHHHHHHH
Confidence            3444543332   2233555544


No 242
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=35.29  E-value=60  Score=19.08  Aligned_cols=15  Identities=27%  Similarity=0.851  Sum_probs=11.1

Q ss_pred             eeCCCCccccccchH
Q psy10072         41 VKCPHCAYKCVKQKD   55 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~   55 (84)
                      |.|+.|+..+...-+
T Consensus       323 ~~C~~cg~~~~rD~n  337 (364)
T COG0675         323 FKCPRCGFVHDRDVN  337 (364)
T ss_pred             EECCCCCCeehhhHH
Confidence            999999987654433


No 243
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=34.14  E-value=33  Score=18.83  Aligned_cols=20  Identities=20%  Similarity=0.295  Sum_probs=15.0

Q ss_pred             CCCeecCCCCccccChhhHH
Q psy10072         11 EKPYKCTFCPFTAAHSSTMS   30 (84)
Q Consensus        11 ~k~~~c~~C~~~f~~~~~l~   30 (84)
                      ..+..|..||+.|.....+.
T Consensus       112 ~~~~~C~~Cg~~f~~~k~i~  131 (181)
T PRK08222        112 FHLQRCSRCERPFAPQKTVA  131 (181)
T ss_pred             cccCcCcccCCccCcHhHHH
Confidence            35778999999998665444


No 244
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=33.59  E-value=20  Score=19.30  Aligned_cols=15  Identities=13%  Similarity=0.151  Sum_probs=12.1

Q ss_pred             eecCCCCccccChhh
Q psy10072         14 YKCTFCPFTAAHSST   28 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~   28 (84)
                      =.|..|+..|++-..
T Consensus        29 ReC~~C~~RFTTfE~   43 (156)
T COG1327          29 RECLECGERFTTFER   43 (156)
T ss_pred             hcccccccccchhhe
Confidence            479999999987654


No 245
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=31.98  E-value=38  Score=13.30  Aligned_cols=13  Identities=23%  Similarity=0.330  Sum_probs=7.0

Q ss_pred             CCeecCCCCcccc
Q psy10072         12 KPYKCTFCPFTAA   24 (84)
Q Consensus        12 k~~~c~~C~~~f~   24 (84)
                      .+..|..||..+.
T Consensus        20 ~~isC~~CGPr~~   32 (35)
T PF07503_consen   20 QFISCTNCGPRYS   32 (35)
T ss_dssp             TT--BTTCC-SCC
T ss_pred             cCccCCCCCCCEE
Confidence            3567888887664


No 246
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=31.88  E-value=25  Score=18.38  Aligned_cols=17  Identities=24%  Similarity=0.380  Sum_probs=13.6

Q ss_pred             CCCeecCCCCccccChh
Q psy10072         11 EKPYKCTFCPFTAAHSS   27 (84)
Q Consensus        11 ~k~~~c~~C~~~f~~~~   27 (84)
                      +.|..|..||+.|++..
T Consensus        66 e~psfchncgs~fpwte   82 (160)
T COG4306          66 EPPSFCHNCGSRFPWTE   82 (160)
T ss_pred             CCcchhhcCCCCCCcHH
Confidence            45778999999998764


No 247
>PTZ00448 hypothetical protein; Provisional
Probab=31.86  E-value=34  Score=21.31  Aligned_cols=22  Identities=14%  Similarity=0.508  Sum_probs=18.4

Q ss_pred             eeCCCCccccccchHHHHHHhh
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIER   62 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~   62 (84)
                      |.|..|+..|........|.+.
T Consensus       315 ~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        315 LLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             ccccccccccCCHHHHHHHhhh
Confidence            7899999999877778888764


No 248
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=31.81  E-value=20  Score=21.54  Aligned_cols=31  Identities=19%  Similarity=0.370  Sum_probs=18.0

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccccc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVKQ   53 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~~   53 (84)
                      ..|+.|+.....+. |        ... +.|+.|+.-|+..
T Consensus        39 ~kc~~C~~~~~~~~-l--------~~~~~vcp~c~~h~rlt   70 (296)
T CHL00174         39 VQCENCYGLNYKKF-L--------KSKMNICEQCGYHLKMS   70 (296)
T ss_pred             eECCCccchhhHHH-H--------HHcCCCCCCCCCCcCCC
Confidence            45888876543321 1        122 6888888877643


No 249
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=31.62  E-value=38  Score=21.64  Aligned_cols=12  Identities=17%  Similarity=0.764  Sum_probs=8.6

Q ss_pred             CCeecCCCCccc
Q psy10072         12 KPYKCTFCPFTA   23 (84)
Q Consensus        12 k~~~c~~C~~~f   23 (84)
                      ..|.|..||...
T Consensus         6 t~f~C~~CG~~s   17 (456)
T COG1066           6 TAFVCQECGYVS   17 (456)
T ss_pred             cEEEcccCCCCC
Confidence            458888888654


No 250
>PF10071 DUF2310:  Zn-ribbon-containing, possibly nucleic-acid-binding protein (DUF2310);  InterPro: IPR016908 This group represents uncharacterised conserved proteins.
Probab=31.53  E-value=36  Score=20.07  Aligned_cols=31  Identities=23%  Similarity=0.432  Sum_probs=19.3

Q ss_pred             CeecCCCCccccChhhHHHHHHhcCCceeeCCCCccc
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYK   49 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~   49 (84)
                      .-.|+.||+.......+      |.--.|+|..|...
T Consensus       220 ~r~CP~Cg~~W~L~~pl------h~iFdFKCD~CRLV  250 (258)
T PF10071_consen  220 ARKCPSCGGDWRLKEPL------HDIFDFKCDPCRLV  250 (258)
T ss_pred             CCCCCCCCCccccCCch------hhceeccCCcceee
Confidence            34688898866555544      22222888888654


No 251
>KOG0978|consensus
Probab=31.41  E-value=16  Score=24.57  Aligned_cols=47  Identities=19%  Similarity=0.373  Sum_probs=27.0

Q ss_pred             CeecCCCCccccChhhHH-HH------HHhcCCce-eeCCCCccccccchHHHHH
Q psy10072         13 PYKCTFCPFTAAHSSTMS-YH------LRIHQDLK-VKCPHCAYKCVKQKDLNTH   59 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~-~h------~~~~~~~~-~~c~~C~~~f~~~~~l~~H   59 (84)
                      ...|+.|+..+....-.. .|      ++.-.+.+ -+||.|+..|...+.+..|
T Consensus       643 ~LkCs~Cn~R~Kd~vI~kC~H~FC~~Cvq~r~etRqRKCP~Cn~aFganDv~~I~  697 (698)
T KOG0978|consen  643 LLKCSVCNTRWKDAVITKCGHVFCEECVQTRYETRQRKCPKCNAAFGANDVHRIH  697 (698)
T ss_pred             ceeCCCccCchhhHHHHhcchHHHHHHHHHHHHHhcCCCCCCCCCCCcccccccC
Confidence            367999986554432111 11      11112333 6999999999877655444


No 252
>COG5246 PRP11 Splicing factor 3a, subunit 2 [RNA processing and modification]
Probab=31.08  E-value=37  Score=18.99  Aligned_cols=27  Identities=26%  Similarity=0.562  Sum_probs=16.7

Q ss_pred             hhhcCCCCeecCCCCccccChhhHHHHHH
Q psy10072          6 RTHTGEKPYKCTFCPFTAAHSSTMSYHLR   34 (84)
Q Consensus         6 ~~h~~~k~~~c~~C~~~f~~~~~l~~h~~   34 (84)
                      +.|+|.  |.|..|...-.+..+..+|..
T Consensus        48 knh~Gk--~vC~LC~T~H~~e~Sy~~H~~   74 (222)
T COG5246          48 KNHTGK--YVCLLCKTKHLTEMSYVKHRE   74 (222)
T ss_pred             hcCCCc--EEeeeeccccccHHHHHHhhc
Confidence            446664  788888766655555555543


No 253
>KOG0782|consensus
Probab=30.94  E-value=19  Score=23.91  Aligned_cols=25  Identities=20%  Similarity=0.375  Sum_probs=10.5

Q ss_pred             hHHHHHHhcCCce-eeCCCCcccccc
Q psy10072         28 TMSYHLRIHQDLK-VKCPHCAYKCVK   52 (84)
Q Consensus        28 ~l~~h~~~~~~~~-~~c~~C~~~f~~   52 (84)
                      .+..|-..|.... -+|..|++.|.+
T Consensus       240 ~fvrHHWVHrrRqeGkC~~CgKgFQQ  265 (1004)
T KOG0782|consen  240 GFVRHHWVHRRRQEGKCNTCGKGFQQ  265 (1004)
T ss_pred             cchHHhHhhHhhhccccchhhhhhhh
Confidence            3333433333333 345555554443


No 254
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=30.70  E-value=37  Score=14.84  Aligned_cols=14  Identities=29%  Similarity=0.415  Sum_probs=5.7

Q ss_pred             CeecCCCCccccCh
Q psy10072         13 PYKCTFCPFTAAHS   26 (84)
Q Consensus        13 ~~~c~~C~~~f~~~   26 (84)
                      |.....|+-.|...
T Consensus        24 PV~s~~C~H~fek~   37 (57)
T PF11789_consen   24 PVKSKKCGHTFEKE   37 (57)
T ss_dssp             EEEESSS--EEEHH
T ss_pred             CcCcCCCCCeecHH
Confidence            44444555555443


No 255
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=30.53  E-value=22  Score=21.19  Aligned_cols=30  Identities=20%  Similarity=0.434  Sum_probs=18.1

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCce-eeCCCCcccccc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVK   52 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~   52 (84)
                      ..|+.|+.....+. |        ... +.|+.|+.-|+.
T Consensus        27 ~~c~~c~~~~~~~~-l--------~~~~~vc~~c~~h~rl   57 (285)
T TIGR00515        27 TKCPKCGQVLYTKE-L--------ERNLEVCPKCDHHMRM   57 (285)
T ss_pred             eECCCCcchhhHHH-H--------HhhCCCCCCCCCcCcC
Confidence            46888876543321 1        122 688889887764


No 256
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=30.43  E-value=52  Score=13.62  Aligned_cols=28  Identities=21%  Similarity=0.476  Sum_probs=16.5

Q ss_pred             CCCeecCCCCccccChhhHHHHHHhcCCce-eeCCCCccc
Q psy10072         11 EKPYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYK   49 (84)
Q Consensus        11 ~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~   49 (84)
                      .+|-.|..|++..           ...+.. +.|..|+..
T Consensus         9 ~~~~~C~~C~~~i-----------~g~~~~g~~C~~C~~~   37 (53)
T PF00130_consen    9 SKPTYCDVCGKFI-----------WGLGKQGYRCSWCGLV   37 (53)
T ss_dssp             SSTEB-TTSSSBE-----------CSSSSCEEEETTTT-E
T ss_pred             CCCCCCcccCccc-----------CCCCCCeEEECCCCCh
Confidence            4677888888764           112333 888888754


No 257
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=30.20  E-value=54  Score=16.36  Aligned_cols=19  Identities=11%  Similarity=0.216  Sum_probs=14.0

Q ss_pred             CCeecCCCCccccChhhHH
Q psy10072         12 KPYKCTFCPFTAAHSSTMS   30 (84)
Q Consensus        12 k~~~c~~C~~~f~~~~~l~   30 (84)
                      .-+.|+.||..+.......
T Consensus        30 ~~~~C~~CGe~~~~~e~~~   48 (127)
T TIGR03830        30 PGWYCPACGEELLDPEESK   48 (127)
T ss_pred             eeeECCCCCCEEEcHHHHH
Confidence            3478999999887776544


No 258
>PRK07218 replication factor A; Provisional
Probab=30.05  E-value=36  Score=21.56  Aligned_cols=10  Identities=20%  Similarity=0.454  Sum_probs=6.6

Q ss_pred             eecCCCCccc
Q psy10072         14 YKCTFCPFTA   23 (84)
Q Consensus        14 ~~c~~C~~~f   23 (84)
                      .+|+.|++..
T Consensus       298 ~rCP~C~r~v  307 (423)
T PRK07218        298 ERCPECGRVI  307 (423)
T ss_pred             ecCcCccccc
Confidence            4677777654


No 259
>PF00649 Copper-fist:  Copper fist DNA binding domain;  InterPro: IPR001083 Some fungal transcription factors contain an N-terminal domain, the copper fist, which seems to be involved in copper-dependent DNA-binding [, ]. These proteins activate the transcription of the metallothionein gene in response to copper. Metallothionein maintains copper levels in yeast [, ]. The copper fist domain, which is similar in structure to metallothionein itself, undergoes a large conformational change on copper-binding that allows DNA-binding. The domain contains a conserved array of zinc-binding residues (Cys-X2-Cys-X8-Cys-X-His) and forms a three-stranded antiparallel beta-sheet with two short helical segments that project from one end of the beta-sheet []. Conserved residues form a basic patch that may be important for DNA binding. ; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0005507 copper ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1CO4_A.
Probab=30.01  E-value=52  Score=13.47  Aligned_cols=15  Identities=20%  Similarity=0.339  Sum_probs=9.9

Q ss_pred             CCceeeCCCCccccc
Q psy10072         37 QDLKVKCPHCAYKCV   51 (84)
Q Consensus        37 ~~~~~~c~~C~~~f~   51 (84)
                      .+.+|.|..|-+.-+
T Consensus         5 ~g~KyAC~~CirGHR   19 (40)
T PF00649_consen    5 DGEKYACESCIRGHR   19 (40)
T ss_dssp             TTEEEEETTTTTTSG
T ss_pred             CCeEEEhhhhhCccc
Confidence            355688888866544


No 260
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=29.53  E-value=22  Score=15.32  Aligned_cols=14  Identities=14%  Similarity=0.543  Sum_probs=6.5

Q ss_pred             CCCeecCCCCcccc
Q psy10072         11 EKPYKCTFCPFTAA   24 (84)
Q Consensus        11 ~k~~~c~~C~~~f~   24 (84)
                      ...++|..|++.+.
T Consensus        33 ~~~~rC~YCe~~~~   46 (52)
T PF02748_consen   33 PIKLRCHYCERIIT   46 (52)
T ss_dssp             TCEEEETTT--EEE
T ss_pred             CCEEEeeCCCCEec
Confidence            34466666665543


No 261
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=29.29  E-value=39  Score=23.65  Aligned_cols=32  Identities=16%  Similarity=0.247  Sum_probs=17.6

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCceeeCCCCccccc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCV   51 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f~   51 (84)
                      -.|..|++.|......      -...+..|..||..|.
T Consensus       461 dtC~~C~kkFfSlsK~------L~~RKHHCRkCGrVFC  492 (1374)
T PTZ00303        461 DSCPSCGRAFISLSRP------LGTRAHHCRSCGIRLC  492 (1374)
T ss_pred             CcccCcCCcccccccc------cccccccccCCccccC
Confidence            4589999988654110      0112255666666554


No 262
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=28.61  E-value=37  Score=12.88  Aligned_cols=12  Identities=33%  Similarity=0.791  Sum_probs=8.6

Q ss_pred             CCeecCCCCccc
Q psy10072         12 KPYKCTFCPFTA   23 (84)
Q Consensus        12 k~~~c~~C~~~f   23 (84)
                      +-|.|..|+...
T Consensus         6 ~~ykC~~Cgniv   17 (34)
T TIGR00319         6 QVYKCEVCGNIV   17 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            467888888654


No 263
>KOG2461|consensus
Probab=28.60  E-value=29  Score=21.73  Aligned_cols=59  Identities=14%  Similarity=-0.104  Sum_probs=24.2

Q ss_pred             hcCCCCeecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccccchHHHHHHhhhCCC
Q psy10072          8 HTGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVKQKDLNTHIERRHMP   66 (84)
Q Consensus         8 h~~~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~~~~l~~H~~~~~~~   66 (84)
                      +++..+..++.+.+.+.....+..+...+.+.+ +.+..+...+.....+..++.++...
T Consensus       326 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  385 (396)
T KOG2461|consen  326 ATVSVWTGETIPVRTPAGQLIYTQSHSMEVAEPTDMAPNQIWKIYHTGVLGFLIITTDES  385 (396)
T ss_pred             ccccccCcCcccccccccccchhhhhhcccCCCCcccccccccceeccccceeeeecccc
Confidence            344444444444444444444444444444433 34443333333333334444444433


No 264
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=28.57  E-value=34  Score=11.90  Aligned_cols=6  Identities=33%  Similarity=0.894  Sum_probs=2.8

Q ss_pred             cCCCCc
Q psy10072         16 CTFCPF   21 (84)
Q Consensus        16 c~~C~~   21 (84)
                      |+.||.
T Consensus         2 Cp~CG~    7 (23)
T PF13240_consen    2 CPNCGA    7 (23)
T ss_pred             CcccCC
Confidence            444544


No 265
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=28.52  E-value=37  Score=12.90  Aligned_cols=11  Identities=36%  Similarity=0.845  Sum_probs=7.3

Q ss_pred             CeecCCCCccc
Q psy10072         13 PYKCTFCPFTA   23 (84)
Q Consensus        13 ~~~c~~C~~~f   23 (84)
                      -|.|..|+...
T Consensus         4 ~ykC~~CGniv   14 (34)
T cd00974           4 VYKCEICGNIV   14 (34)
T ss_pred             EEEcCCCCcEE
Confidence            46777777654


No 266
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=28.42  E-value=36  Score=12.78  Aligned_cols=10  Identities=30%  Similarity=1.109  Sum_probs=4.8

Q ss_pred             eeCCCCcccc
Q psy10072         41 VKCPHCAYKC   50 (84)
Q Consensus        41 ~~c~~C~~~f   50 (84)
                      |.|+.|+..+
T Consensus        14 Y~Cp~C~~~~   23 (30)
T PF04438_consen   14 YRCPRCGARY   23 (30)
T ss_dssp             EE-TTT--EE
T ss_pred             EECCCcCCce
Confidence            7777777654


No 267
>KOG3277|consensus
Probab=28.23  E-value=59  Score=17.71  Aligned_cols=40  Identities=23%  Similarity=0.595  Sum_probs=22.9

Q ss_pred             CeecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccccchH
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVKQKD   55 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~~~~   55 (84)
                      .|.|.+|+..-..  .+.++ ..+.|.- .+|+.|..--...++
T Consensus        79 ~yTCkvCntRs~k--tisk~-AY~~GvVivqC~gC~~~HliaDn  119 (165)
T KOG3277|consen   79 AYTCKVCNTRSTK--TISKQ-AYEKGVVIVQCPGCKNHHLIADN  119 (165)
T ss_pred             EEEeeccCCcccc--ccChh-hhhCceEEEECCCCccceeehhh
Confidence            3889999865331  22222 3355666 799998754333333


No 268
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional
Probab=28.16  E-value=42  Score=18.30  Aligned_cols=18  Identities=17%  Similarity=0.309  Sum_probs=13.8

Q ss_pred             CCeecCCCCccccChhhH
Q psy10072         12 KPYKCTFCPFTAAHSSTM   29 (84)
Q Consensus        12 k~~~c~~C~~~f~~~~~l   29 (84)
                      .++.|..||+.|.....+
T Consensus       113 ~~~~C~~CG~~f~~~~~i  130 (180)
T PRK12387        113 ALCNCRVCGRPFAVQKEI  130 (180)
T ss_pred             CcccchhhCCccccHHHH
Confidence            467899999999866543


No 269
>PF04032 Rpr2:  RNAse P Rpr2/Rpp21/SNM1 subunit domain;  InterPro: IPR007175 This family contains a ribonuclease P subunit of human and yeast. Other members of the family include the probable archaeal homologues. This subunit possibly binds the precursor tRNA [].; PDB: 2K3R_A 2KI7_B 2ZAE_B 1X0T_A.
Probab=28.06  E-value=4.2  Score=18.98  Aligned_cols=18  Identities=17%  Similarity=0.119  Sum_probs=7.1

Q ss_pred             cCCCCeecCCCCccccCh
Q psy10072          9 TGEKPYKCTFCPFTAAHS   26 (84)
Q Consensus         9 ~~~k~~~c~~C~~~f~~~   26 (84)
                      ...+..-|..|+..+...
T Consensus        42 ~~~kr~~Ck~C~~~liPG   59 (85)
T PF04032_consen   42 PEIKRTICKKCGSLLIPG   59 (85)
T ss_dssp             TTCCCTB-TTT--B--CT
T ss_pred             hHHhcccccCCCCEEeCC
Confidence            334455677777655443


No 270
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=27.66  E-value=26  Score=20.96  Aligned_cols=30  Identities=20%  Similarity=0.459  Sum_probs=17.9

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCce-eeCCCCcccccc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVK   52 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~   52 (84)
                      ..|+.|+.....+. |        ... +.|+.|+.-|+-
T Consensus        28 ~~c~~c~~~~~~~~-l--------~~~~~vc~~c~~h~rl   58 (292)
T PRK05654         28 TKCPSCGQVLYRKE-L--------EANLNVCPKCGHHMRI   58 (292)
T ss_pred             eECCCccchhhHHH-H--------HhcCCCCCCCCCCeeC
Confidence            46888876543221 1        122 688889887764


No 271
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=27.63  E-value=31  Score=19.61  Aligned_cols=16  Identities=19%  Similarity=0.557  Sum_probs=13.5

Q ss_pred             CCCeecCCCCccccCh
Q psy10072         11 EKPYKCTFCPFTAAHS   26 (84)
Q Consensus        11 ~k~~~c~~C~~~f~~~   26 (84)
                      ..||.|..|.+.|..+
T Consensus       194 ~IPF~C~iCKkdy~sp  209 (259)
T COG5152         194 KIPFLCGICKKDYESP  209 (259)
T ss_pred             CCceeehhchhhccch
Confidence            4699999999988766


No 272
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.58  E-value=29  Score=20.22  Aligned_cols=24  Identities=17%  Similarity=0.375  Sum_probs=16.4

Q ss_pred             CCCeecCCCCccccChhhHHHHHH
Q psy10072         11 EKPYKCTFCPFTAAHSSTMSYHLR   34 (84)
Q Consensus        11 ~k~~~c~~C~~~f~~~~~l~~h~~   34 (84)
                      ++...|++|+..|.....+....+
T Consensus        17 kk~ieCPvC~tkFkkeev~tgsiR   40 (267)
T COG1655          17 KKTIECPVCNTKFKKEEVKTGSIR   40 (267)
T ss_pred             hceeccCcccchhhhhheecccee
Confidence            456899999998876654443333


No 273
>KOG2747|consensus
Probab=27.15  E-value=43  Score=21.10  Aligned_cols=24  Identities=17%  Similarity=0.404  Sum_probs=21.3

Q ss_pred             eeCCCCccccccchHHHHHHhhhC
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERRH   64 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~~   64 (84)
                      |.|..|.+-+.....|.+|+....
T Consensus       159 YiCEfCLkY~~s~~~l~rH~~kC~  182 (396)
T KOG2747|consen  159 YICEFCLKYMKSRTSLQRHLKKCK  182 (396)
T ss_pred             EEehHHHhHhchHHHHHHHHHhcC
Confidence            899999999999999999987644


No 274
>PF06170 DUF983:  Protein of unknown function (DUF983);  InterPro: IPR009325 This family consists of several bacterial proteins of unknown function.
Probab=27.09  E-value=27  Score=16.79  Aligned_cols=12  Identities=33%  Similarity=1.043  Sum_probs=8.0

Q ss_pred             eeCCCCcccccc
Q psy10072         41 VKCPHCAYKCVK   52 (84)
Q Consensus        41 ~~c~~C~~~f~~   52 (84)
                      -+|+.||..|..
T Consensus         9 ~~C~~CG~d~~~   20 (86)
T PF06170_consen    9 PRCPHCGLDYSH   20 (86)
T ss_pred             CcccccCCcccc
Confidence            467778776653


No 275
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=27.04  E-value=72  Score=14.14  Aligned_cols=9  Identities=44%  Similarity=1.088  Sum_probs=2.6

Q ss_pred             eCCCCcccc
Q psy10072         42 KCPHCAYKC   50 (84)
Q Consensus        42 ~c~~C~~~f   50 (84)
                      .|+.|++.+
T Consensus         4 ~CP~C~k~~   12 (57)
T PF03884_consen    4 KCPICGKPV   12 (57)
T ss_dssp             E-TTT--EE
T ss_pred             cCCCCCCee
Confidence            344444433


No 276
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=26.82  E-value=76  Score=19.84  Aligned_cols=22  Identities=18%  Similarity=0.351  Sum_probs=12.4

Q ss_pred             eeCCCCccccccchHHHHHHhh
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIER   62 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~   62 (84)
                      ..|..|...|-..+.|..|++.
T Consensus       221 P~C~FC~~~FYdDDEL~~HcR~  242 (493)
T COG5236         221 PLCIFCKIYFYDDDELRRHCRL  242 (493)
T ss_pred             chhhhccceecChHHHHHHHHh
Confidence            3555555555555556555554


No 277
>PLN03239 histone acetyltransferase; Provisional
Probab=26.79  E-value=48  Score=20.54  Aligned_cols=22  Identities=9%  Similarity=0.099  Sum_probs=19.6

Q ss_pred             eeCCCCccccccchHHHHHHhh
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIER   62 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~   62 (84)
                      |.|..|.+-|.....|.+|+..
T Consensus       107 YiCE~Clky~~~~~~l~~H~~~  128 (351)
T PLN03239        107 YVCEFSFGFFARKSELLRFQAK  128 (351)
T ss_pred             EEeccchhhhcCHHHHHHHHHh
Confidence            9999999999999999999753


No 278
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=26.49  E-value=67  Score=13.65  Aligned_cols=12  Identities=33%  Similarity=1.007  Sum_probs=8.7

Q ss_pred             eeCCCCcccccc
Q psy10072         41 VKCPHCAYKCVK   52 (84)
Q Consensus        41 ~~c~~C~~~f~~   52 (84)
                      ..|+.|+..|-.
T Consensus        41 v~C~~C~~~fC~   52 (64)
T smart00647       41 VTCPKCGFSFCF   52 (64)
T ss_pred             eECCCCCCeECC
Confidence            788888877653


No 279
>KOG0801|consensus
Probab=26.34  E-value=32  Score=18.89  Aligned_cols=11  Identities=27%  Similarity=0.673  Sum_probs=8.2

Q ss_pred             eecCCCCcccc
Q psy10072         14 YKCTFCPFTAA   24 (84)
Q Consensus        14 ~~c~~C~~~f~   24 (84)
                      ++|++|.+...
T Consensus       139 ~KCPvC~K~V~  149 (205)
T KOG0801|consen  139 MKCPVCHKVVP  149 (205)
T ss_pred             ccCCccccccC
Confidence            67888887654


No 280
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=26.22  E-value=89  Score=19.69  Aligned_cols=36  Identities=31%  Similarity=0.625  Sum_probs=22.3

Q ss_pred             hcCCCCeecCCCCccccChhhHHHHHHhcCCceeeCCCCcccc
Q psy10072          8 HTGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKC   50 (84)
Q Consensus         8 h~~~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f   50 (84)
                      +.....-.|++|+.....+       ....++...|+.|+...
T Consensus         8 ~~~~~~~~C~~Cd~l~~~~-------~l~~g~~a~CpRCg~~L   43 (403)
T TIGR00155         8 HPAAKHILCSQCDMLVALP-------RIESGQKAACPRCGTTL   43 (403)
T ss_pred             CCCCCeeeCCCCCCccccc-------CCCCCCeeECCCCCCCC
Confidence            4444555699999765433       12234457899998654


No 281
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=26.09  E-value=1e+02  Score=16.65  Aligned_cols=35  Identities=17%  Similarity=0.463  Sum_probs=19.8

Q ss_pred             CeecCCCCccccChhhHHHHHHhcCCceeeCCCCcccc
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKC   50 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f   50 (84)
                      ...|..|++.+.......   .........|+.|+...
T Consensus       105 ~~~C~~C~~~~~~~~~~~---~~~~~~~~~C~~C~~~l  139 (178)
T PF02146_consen  105 RLRCSKCGKEYDREDIVD---SIDEEEPPRCPKCGGLL  139 (178)
T ss_dssp             EEEETTTSBEEEGHHHHH---HHHTTSSCBCTTTSCBE
T ss_pred             eeeecCCCccccchhhcc---cccccccccccccCccC
Confidence            467888988776543211   11222225788887643


No 282
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=25.72  E-value=39  Score=17.87  Aligned_cols=49  Identities=18%  Similarity=0.272  Sum_probs=27.8

Q ss_pred             hhhcCCCCeecCCCCccccChhhHHHHH------------H-hcCCce-eeCCCCccccccch
Q psy10072          6 RTHTGEKPYKCTFCPFTAAHSSTMSYHL------------R-IHQDLK-VKCPHCAYKCVKQK   54 (84)
Q Consensus         6 ~~h~~~k~~~c~~C~~~f~~~~~l~~h~------------~-~~~~~~-~~c~~C~~~f~~~~   54 (84)
                      ..-...+.|+|..|..+......|..-.            . +..... ..|+.|.-.|...+
T Consensus        73 nvF~d~~lYeCnIC~etS~ee~FLKPneCCgY~iCn~Cya~LWK~~~~ypvCPvCkTSFKss~  135 (140)
T PF05290_consen   73 NVFLDPKLYECNICKETSAEERFLKPNECCGYSICNACYANLWKFCNLYPVCPVCKTSFKSSS  135 (140)
T ss_pred             eeecCCCceeccCcccccchhhcCCcccccchHHHHHHHHHHHHHcccCCCCCcccccccccc
Confidence            3446668899999987765544432110            0 111123 47888877776543


No 283
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=25.65  E-value=27  Score=12.44  Aligned_cols=6  Identities=33%  Similarity=0.894  Sum_probs=3.1

Q ss_pred             cCCCCc
Q psy10072         16 CTFCPF   21 (84)
Q Consensus        16 c~~C~~   21 (84)
                      |+.||.
T Consensus        19 C~~CG~   24 (26)
T PF13248_consen   19 CPNCGA   24 (26)
T ss_pred             ChhhCC
Confidence            555553


No 284
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=25.60  E-value=37  Score=12.57  Aligned_cols=10  Identities=30%  Similarity=0.783  Sum_probs=6.3

Q ss_pred             eecCCCCccc
Q psy10072         14 YKCTFCPFTA   23 (84)
Q Consensus        14 ~~c~~C~~~f   23 (84)
                      |.|..|+..+
T Consensus        28 f~C~~C~~~L   37 (39)
T smart00132       28 FKCSKCGKPL   37 (39)
T ss_pred             CCCcccCCcC
Confidence            5677776654


No 285
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=25.45  E-value=49  Score=13.64  Aligned_cols=31  Identities=16%  Similarity=0.401  Sum_probs=18.5

Q ss_pred             ecCCCCccccChhhHHHHHHhcCCc-eeeCCCCccccccc
Q psy10072         15 KCTFCPFTAAHSSTMSYHLRIHQDL-KVKCPHCAYKCVKQ   53 (84)
Q Consensus        15 ~c~~C~~~f~~~~~l~~h~~~~~~~-~~~c~~C~~~f~~~   53 (84)
                      .|+.||.......        .... .+.|+.|+..+...
T Consensus         2 FCp~Cg~~l~~~~--------~~~~~~~vC~~Cg~~~~~~   33 (52)
T smart00661        2 FCPKCGNMLIPKE--------GKEKRRFVCRKCGYEEPIE   33 (52)
T ss_pred             CCCCCCCcccccc--------CCCCCEEECCcCCCeEECC
Confidence            4788886442221        1122 38999999876543


No 286
>PRK07591 threonine synthase; Validated
Probab=25.30  E-value=57  Score=20.49  Aligned_cols=12  Identities=25%  Similarity=0.459  Sum_probs=8.7

Q ss_pred             CeecCCCCcccc
Q psy10072         13 PYKCTFCPFTAA   24 (84)
Q Consensus        13 ~~~c~~C~~~f~   24 (84)
                      -+.|..|++.|.
T Consensus        18 ~l~C~~Cg~~~~   29 (421)
T PRK07591         18 ALKCRECGAEYP   29 (421)
T ss_pred             EEEeCCCCCcCC
Confidence            367888887765


No 287
>PF14375 Cys_rich_CWC:  Cysteine-rich CWC
Probab=25.17  E-value=45  Score=14.04  Aligned_cols=7  Identities=14%  Similarity=0.111  Sum_probs=2.8

Q ss_pred             CCCCccc
Q psy10072         17 TFCPFTA   23 (84)
Q Consensus        17 ~~C~~~f   23 (84)
                      +.|+..|
T Consensus         2 P~Cg~~f    8 (50)
T PF14375_consen    2 PRCGAPF    8 (50)
T ss_pred             CCCCCcC
Confidence            3444433


No 288
>PRK06260 threonine synthase; Validated
Probab=25.16  E-value=68  Score=19.92  Aligned_cols=10  Identities=30%  Similarity=0.484  Sum_probs=5.2

Q ss_pred             eecCCCCccc
Q psy10072         14 YKCTFCPFTA   23 (84)
Q Consensus        14 ~~c~~C~~~f   23 (84)
                      +.|..|+..|
T Consensus         4 ~~C~~cg~~~   13 (397)
T PRK06260          4 LKCIECGKEY   13 (397)
T ss_pred             EEECCCCCCC
Confidence            4555555544


No 289
>PRK11032 hypothetical protein; Provisional
Probab=24.62  E-value=26  Score=19.06  Aligned_cols=27  Identities=22%  Similarity=0.536  Sum_probs=15.9

Q ss_pred             CeecCCCCccccChhhHHHHHHhcCCceeeCCCCcc
Q psy10072         13 PYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAY   48 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~   48 (84)
                      ...|..||.....         .+++....|+.|+.
T Consensus       124 ~LvC~~Cg~~~~~---------~~p~~i~pCp~C~~  150 (160)
T PRK11032        124 NLVCEKCHHHLAF---------YTPEVLPLCPKCGH  150 (160)
T ss_pred             eEEecCCCCEEEe---------cCCCcCCCCCCCCC
Confidence            4778888854211         12233368888875


No 290
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=24.52  E-value=25  Score=23.93  Aligned_cols=8  Identities=38%  Similarity=1.173  Sum_probs=5.2

Q ss_pred             eeCCCCcc
Q psy10072         41 VKCPHCAY   48 (84)
Q Consensus        41 ~~c~~C~~   48 (84)
                      ..|+.|+-
T Consensus       476 ~~Cp~Cgs  483 (730)
T COG1198         476 QSCPECGS  483 (730)
T ss_pred             CCCCCCCC
Confidence            56777764


No 291
>KOG1702|consensus
Probab=24.37  E-value=33  Score=19.62  Aligned_cols=33  Identities=15%  Similarity=0.213  Sum_probs=16.7

Q ss_pred             ecCCCCccccChhhHHHHHHhcCCceeeCCCCc
Q psy10072         15 KCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCA   47 (84)
Q Consensus        15 ~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~   47 (84)
                      .|..||+....-..+..-........|+|..|+
T Consensus         6 n~~~cgk~vYPvE~v~cldk~whk~cfkce~c~   38 (264)
T KOG1702|consen    6 NREDCGKTVYPVEEVKCLDKVWHKQCFKCEVCG   38 (264)
T ss_pred             hhhhhccccccHHHHhhHHHHHHHHhheeeecc
Confidence            455666654433334433344444446666665


No 292
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=24.28  E-value=38  Score=14.67  Aligned_cols=12  Identities=17%  Similarity=0.534  Sum_probs=8.4

Q ss_pred             ecCCCCccccCh
Q psy10072         15 KCTFCPFTAAHS   26 (84)
Q Consensus        15 ~c~~C~~~f~~~   26 (84)
                      .|+.||..+...
T Consensus         2 ~CPyCge~~~~~   13 (52)
T PF14255_consen    2 QCPYCGEPIEIL   13 (52)
T ss_pred             CCCCCCCeeEEE
Confidence            588888776543


No 293
>PF04161 Arv1:  Arv1-like family ;  InterPro: IPR007290 Arv1 is a transmembrane protein, with potential zinc-binding motifs, that mediates sterol homeostasis. Its action is important in lipid homeostasis, which prevents free sterol toxicity []. Arv1 contains a homology domain (AHD), which consists of an N-terminal cysteine-rich subdomain with a putative zinc-binding motif, followed by a C-terminal subdomain of 33 amino acids. The C-terminal subdomain of the AHD is critical for the protein's function []. In yeast, Arv1p is important for the delivery of an early glycosylphosphatidylinositol GPI intermediate, GlcN-acylPI, to the first mannosyltransferase of GPI synthesis in the ER lumen []. It is important for the traffic of sterol in yeast and in humans. In eukaryotic cells, it may fuction in the sphingolipid metabolic pathway as a transporter of ceramides between the ER and Golgi []. 
Probab=24.16  E-value=56  Score=18.38  Aligned_cols=31  Identities=19%  Similarity=0.465  Sum_probs=16.2

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCce-eeCCCCcc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAY   48 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~   48 (84)
                      +.|.+||.....-.  .+.  .....+ -.|+.|++
T Consensus         1 miCIeCg~~v~~Ly--~~Y--s~~~irLt~C~~C~~   32 (208)
T PF04161_consen    1 MICIECGHPVKSLY--RQY--SPGNIRLTKCPNCGK   32 (208)
T ss_pred             CEeccCCCcchhhh--hcc--CCCcEEEeeccccCC
Confidence            36888886632211  111  122234 68888876


No 294
>PF12773 DZR:  Double zinc ribbon
Probab=23.92  E-value=44  Score=13.73  Aligned_cols=9  Identities=33%  Similarity=1.017  Sum_probs=6.1

Q ss_pred             eeCCCCccc
Q psy10072         41 VKCPHCAYK   49 (84)
Q Consensus        41 ~~c~~C~~~   49 (84)
                      ..|+.|+..
T Consensus        30 ~~C~~Cg~~   38 (50)
T PF12773_consen   30 KICPNCGAE   38 (50)
T ss_pred             CCCcCCcCC
Confidence            567777764


No 295
>PLN02748 tRNA dimethylallyltransferase
Probab=23.83  E-value=69  Score=20.69  Aligned_cols=23  Identities=17%  Similarity=0.326  Sum_probs=13.7

Q ss_pred             CCeecCCCCc-cccChhhHHHHHH
Q psy10072         12 KPYKCTFCPF-TAAHSSTMSYHLR   34 (84)
Q Consensus        12 k~~~c~~C~~-~f~~~~~l~~h~~   34 (84)
                      +.|.|..|++ ++........|+.
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlk  440 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQ  440 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhc
Confidence            3456777775 5655555555554


No 296
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=23.65  E-value=26  Score=19.85  Aligned_cols=29  Identities=10%  Similarity=0.224  Sum_probs=0.0

Q ss_pred             eeCCCCccccccchHHHHHHhhhCCCCChh
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERRHMPGDVL   70 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~   70 (84)
                      ..|+.||.... .+.+..||++.....-|.
T Consensus       169 ~~cPitGe~IP-~~e~~eHmRi~LlDP~wk  197 (229)
T PF12230_consen  169 IICPITGEMIP-ADEMDEHMRIELLDPRWK  197 (229)
T ss_dssp             ------------------------------
T ss_pred             ccccccccccc-cccccccccccccccccc
Confidence            57777776554 334667776655444443


No 297
>PF03145 Sina:  Seven in absentia protein family;  InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila. The Drosophila Sina protein is essential for the determination of the R7 pathway in photoreceptor cell development: the loss of functional Sina results in the transformation of the R7 precursor cell to a non-neuronal cell type. The Sina protein contains an N-terminal RING finger domain C3HC4-type. Through this domain, Sina binds E2 ubiquitin-conjugating enzymes (UbcD1) Sina also interacts with Tramtrack (TTK88) via PHYL. Tramtrack is a transcriptional repressor that blocks photoreceptor determination, while PHYL down-regulates the activity of TTK88. In turn, the activity of PHYL requires the activation of the Sevenless receptor tyrosine kinase, a process essential for R7 determination. It is thought that Sina targets TTK88 for degradation, therefore promoting the R7 pathway. Murine and human homologues of Sina have also been identified. The human homologue Siah-1 [] also binds E2 enzymes (UbcH5) and through a series of physical interactions, targets beta-catenin for ubiquitin degradation. Siah-1 expression is enhanced by p53, itself promoted by DNA damage. Thus this pathway links DNA damage to beta-catenin degradation [, ]. Sina proteins, therefore, physically interact with a variety of proteins. The N-terminal RING finger domain that binds ubiquitin conjugating enzymes is a C3HC4-type, and does not form part of the alignment for this family. The remainder C-terminal part is involved in interactions with other proteins, and is included in this alignment. In addition to the Drosophila protein and mammalian homologues, whose similarity was noted previously, this family also includes putative homologues from Caenorhabditis elegans, Arabidopsis thaliana.; GO: 0006511 ubiquitin-dependent protein catabolic process, 0007275 multicellular organismal development, 0005634 nucleus; PDB: 2A25_A 1K2F_B 2AN6_C.
Probab=23.58  E-value=1.4e+02  Score=16.44  Aligned_cols=52  Identities=23%  Similarity=0.377  Sum_probs=27.8

Q ss_pred             CeecCC----CCccccChhhHHHHHHhcCCceeeCCC----CccccccchHHHHHHhhhCCC
Q psy10072         13 PYKCTF----CPFTAAHSSTMSYHLRIHQDLKVKCPH----CAYKCVKQKDLNTHIERRHMP   66 (84)
Q Consensus        13 ~~~c~~----C~~~f~~~~~l~~h~~~~~~~~~~c~~----C~~~f~~~~~l~~H~~~~~~~   66 (84)
                      .+.|+.    |...+... ....|.....-.++.|+.    |+-.- ....|..|....|..
T Consensus        14 ~~pC~~~~~GC~~~~~~~-~~~~HE~~C~~~p~~CP~~~~~C~~~G-~~~~l~~Hl~~~H~~   73 (198)
T PF03145_consen   14 KFPCKNAKYGCTETFPYS-EKREHEEECPFRPCSCPFPGSGCDWQG-SYKELLDHLRDKHSW   73 (198)
T ss_dssp             -EE-CCGGGT---EE-GG-GHHHHHHT-TTSEEE-SSSSTT---EE-ECCCHHHHHHHHTTT
T ss_pred             eecCCCCCCCCccccccc-ChhhHhccCCCcCCcCCCCCCCccccC-CHHHHHHHHHHHCCC
Confidence            466765    77665544 567888877777788877    44322 345688898876654


No 298
>PRK14138 NAD-dependent deacetylase; Provisional
Probab=23.50  E-value=1.1e+02  Score=17.67  Aligned_cols=34  Identities=15%  Similarity=0.430  Sum_probs=18.4

Q ss_pred             CCeecCCCCccccChhhHHHHHHhcCCceeeCCCCcc
Q psy10072         12 KPYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAY   48 (84)
Q Consensus        12 k~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~   48 (84)
                      ....|..|++.+.......   .........|+.|+-
T Consensus       118 ~~~~C~~C~~~~~~~~~~~---~~~~~~~p~Cp~Cgg  151 (244)
T PRK14138        118 EEYYCVRCGKRYTVEDVIE---KLEKSDVPRCDDCSG  151 (244)
T ss_pred             CeeEECCCCCcccHHHHHH---HHhcCCCCCCCCCCC
Confidence            4467888988776543322   111111256888863


No 299
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=23.45  E-value=35  Score=15.46  Aligned_cols=8  Identities=50%  Similarity=1.348  Sum_probs=4.6

Q ss_pred             eeCCCCcc
Q psy10072         41 VKCPHCAY   48 (84)
Q Consensus        41 ~~c~~C~~   48 (84)
                      |.|+.|+.
T Consensus         1 y~C~KCg~    8 (64)
T PF09855_consen    1 YKCPKCGN    8 (64)
T ss_pred             CCCCCCCC
Confidence            45666654


No 300
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]
Probab=23.41  E-value=57  Score=20.30  Aligned_cols=8  Identities=38%  Similarity=1.161  Sum_probs=4.4

Q ss_pred             CeecCCCC
Q psy10072         13 PYKCTFCP   20 (84)
Q Consensus        13 ~~~c~~C~   20 (84)
                      +|.|..||
T Consensus       354 ~YRC~~CG  361 (389)
T COG2956         354 RYRCQNCG  361 (389)
T ss_pred             CceecccC
Confidence            35555555


No 301
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.27  E-value=51  Score=15.05  Aligned_cols=12  Identities=17%  Similarity=0.384  Sum_probs=8.8

Q ss_pred             eecCCCCccccC
Q psy10072         14 YKCTFCPFTAAH   25 (84)
Q Consensus        14 ~~c~~C~~~f~~   25 (84)
                      -.|+.|++....
T Consensus         8 v~CP~Cgkpv~w   19 (65)
T COG3024           8 VPCPTCGKPVVW   19 (65)
T ss_pred             ccCCCCCCcccc
Confidence            468999887554


No 302
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=23.20  E-value=47  Score=20.35  Aligned_cols=23  Identities=17%  Similarity=0.300  Sum_probs=15.3

Q ss_pred             eeCCCCccccccchHHHHHHhhh
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERR   63 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~   63 (84)
                      |+|+.|...|...-....|...|
T Consensus       389 Y~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         389 YQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             eechhhhhhhhhhhHHHHHHHHh
Confidence            77777777777666666665444


No 303
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The Sir2 homolog from the archaea Sulfolobus solftaricus deacetylates the non-specific DNA protein Alba to mediate transcription repression.
Probab=22.32  E-value=1.2e+02  Score=17.25  Aligned_cols=33  Identities=15%  Similarity=0.335  Sum_probs=18.0

Q ss_pred             CCeecCCCCccccChhhHHHHHHhcCCceeeCCCCcc
Q psy10072         12 KPYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAY   48 (84)
Q Consensus        12 k~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~   48 (84)
                      ....|..|+..+..... .   .........|+.|+.
T Consensus       112 ~~~~C~~C~~~~~~~~~-~---~~~~~~~p~C~~Cgg  144 (222)
T cd01413         112 QTAYCVNCGSKYDLEEV-K---YAKKHEVPRCPKCGG  144 (222)
T ss_pred             CcceECCCCCCcchhHH-H---HhccCCCCcCCCCCC
Confidence            44678889887765432 1   111112257888864


No 304
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=22.16  E-value=14  Score=21.72  Aligned_cols=9  Identities=22%  Similarity=0.475  Sum_probs=4.0

Q ss_pred             eecCCCCcc
Q psy10072         14 YKCTFCPFT   22 (84)
Q Consensus        14 ~~c~~C~~~   22 (84)
                      -.|++||..
T Consensus       173 g~CPvCGs~  181 (290)
T PF04216_consen  173 GYCPVCGSP  181 (290)
T ss_dssp             SS-TTT---
T ss_pred             CcCCCCCCc
Confidence            379999964


No 305
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=22.14  E-value=84  Score=18.38  Aligned_cols=9  Identities=44%  Similarity=0.929  Sum_probs=7.4

Q ss_pred             eeCCCCccc
Q psy10072         41 VKCPHCAYK   49 (84)
Q Consensus        41 ~~c~~C~~~   49 (84)
                      ..|+.||+-
T Consensus       222 v~CP~CgRI  230 (239)
T COG1579         222 VFCPYCGRI  230 (239)
T ss_pred             ccCCccchH
Confidence            789999873


No 306
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=21.96  E-value=63  Score=15.78  Aligned_cols=17  Identities=18%  Similarity=0.548  Sum_probs=12.8

Q ss_pred             eecCCCCccccChhhHH
Q psy10072         14 YKCTFCPFTAAHSSTMS   30 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~   30 (84)
                      ..|+.||..|.....+.
T Consensus        36 ~~C~~CGe~y~~dev~~   52 (89)
T TIGR03829        36 ISCSHCGMEYQDDTTVK   52 (89)
T ss_pred             ccccCCCcEeecHHHHH
Confidence            56999999887776544


No 307
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=21.95  E-value=64  Score=14.51  Aligned_cols=15  Identities=20%  Similarity=0.458  Sum_probs=9.8

Q ss_pred             CeecCCCCccccChh
Q psy10072         13 PYKCTFCPFTAAHSS   27 (84)
Q Consensus        13 ~~~c~~C~~~f~~~~   27 (84)
                      |-+|-.||+......
T Consensus         4 PVRCFTCGkvi~~~~   18 (60)
T PF01194_consen    4 PVRCFTCGKVIGNKW   18 (60)
T ss_dssp             SSS-STTTSBTCGHH
T ss_pred             ceecCCCCCChhHhH
Confidence            667888888766543


No 308
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=21.69  E-value=31  Score=19.46  Aligned_cols=21  Identities=24%  Similarity=0.547  Sum_probs=0.0

Q ss_pred             eeCCCCcc-ccccchHHHHHHh
Q psy10072         41 VKCPHCAY-KCVKQKDLNTHIE   61 (84)
Q Consensus        41 ~~c~~C~~-~f~~~~~l~~H~~   61 (84)
                      |.|..||- .|.=+..+.+|-.
T Consensus       102 y~CEICGN~~Y~GrkaFekHF~  123 (196)
T PF11931_consen  102 YKCEICGNQSYKGRKAFEKHFQ  123 (196)
T ss_dssp             ----------------------
T ss_pred             eeeEeCCCcceecHHHHHHhcC
Confidence            88888874 5555666666643


No 309
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=21.65  E-value=42  Score=14.65  Aligned_cols=19  Identities=26%  Similarity=0.466  Sum_probs=14.5

Q ss_pred             eeCCCCccccccchHHHHH
Q psy10072         41 VKCPHCAYKCVKQKDLNTH   59 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H   59 (84)
                      +-|..|+..|.....|..+
T Consensus        28 ~YC~~Cg~~Y~d~~dL~~~   46 (55)
T PF13821_consen   28 NYCFWCGTKYDDEEDLERN   46 (55)
T ss_pred             ceeeeeCCccCCHHHHHhC
Confidence            6788899888887776543


No 310
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=21.49  E-value=59  Score=19.07  Aligned_cols=36  Identities=22%  Similarity=0.404  Sum_probs=20.0

Q ss_pred             CCCCeecCCCCccccChhhHHHHHHhcCCceeeCCCCcc
Q psy10072         10 GEKPYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAY   48 (84)
Q Consensus        10 ~~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~   48 (84)
                      .-..+.|..|+..+..... ..  ....+....|+.|+.
T Consensus       119 sl~~~~C~~C~~~~~~~~~-~~--~~~~~~~p~C~~Cg~  154 (250)
T COG0846         119 SLKRVRCSKCGNQYYDEDV-IK--FIEDGLIPRCPKCGG  154 (250)
T ss_pred             ceeeeEeCCCcCccchhhh-hh--hcccCCCCcCccCCC
Confidence            3456788999877764431 11  111122267888876


No 311
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=21.15  E-value=1.9e+02  Score=18.26  Aligned_cols=24  Identities=21%  Similarity=0.447  Sum_probs=12.1

Q ss_pred             cCCce-eeCCCCc-cccccchHHHHH
Q psy10072         36 HQDLK-VKCPHCA-YKCVKQKDLNTH   59 (84)
Q Consensus        36 ~~~~~-~~c~~C~-~~f~~~~~l~~H   59 (84)
                      |.-.+ |.|..|+ +++.-...+-+|
T Consensus       369 hgLd~ef~CEICgNyvy~GR~~FdrH  394 (470)
T COG5188         369 HGLDIEFECEICGNYVYYGRDRFDRH  394 (470)
T ss_pred             cCCCcceeeeecccccccchHHHHhh
Confidence            44334 6666666 444444444444


No 312
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=21.03  E-value=64  Score=14.74  Aligned_cols=11  Identities=9%  Similarity=0.102  Sum_probs=6.4

Q ss_pred             eecCCCCcccc
Q psy10072         14 YKCTFCPFTAA   24 (84)
Q Consensus        14 ~~c~~C~~~f~   24 (84)
                      ..++-|++.|.
T Consensus        11 ~~~~cC~~~y~   21 (71)
T PF05495_consen   11 IRFPCCGKYYP   21 (71)
T ss_dssp             EEETTTTEEES
T ss_pred             EECCcccCeec
Confidence            45566666554


No 313
>PF11238 DUF3039:  Protein of unknown function (DUF3039);  InterPro: IPR021400  This family of proteins with unknown function appears to be restricted to Actinobacteria. 
Probab=20.96  E-value=28  Score=15.52  Aligned_cols=10  Identities=30%  Similarity=0.727  Sum_probs=4.9

Q ss_pred             eeCCCCcccc
Q psy10072         41 VKCPHCAYKC   50 (84)
Q Consensus        41 ~~c~~C~~~f   50 (84)
                      ..|+.|...|
T Consensus        45 PVCP~Ck~iy   54 (58)
T PF11238_consen   45 PVCPECKEIY   54 (58)
T ss_pred             CCCcCHHHHH
Confidence            3555555443


No 314
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=20.86  E-value=68  Score=11.77  Aligned_cols=7  Identities=29%  Similarity=1.132  Sum_probs=4.1

Q ss_pred             eeCCCCc
Q psy10072         41 VKCPHCA   47 (84)
Q Consensus        41 ~~c~~C~   47 (84)
                      |.|..|.
T Consensus        16 Y~C~~c~   22 (30)
T PF03107_consen   16 YHCSECC   22 (30)
T ss_pred             EEeCCCC
Confidence            5665555


No 315
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=20.83  E-value=19  Score=21.32  Aligned_cols=17  Identities=41%  Similarity=1.081  Sum_probs=9.0

Q ss_pred             eeCCCCccccccchHHH
Q psy10072         41 VKCPHCAYKCVKQKDLN   57 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~   57 (84)
                      +.|+.|+........|.
T Consensus       210 ~PCPKCg~et~eTkdLS  226 (314)
T PF06524_consen  210 IPCPKCGYETQETKDLS  226 (314)
T ss_pred             CCCCCCCCcccccccce
Confidence            56666665544444433


No 316
>COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics]
Probab=20.65  E-value=67  Score=20.07  Aligned_cols=24  Identities=21%  Similarity=0.281  Sum_probs=21.2

Q ss_pred             eeCCCCccccccchHHHHHHhhhC
Q psy10072         41 VKCPHCAYKCVKQKDLNTHIERRH   64 (84)
Q Consensus        41 ~~c~~C~~~f~~~~~l~~H~~~~~   64 (84)
                      |.|..|.+.|.....|.+|+....
T Consensus       159 yICefClkY~~s~~~~~rH~~kC~  182 (395)
T COG5027         159 YICEFCLKYYGSQTSLVRHRKKCS  182 (395)
T ss_pred             EEhhhhHHHhcchhHHHHHHhcCc
Confidence            899999999999999999987643


No 317
>PF01844 HNH:  HNH endonuclease;  InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ]. This family includes pyocins, colicins and anaredoxins.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity; PDB: 2QGP_C.
Probab=20.53  E-value=47  Score=13.17  Aligned_cols=10  Identities=20%  Similarity=0.843  Sum_probs=2.4

Q ss_pred             cCCCCccccC
Q psy10072         16 CTFCPFTAAH   25 (84)
Q Consensus        16 c~~C~~~f~~   25 (84)
                      |..|++.+..
T Consensus         1 C~~C~~~~~~   10 (47)
T PF01844_consen    1 CQYCGKPGSD   10 (47)
T ss_dssp             -TTT--B--G
T ss_pred             CCCCCCcCcc
Confidence            4455554433


No 318
>KOG3214|consensus
Probab=20.45  E-value=60  Score=16.29  Aligned_cols=40  Identities=23%  Similarity=0.505  Sum_probs=21.1

Q ss_pred             CCCeecCCCCccccChhhHHHHHHhcCCceeeCCCCccccccc
Q psy10072         11 EKPYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCVKQ   53 (84)
Q Consensus        11 ~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~f~~~   53 (84)
                      +..|.|+.|.---...-.+.   +.+.-....|..|+..|...
T Consensus        21 dt~FnClfcnHek~v~~~~D---k~~~iG~~sC~iC~esFqt~   60 (109)
T KOG3214|consen   21 DTQFNCLFCNHEKSVSCTLD---KKHNIGKASCRICEESFQTT   60 (109)
T ss_pred             heeeccCccccccceeeeeh---hhcCcceeeeeehhhhhccc
Confidence            34577888864321111111   11222226899999888754


No 319
>PRK08270 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=20.41  E-value=68  Score=21.67  Aligned_cols=8  Identities=38%  Similarity=0.991  Sum_probs=5.2

Q ss_pred             eeCCCCcc
Q psy10072         41 VKCPHCAY   48 (84)
Q Consensus        41 ~~c~~C~~   48 (84)
                      +.|+.||.
T Consensus       640 ~~CP~CG~  647 (656)
T PRK08270        640 EFCPKCGE  647 (656)
T ss_pred             CCCcCCcC
Confidence            66777764


No 320
>PRK12366 replication factor A; Reviewed
Probab=20.19  E-value=73  Score=21.41  Aligned_cols=25  Identities=24%  Similarity=0.495  Sum_probs=16.0

Q ss_pred             eecCCCCccccChhhHHHHHHhcCCceeeCCCCccc
Q psy10072         14 YKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYK   49 (84)
Q Consensus        14 ~~c~~C~~~f~~~~~l~~h~~~~~~~~~~c~~C~~~   49 (84)
                      ..|+.|++....           ....|.|+.|++.
T Consensus       533 ~aCp~CnkKv~~-----------~~g~~~C~~c~~~  557 (637)
T PRK12366        533 YLCPNCRKRVEE-----------VDGEYICEFCGEV  557 (637)
T ss_pred             ecccccCeEeEc-----------CCCcEECCCCCCC
Confidence            468888776431           1123899999875


Done!