Query         psy10074
Match_columns 420
No_of_seqs    211 out of 2516
Neff          10.3
Searched_HMMs 46136
Date          Fri Aug 16 17:17:01 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10074.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10074hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1074|consensus              100.0 1.5E-28 3.3E-33  233.1   8.5  206  169-405   603-934 (958)
  2 KOG3608|consensus               99.9 3.6E-27 7.9E-32  202.7   8.9  229  125-404   135-379 (467)
  3 KOG2462|consensus               99.9 5.8E-26 1.3E-30  190.9   5.9  135  255-398   127-264 (279)
  4 KOG2462|consensus               99.9 2.3E-25 4.9E-30  187.3   4.5  130  284-419   127-256 (279)
  5 KOG3608|consensus               99.9 2.4E-24 5.3E-29  185.4   9.2  238  171-418    69-364 (467)
  6 KOG1074|consensus               99.9 1.1E-24 2.3E-29  207.2   4.1  109  259-369   606-730 (958)
  7 KOG3623|consensus               99.9   3E-22 6.4E-27  187.5   8.8  111   13-137   209-322 (1007)
  8 KOG3623|consensus               99.8 3.5E-21 7.6E-26  180.4   5.3   68  349-418   895-962 (1007)
  9 KOG3576|consensus               99.6 8.5E-17 1.8E-21  128.6   1.3  118  283-405   113-240 (267)
 10 KOG3576|consensus               99.5 1.8E-15   4E-20  121.0   2.4  125  119-282   112-236 (267)
 11 PLN03086 PRLI-interacting fact  99.2 3.4E-11 7.4E-16  115.0   6.0  136  258-419   407-554 (567)
 12 PLN03086 PRLI-interacting fact  99.1 2.1E-10 4.6E-15  109.6   7.9  121  258-402   433-565 (567)
 13 PHA00733 hypothetical protein   99.0 1.7E-10 3.7E-15   89.8   3.5   82  318-402    38-124 (128)
 14 PHA00733 hypothetical protein   98.9 2.4E-09 5.2E-14   83.4   5.4   85  283-373    36-124 (128)
 15 PHA02768 hypothetical protein;  98.7 1.1E-08 2.3E-13   65.1   1.9   44  348-394     5-48  (55)
 16 KOG3993|consensus               98.7 4.6E-09 9.9E-14   94.1   0.0  145  257-404   266-485 (500)
 17 KOG3993|consensus               98.6 9.3E-09   2E-13   92.1   1.6  202  169-374   265-484 (500)
 18 PHA02768 hypothetical protein;  98.6 2.1E-08 4.6E-13   63.8   1.5   44  320-365     5-48  (55)
 19 KOG1146|consensus               98.4 2.2E-07 4.7E-12   95.1   3.3   93   13-114   464-613 (1406)
 20 PF13465 zf-H2C2_2:  Zinc-finge  98.3 2.8E-07   6E-12   50.0   1.9   24  364-388     2-25  (26)
 21 PF13465 zf-H2C2_2:  Zinc-finge  98.3 4.9E-07 1.1E-11   49.0   2.2   24  336-359     2-25  (26)
 22 PF05605 zf-Di19:  Drought indu  98.2 9.8E-07 2.1E-11   57.6   3.1   52  348-402     2-54  (54)
 23 PHA00732 hypothetical protein   98.1 1.8E-06   4E-11   60.7   2.7   44  348-397     1-44  (79)
 24 PHA00616 hypothetical protein   98.0 1.8E-06   4E-11   52.2   1.3   21  349-369     2-22  (44)
 25 PHA00732 hypothetical protein   97.9 6.8E-06 1.5E-10   57.8   2.0   39  377-418     1-39  (79)
 26 PF05605 zf-Di19:  Drought indu  97.9 1.3E-05 2.9E-10   52.3   3.1   49  321-372     3-53  (54)
 27 PHA00616 hypothetical protein   97.9 7.1E-06 1.5E-10   49.6   1.6   37  171-207     1-37  (44)
 28 KOG1146|consensus               97.7 1.4E-05   3E-10   82.3   1.4   87   17-113   439-541 (1406)
 29 PF00096 zf-C2H2:  Zinc finger,  97.6 5.9E-05 1.3E-09   39.5   2.3   22  172-193     1-22  (23)
 30 PF00096 zf-C2H2:  Zinc finger,  97.5 8.3E-05 1.8E-09   39.0   1.9   21  349-369     1-21  (23)
 31 PF12756 zf-C2H2_2:  C2H2 type   97.4 0.00012 2.6E-09   55.0   2.6   71  290-370     2-72  (100)
 32 PF13894 zf-C2H2_4:  C2H2-type   97.4 0.00018 3.9E-09   38.0   2.5   21  349-369     1-21  (24)
 33 PF12756 zf-C2H2_2:  C2H2 type   97.3 8.2E-05 1.8E-09   55.9   1.3   75  322-402     1-75  (100)
 34 PF13894 zf-C2H2_4:  C2H2-type   97.3 0.00021 4.7E-09   37.7   2.2   23  172-194     1-23  (24)
 35 PF13912 zf-C2H2_6:  C2H2-type   97.2 0.00018 3.9E-09   39.3   1.2   20  378-397     2-21  (27)
 36 COG5189 SFP1 Putative transcri  97.0 0.00029 6.3E-09   61.4   1.7   55  345-399   346-420 (423)
 37 PF13912 zf-C2H2_6:  C2H2-type   96.9 0.00075 1.6E-08   36.8   2.2   23  200-222     2-24  (27)
 38 COG5189 SFP1 Putative transcri  96.9 0.00034 7.3E-09   61.1   0.8   72  284-369   346-419 (423)
 39 PF09237 GAGA:  GAGA factor;  I  96.2  0.0013 2.7E-08   40.8   0.1   28  346-373    22-49  (54)
 40 PF13909 zf-H2C2_5:  C2H2-type   96.2  0.0038 8.3E-08   32.9   1.9   23  200-223     1-23  (24)
 41 COG5236 Uncharacterized conser  96.1  0.0037   8E-08   55.4   2.4  137   50-225   151-307 (493)
 42 smart00355 ZnF_C2H2 zinc finge  96.0  0.0061 1.3E-07   32.5   2.3   23  172-194     1-23  (26)
 43 PF09237 GAGA:  GAGA factor;  I  96.0  0.0057 1.2E-07   38.0   2.3   31  318-348    22-52  (54)
 44 PF13909 zf-H2C2_5:  C2H2-type   96.0  0.0063 1.4E-07   32.0   2.2   24  172-196     1-24  (24)
 45 smart00355 ZnF_C2H2 zinc finge  96.0   0.007 1.5E-07   32.2   2.3   20  350-369     2-21  (26)
 46 KOG2231|consensus               95.8  0.0064 1.4E-07   59.9   2.8  134   52-220   117-260 (669)
 47 KOG2482|consensus               95.7   0.015 3.3E-07   51.6   4.6   55  139-193   147-217 (423)
 48 PF12874 zf-met:  Zinc-finger o  95.7  0.0066 1.4E-07   32.3   1.5   20  173-192     2-21  (25)
 49 PF12874 zf-met:  Zinc-finger o  95.7   0.009 1.9E-07   31.8   2.0   23  200-222     1-23  (25)
 50 KOG2482|consensus               95.6   0.019 4.1E-07   51.0   4.6  155  245-399   131-356 (423)
 51 KOG2785|consensus               95.5   0.045 9.8E-07   49.7   6.8   53  348-400   166-243 (390)
 52 PF12171 zf-C2H2_jaz:  Zinc-fin  95.2   0.017 3.6E-07   31.4   2.0   22  378-399     2-23  (27)
 53 PF12171 zf-C2H2_jaz:  Zinc-fin  95.0   0.018 3.9E-07   31.3   1.7   22  321-342     2-23  (27)
 54 PRK04860 hypothetical protein;  94.6   0.029 6.3E-07   45.6   2.7   36  348-388   119-154 (160)
 55 KOG2231|consensus               94.5   0.051 1.1E-06   53.8   4.7  112  260-384   117-245 (669)
 56 PRK04860 hypothetical protein;  94.5   0.034 7.4E-07   45.2   2.9   39  170-212   118-156 (160)
 57 KOG4173|consensus               94.2   0.012 2.5E-07   48.4  -0.3   79  286-372    78-170 (253)
 58 KOG2785|consensus               93.6    0.13 2.8E-06   46.9   5.0   25  169-193    66-90  (390)
 59 KOG2893|consensus               92.7   0.053 1.2E-06   45.7   1.2   46   17-74     13-59  (341)
 60 COG5048 FOG: Zn-finger [Genera  92.6   0.072 1.6E-06   51.6   2.3   61   14-82    289-355 (467)
 61 PF13913 zf-C2HC_2:  zinc-finge  92.5    0.11 2.4E-06   27.5   1.9   20  349-369     3-22  (25)
 62 PF12013 DUF3505:  Protein of u  92.1    0.16 3.5E-06   38.6   3.2   25  378-402    81-109 (109)
 63 COG5236 Uncharacterized conser  91.9    0.48   1E-05   42.5   6.1  139   93-253   157-305 (493)
 64 KOG4173|consensus               91.8    0.07 1.5E-06   44.0   0.9   84  257-344    78-170 (253)
 65 PF13913 zf-C2HC_2:  zinc-finge  91.3    0.19 4.2E-06   26.6   2.0   18  173-191     4-21  (25)
 66 cd00350 rubredoxin_like Rubred  90.5    0.19   4E-06   28.8   1.6   10  321-330     2-11  (33)
 67 smart00451 ZnF_U1 U1-like zinc  89.8    0.24 5.1E-06   28.6   1.7   22  348-369     3-24  (35)
 68 smart00451 ZnF_U1 U1-like zinc  89.7    0.28 6.1E-06   28.3   2.0   23  320-342     3-25  (35)
 69 TIGR00622 ssl1 transcription f  89.1    0.66 1.4E-05   34.8   3.9   21  257-277    14-34  (112)
 70 KOG2893|consensus               89.1    0.13 2.8E-06   43.4   0.2   46  351-401    13-58  (341)
 71 COG4049 Uncharacterized protei  88.4    0.13 2.9E-06   32.5  -0.1   26  377-402    17-42  (65)
 72 COG4049 Uncharacterized protei  87.6     0.3 6.5E-06   30.9   1.1   30  344-373    13-42  (65)
 73 PF12013 DUF3505:  Protein of u  86.9     1.3 2.7E-05   33.7   4.5   27  347-373    79-109 (109)
 74 COG5048 FOG: Zn-finger [Genera  86.7    0.25 5.5E-06   47.8   0.7   64  170-233   288-357 (467)
 75 TIGR00622 ssl1 transcription f  84.9     1.3 2.8E-05   33.3   3.5   24  171-194    81-104 (112)
 76 cd00729 rubredoxin_SM Rubredox  83.3    0.85 1.8E-05   26.2   1.5   10  349-358     3-12  (34)
 77 TIGR02098 MJ0042_CXXC MJ0042 f  82.1     1.1 2.3E-05   26.5   1.8    8  351-358     5-12  (38)
 78 PF09986 DUF2225:  Uncharacteri  81.7    0.52 1.1E-05   40.6   0.4   13  349-361    49-61  (214)
 79 COG5151 SSL1 RNA polymerase II  81.4     3.5 7.6E-05   36.6   5.3   96   77-194   307-411 (421)
 80 PF09986 DUF2225:  Uncharacteri  81.1    0.32   7E-06   41.9  -1.1   12  378-389    49-60  (214)
 81 PF09538 FYDLN_acid:  Protein o  80.6    0.87 1.9E-05   34.3   1.2   14  347-360    25-38  (108)
 82 COG2888 Predicted Zn-ribbon RN  79.3     1.3 2.9E-05   28.7   1.5    8  377-384    50-57  (61)
 83 PF10571 UPF0547:  Uncharacteri  77.8     1.3 2.9E-05   23.6   1.0   11  172-182    15-25  (26)
 84 PF13719 zinc_ribbon_5:  zinc-r  76.9       2 4.4E-05   25.2   1.8    6  379-384    27-32  (37)
 85 PHA00626 hypothetical protein   74.9     1.7 3.6E-05   27.8   1.0   12  171-182    23-34  (59)
 86 TIGR00373 conserved hypothetic  74.8     2.7 5.9E-05   34.2   2.6   16  321-336   110-125 (158)
 87 smart00834 CxxC_CXXC_SSSS Puta  73.8     1.3 2.8E-05   26.6   0.4   12   15-26      6-17  (41)
 88 PF02892 zf-BED:  BED zinc fing  73.5     1.2 2.7E-05   27.3   0.3   23  347-369    15-41  (45)
 89 PF09538 FYDLN_acid:  Protein o  72.9     1.8 3.9E-05   32.6   1.1   30  349-390    10-39  (108)
 90 PF09723 Zn-ribbon_8:  Zinc rib  72.6     1.4   3E-05   26.8   0.3   12   15-26      6-17  (42)
 91 PF12907 zf-met2:  Zinc-binding  72.5     1.4 2.9E-05   26.4   0.3   25  379-403     3-30  (40)
 92 smart00531 TFIIE Transcription  72.0     4.3 9.4E-05   32.7   3.2   13  320-332    99-111 (147)
 93 PRK14890 putative Zn-ribbon RN  71.8     1.9 4.1E-05   28.1   0.8   10  376-385    47-56  (59)
 94 KOG2186|consensus               71.3     1.8 3.8E-05   37.4   0.8   46   15-71      4-49  (276)
 95 PF12907 zf-met2:  Zinc-binding  70.7     2.2 4.9E-05   25.5   0.9   32  349-380     2-36  (40)
 96 smart00734 ZnF_Rad18 Rad18-lik  69.8     4.5 9.8E-05   21.6   1.9   19  350-369     3-21  (26)
 97 TIGR02605 CxxC_CxxC_SSSS putat  69.6     1.8   4E-05   27.6   0.4   12   15-26      6-17  (52)
 98 PRK00464 nrdR transcriptional   69.5     1.1 2.4E-05   36.2  -0.8   23   49-71     27-49  (154)
 99 PRK00398 rpoP DNA-directed RNA  68.7     1.9 4.1E-05   26.7   0.3   13   14-26      3-15  (46)
100 PF02176 zf-TRAF:  TRAF-type zi  68.5     3.6 7.9E-05   27.0   1.7   46  171-217     9-59  (60)
101 PRK06266 transcription initiat  68.4     4.1   9E-05   33.9   2.4   17  320-336   117-133 (178)
102 PRK00464 nrdR transcriptional   67.9     1.6 3.4E-05   35.3  -0.2   18  321-338    29-46  (154)
103 PF06524 NOA36:  NOA36 protein;  67.4     3.1 6.8E-05   36.0   1.4   82   47-137   139-222 (314)
104 TIGR00373 conserved hypothetic  66.3     3.5 7.6E-05   33.6   1.5   34  344-387   105-138 (158)
105 smart00659 RPOLCX RNA polymera  65.4     5.1 0.00011   24.6   1.7   27  171-208     2-28  (44)
106 smart00531 TFIIE Transcription  64.7     3.2 6.9E-05   33.4   1.0   12   15-26    100-111 (147)
107 TIGR02300 FYDLN_acid conserved  63.7     4.1 8.9E-05   31.3   1.3   13  347-359    25-37  (129)
108 PF05290 Baculo_IE-1:  Baculovi  62.8       6 0.00013   30.6   2.1   55  318-391    78-135 (140)
109 PRK06266 transcription initiat  62.1     4.3 9.4E-05   33.8   1.4   15  348-362   117-131 (178)
110 COG1592 Rubrerythrin [Energy p  62.0     5.4 0.00012   32.6   1.8   24  320-356   134-157 (166)
111 PRK09678 DNA-binding transcrip  61.3     1.9 4.1E-05   29.7  -0.8   44   15-68      2-47  (72)
112 COG1997 RPL43A Ribosomal prote  61.0     4.2 9.2E-05   28.8   0.9   32   13-62     34-65  (89)
113 COG1198 PriA Primosomal protei  60.7     5.4 0.00012   41.0   1.9   49  125-208   436-484 (730)
114 PF04959 ARS2:  Arsenite-resist  58.7     3.2 6.9E-05   35.5   0.0   25  378-402    78-102 (214)
115 smart00614 ZnF_BED BED zinc fi  58.5     9.6 0.00021   24.0   2.2   23  350-372    20-47  (50)
116 PF14803 Nudix_N_2:  Nudix N-te  58.4     4.4 9.5E-05   23.3   0.5   10  171-180    22-31  (34)
117 KOG2272|consensus               58.0      19  0.0004   31.2   4.4   16   88-103    98-113 (332)
118 PF00301 Rubredoxin:  Rubredoxi  57.0     6.6 0.00014   24.5   1.2   11  288-298     2-12  (47)
119 COG1996 RPC10 DNA-directed RNA  56.9     7.4 0.00016   24.4   1.4   11  320-330     6-16  (49)
120 PF13240 zinc_ribbon_2:  zinc-r  56.1     6.9 0.00015   20.2   1.0    6  174-179    16-21  (23)
121 PF08274 PhnA_Zn_Ribbon:  PhnA   55.2     5.7 0.00012   22.1   0.6    9  348-356    19-27  (30)
122 COG5151 SSL1 RNA polymerase II  54.3      11 0.00024   33.6   2.6   20  348-367   388-407 (421)
123 TIGR02300 FYDLN_acid conserved  53.7     7.2 0.00016   30.0   1.2   33  349-393    10-42  (129)
124 PF13878 zf-C2H2_3:  zinc-finge  53.6      13 0.00029   22.3   2.1   25  171-195    13-39  (41)
125 PF13248 zf-ribbon_3:  zinc-rib  53.5       8 0.00017   20.5   1.0    7  126-132     4-10  (26)
126 KOG4124|consensus               52.2     5.2 0.00011   36.3   0.3  117  284-401   175-422 (442)
127 KOG2593|consensus               51.9     6.9 0.00015   36.8   1.0   35   50-87    128-162 (436)
128 KOG2272|consensus               51.6      15 0.00033   31.7   2.9   20  193-212   215-234 (332)
129 PF06524 NOA36:  NOA36 protein;  51.3     5.5 0.00012   34.6   0.2   18  119-136    33-50  (314)
130 COG1592 Rubrerythrin [Energy p  51.1     9.5 0.00021   31.2   1.6   25  171-208   134-158 (166)
131 cd00730 rubredoxin Rubredoxin;  49.4     8.9 0.00019   24.3   0.9    9  289-297     3-11  (50)
132 KOG2186|consensus               49.0      14 0.00031   32.0   2.4   50  171-223     3-52  (276)
133 PF14353 CpXC:  CpXC protein     48.1     3.1 6.7E-05   32.6  -1.6   22   50-71     38-59  (128)
134 PRK14714 DNA polymerase II lar  46.6      17 0.00037   39.4   2.9   22  125-146   668-689 (1337)
135 KOG2807|consensus               46.2      23  0.0005   32.0   3.3   20  348-367   345-364 (378)
136 smart00154 ZnF_AN1 AN1-like Zi  45.0     8.8 0.00019   22.8   0.4   15  406-420    12-26  (39)
137 PF08271 TF_Zn_Ribbon:  TFIIB z  44.6     9.5 0.00021   23.2   0.5   15   47-61     16-30  (43)
138 PRK00432 30S ribosomal protein  43.6      11 0.00024   23.9   0.7   13   49-61     36-48  (50)
139 PF04959 ARS2:  Arsenite-resist  43.5      18 0.00039   31.0   2.2   26  348-373    77-102 (214)
140 PF07754 DUF1610:  Domain of un  43.4      13 0.00028   19.5   0.8    8  348-355    16-23  (24)
141 PF03604 DNA_RNApol_7kD:  DNA d  41.9      11 0.00024   21.3   0.4   10  171-180    17-26  (32)
142 KOG2593|consensus               41.5      21 0.00046   33.7   2.5   17  347-363   127-143 (436)
143 TIGR00595 priA primosomal prot  41.0      16 0.00036   36.1   1.8   49  125-208   214-262 (505)
144 COG4306 Uncharacterized protei  38.9      20 0.00043   27.3   1.5   39  378-416    40-78  (160)
145 COG4896 Uncharacterized protei  38.9      16 0.00034   23.9   0.9   39   16-62      4-43  (68)
146 PF04810 zf-Sec23_Sec24:  Sec23  38.3      17 0.00037   21.7   0.9   32   14-59      2-33  (40)
147 KOG1280|consensus               38.3      22 0.00048   32.4   2.0   40  345-384    76-116 (381)
148 PF08790 zf-LYAR:  LYAR-type C2  38.0      13 0.00028   20.3   0.3    9   52-60      2-10  (28)
149 PTZ00255 60S ribosomal protein  38.0     6.3 0.00014   28.4  -1.2   14   48-61     52-65  (90)
150 PF03811 Zn_Tnp_IS1:  InsA N-te  37.0     7.3 0.00016   22.7  -0.8   15   42-56     21-35  (36)
151 PF15269 zf-C2H2_7:  Zinc-finge  36.7      26 0.00057   21.3   1.5   21  200-220    21-41  (54)
152 PF01927 Mut7-C:  Mut7-C RNAse   35.6      23 0.00051   28.4   1.6   10  172-181   125-134 (147)
153 PF04780 DUF629:  Protein of un  35.5      27 0.00058   33.8   2.2   29  347-375    56-84  (466)
154 COG4888 Uncharacterized Zn rib  34.9     9.4  0.0002   27.9  -0.7   11  407-417    47-57  (104)
155 KOG1701|consensus               34.5     9.8 0.00021   35.7  -0.8   47   50-103   302-348 (468)
156 PF05443 ROS_MUCR:  ROS/MUCR tr  34.4      16 0.00035   28.6   0.5   28   48-78     70-97  (132)
157 smart00661 RPOL9 RNA polymeras  33.8      23  0.0005   22.3   1.1   12  171-182    20-31  (52)
158 PF01428 zf-AN1:  AN1-like Zinc  33.7      11 0.00025   22.9  -0.4   15  406-420    13-27  (43)
159 KOG4167|consensus               33.6      12 0.00025   37.8  -0.5   28   48-75    790-817 (907)
160 KOG1280|consensus               33.6      37 0.00079   31.1   2.6   38  318-355    77-116 (381)
161 PF05495 zf-CHY:  CHY zinc fing  33.5      17 0.00037   25.0   0.5    8  289-296    12-19  (71)
162 TIGR01206 lysW lysine biosynth  33.3      21 0.00045   23.1   0.8    8  350-357    24-31  (54)
163 KOG2907|consensus               32.8      21 0.00047   26.7   0.9   11  378-388   103-113 (116)
164 PF01363 FYVE:  FYVE zinc finge  32.6      18  0.0004   24.5   0.5    9  350-358    11-19  (69)
165 COG0068 HypF Hydrogenase matur  32.5      14 0.00031   37.3  -0.1   79   90-207   102-181 (750)
166 COG4530 Uncharacterized protei  32.5      22 0.00048   26.4   0.9   12  376-387    25-36  (129)
167 PRK03564 formate dehydrogenase  32.3      32  0.0007   31.4   2.1   14  344-357   208-221 (309)
168 PRK14873 primosome assembly pr  32.2      24 0.00051   36.3   1.4   46  125-206   384-429 (665)
169 PF05129 Elf1:  Transcription e  32.0     8.9 0.00019   27.2  -1.2   14   49-62     45-58  (81)
170 COG3091 SprT Zn-dependent meta  31.9      18 0.00038   28.9   0.3   34   13-59    116-149 (156)
171 PF09845 DUF2072:  Zn-ribbon co  31.6      31 0.00066   26.9   1.6    9  351-359     4-12  (131)
172 PF04780 DUF629:  Protein of un  31.4      20 0.00042   34.7   0.6   33  372-404    52-84  (466)
173 COG3364 Zn-ribbon containing p  31.2      25 0.00055   25.8   1.0   13   14-26      2-14  (112)
174 PRK14714 DNA polymerase II lar  30.9      32  0.0007   37.4   2.1   11  378-388  1254-1264(1337)
175 PF12773 DZR:  Double zinc ribb  30.7      35 0.00077   21.3   1.5    9  172-180    30-38  (50)
176 PRK04023 DNA polymerase II lar  30.3      39 0.00085   35.9   2.5   23  125-147   652-674 (1121)
177 PF04606 Ogr_Delta:  Ogr/Delta-  30.2     9.6 0.00021   23.7  -1.1   19   48-66     23-43  (47)
178 KOG2807|consensus               29.7      70  0.0015   29.1   3.6   19  171-189   290-308 (378)
179 PF08209 Sgf11:  Sgf11 (transcr  29.2      58  0.0012   18.6   2.0   21  348-369     4-24  (33)
180 COG1655 Uncharacterized protei  29.0      17 0.00036   31.2  -0.3   39  319-357    18-71  (267)
181 PF07975 C1_4:  TFIIH C1-like d  28.3      36 0.00078   21.7   1.2   24  320-343    21-44  (51)
182 PF07649 C1_3:  C1-like domain;  28.2      31 0.00067   18.9   0.8   11  171-181    15-25  (30)
183 PF13453 zf-TFIIB:  Transcripti  28.1      35 0.00075   20.4   1.1   18  171-188    19-36  (41)
184 KOG1044|consensus               28.0      30 0.00065   34.0   1.2   37   13-59     15-51  (670)
185 PRK12496 hypothetical protein;  27.9      29 0.00063   28.5   1.0   22  125-146   128-153 (164)
186 PF07503 zf-HYPF:  HypF finger;  27.6      45 0.00098   19.3   1.4   31   92-135     2-32  (35)
187 PRK14892 putative transcriptio  27.4      19 0.00041   26.6  -0.2   12  378-389    43-54  (99)
188 PRK05580 primosome assembly pr  27.4      36 0.00077   35.3   1.7   49  125-208   382-430 (679)
189 PRK14559 putative protein seri  26.9      38 0.00082   34.6   1.7   22  127-148    30-53  (645)
190 PRK03824 hypA hydrogenase nick  26.8      32  0.0007   27.1   1.0   11  288-298    71-81  (135)
191 TIGR03826 YvyF flagellar opero  26.5      18 0.00039   28.6  -0.4   21  126-146     5-28  (137)
192 PF13824 zf-Mss51:  Zinc-finger  26.4      32 0.00069   22.3   0.7   12  171-182    14-25  (55)
193 PF05191 ADK_lid:  Adenylate ki  26.3      38 0.00083   19.7   1.0    9  322-330     3-11  (36)
194 PF14446 Prok-RING_1:  Prokaryo  26.1      33 0.00073   22.1   0.8    9  126-134     7-15  (54)
195 TIGR01562 FdhE formate dehydro  25.9      51  0.0011   30.1   2.2   14  344-357   206-219 (305)
196 PF13451 zf-trcl:  Probable zin  25.4      46   0.001   21.0   1.3   16  348-363     4-19  (49)
197 PF07282 OrfB_Zn_ribbon:  Putat  25.4      52  0.0011   22.2   1.7    9  349-357    47-55  (69)
198 PF01096 TFIIS_C:  Transcriptio  24.8     9.4  0.0002   22.7  -1.8    7  321-327    29-35  (39)
199 COG2331 Uncharacterized protei  24.6      32 0.00069   23.8   0.5   10  349-358    13-22  (82)
200 KOG1842|consensus               24.5      39 0.00085   32.1   1.2   24  321-344    16-39  (505)
201 cd00065 FYVE FYVE domain; Zinc  24.5      44 0.00095   21.4   1.2   27  350-389     4-30  (57)
202 PF08792 A2L_zn_ribbon:  A2L zi  24.3      27 0.00058   19.9   0.1   10  125-134    22-31  (33)
203 KOG4167|consensus               24.0      23  0.0005   35.8  -0.3   26  199-224   792-817 (907)
204 PF09963 DUF2197:  Uncharacteri  23.7      35 0.00075   22.2   0.5   13   47-59     28-40  (56)
205 smart00064 FYVE Protein presen  23.7      44 0.00095   22.5   1.1   28  349-389    11-38  (68)
206 COG1998 RPS31 Ribosomal protei  23.6      34 0.00073   21.5   0.4   11   49-59     36-46  (51)
207 PF01780 Ribosomal_L37ae:  Ribo  22.3      24 0.00053   25.5  -0.4   12  348-359    53-64  (90)
208 PF04438 zf-HIT:  HIT zinc fing  22.0      29 0.00062   19.3  -0.1   18   81-98      5-22  (30)
209 TIGR00280 L37a ribosomal prote  21.9      35 0.00075   24.7   0.3   12  348-359    53-64  (91)
210 COG0068 HypF Hydrogenase matur  21.7      36 0.00078   34.6   0.5   60   51-134   124-183 (750)
211 COG1773 Rubredoxin [Energy pro  21.5      34 0.00074   22.1   0.2   14   50-63      3-16  (55)
212 TIGR00244 transcriptional regu  21.3      22 0.00048   28.3  -0.9   22   48-69     26-47  (147)
213 COG1327 Predicted transcriptio  20.8      24 0.00052   28.1  -0.7   22   48-69     26-47  (156)
214 PF14311 DUF4379:  Domain of un  20.7      80  0.0017   20.2   1.8   12  349-360    29-40  (55)
215 COG1656 Uncharacterized conser  20.7      63  0.0014   26.3   1.6   11  200-210   131-141 (165)
216 PRK04023 DNA polymerase II lar  20.7      66  0.0014   34.3   2.1   22  124-145   626-647 (1121)
217 PRK12380 hydrogenase nickel in  20.6      56  0.0012   24.9   1.2   11  321-331    71-81  (113)
218 TIGR00100 hypA hydrogenase nic  20.4      53  0.0012   25.1   1.1   11  321-331    71-81  (115)
219 KOG3408|consensus               20.3      71  0.0015   24.4   1.6   23  199-221    57-79  (129)
220 KOG0717|consensus               20.2      45 0.00097   32.0   0.8   19   15-34    293-311 (508)
221 PF10083 DUF2321:  Uncharacteri  20.0      36 0.00077   27.3   0.1   52  126-184    30-81  (158)

No 1  
>KOG1074|consensus
Probab=99.95  E-value=1.5e-28  Score=233.15  Aligned_cols=206  Identities=27%  Similarity=0.482  Sum_probs=149.8

Q ss_pred             CcceeccccCccccChhHHHHHHHHhcCCCceecccccccccCHHHHHHHHhhccCCCcceeceeecccccChHHHHHHH
Q psy10074        169 SYRYVCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIYCAYRCTQKSDLKKHLRKKHEVKHCFVNIVMNSYGTNIKKCMKRH  248 (420)
Q Consensus       169 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~c~~c~~~~~~~~~~~l~~h  248 (420)
                      ..+.+|-+|.++..-+..|+.|.++|+|++||+|.+|++.|+++.+|+.||-+|....+                     
T Consensus       603 TdPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~---------------------  661 (958)
T KOG1074|consen  603 TDPNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPP---------------------  661 (958)
T ss_pred             CCccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCcc---------------------
Confidence            34678999999999999999999999999999999999999999999999987654332                     


Q ss_pred             HhhhhcCccccccc---ccccccCChHHHHhchhhcCCCC-C------------CccCCccchhccChhHHhhhhhcccC
Q psy10074        249 VERIHLNITKTRCE---LCDLRFFDKVGLKMHVMRKHTGE-K------------PFHCHYCDYICRTKYDLSSHIGRKHT  312 (420)
Q Consensus       249 ~~~~~~~~~~~~C~---~C~~~f~~~~~l~~H~~~~H~~~-~------------~~~C~~C~~~f~~~~~l~~H~~~~H~  312 (420)
                            -...+.|+   +|.+.|.+...|..| .++|.+. .            .-+|..|.+.|.....+..++ ..|.
T Consensus       662 ------~R~q~ScP~~~ic~~kftn~V~lpQh-IriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~-se~~  733 (958)
T KOG1074|consen  662 ------ARVQFSCPSTFICQKKFTNAVTLPQH-IRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQI-SEQP  733 (958)
T ss_pred             ------ccccccCCchhhhcccccccccccce-EEeecCCCCCCCcccccccchhcccchhhhcccccccchhhh-hccC
Confidence                  22456677   788888888778887 5666521 1            135777777777777776663 3332


Q ss_pred             Ccc------------cccC----ceecCCCCCccCChHHHhhhhhhhc-----------------------CC-------
Q psy10074        313 DKE------------VLEK----RYVCQLCPKQFLTSGELKYHQTTVH-----------------------RK-------  346 (420)
Q Consensus       313 ~~~------------~~~~----~~~C~~C~~~f~~~~~l~~H~~~h~-----------------------~~-------  346 (420)
                      ...            ..+.    +..+..|+..+.....+..+-..+.                       ++       
T Consensus       734 ~~~s~~~~~~~~~t~t~~~~~tp~~~e~~~~~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~  813 (958)
T KOG1074|consen  734 SPESEPDEQMDERTETEELDVTPPPPENSCGRELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASS  813 (958)
T ss_pred             CcccCCcccccccccccccccCCCccccccccccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCccccc
Confidence            100            0011    3444555555544444333322110                       00       


Q ss_pred             ----------------------------------------------------------------cceecCcCCccccChh
Q psy10074        347 ----------------------------------------------------------------RVHECSECGFTFFLEK  362 (420)
Q Consensus       347 ----------------------------------------------------------------~~~~C~~C~~~f~~~~  362 (420)
                                                                                      ....|..||+.|...+
T Consensus       814 ~~~~~~~~~v~~~pvl~~~~~~~l~eg~~t~~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSs  893 (958)
T KOG1074|consen  814 FPGEILAPSVNMDPVLWNQETSMLNEGLATKTNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSA  893 (958)
T ss_pred             CCCcCCccccccCchhhcccccccccccccccccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchH
Confidence                                                                            1167999999999999


Q ss_pred             hHHHHHHhhcCCCCCcccCcCccccCCHHHHHccccccccCCC
Q psy10074        363 TLRAHIRETHRKETPFPCPFCEYKAKRKFELKSHMKRKHTFED  405 (420)
Q Consensus       363 ~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~  405 (420)
                      .|..|++ .|++++||.|..|++.|..+.+|+.||. .|.+..
T Consensus       894 ALqiH~r-THtg~KPF~C~fC~~aFttrgnLKvHMg-tH~w~q  934 (958)
T KOG1074|consen  894 ALEIHMR-THTGPKPFFCHFCEEAFTTRGNLKVHMG-THMWVQ  934 (958)
T ss_pred             HHHHhhh-cCCCCCCccchhhhhhhhhhhhhhhhhc-cccccC
Confidence            9999999 9999999999999999999999999995 665443


No 2  
>KOG3608|consensus
Probab=99.94  E-value=3.6e-27  Score=202.72  Aligned_cols=229  Identities=25%  Similarity=0.477  Sum_probs=196.0

Q ss_pred             ccc--ccccCCCCCccccccccccCCchhhhhhcccccccccCC-------CCC-ccee--ccccCccccChhHHHHHHH
Q psy10074        125 FVC--ILCNYHIPCKWCKYCKTKLDNNTEVLLQHCKLCVNVIRP-------DVS-YRYV--CFTCDYHSFCSSHMKDHIR  192 (420)
Q Consensus       125 ~~C--~~C~~~f~~~~c~~~~~~~~~~~~~l~~H~~~~h~~~~~-------~~~-~~~~--C~~C~~~f~~~~~l~~H~~  192 (420)
                      |.|  ..|+..|.+.             ..|..|+ ..|..-..       ..+ ..+.  ...|-+.+.++..|++|++
T Consensus       135 f~C~WedCe~~F~s~-------------~ef~dHV-~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~r  200 (467)
T KOG3608|consen  135 FRCGWEDCEREFVSI-------------VEFQDHV-VKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHIR  200 (467)
T ss_pred             hccChhhcCCcccCH-------------HHHHHHH-HHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHHH
Confidence            555  4588888888             8888887 66654311       111 1244  4579999999999999999


Q ss_pred             HhcCCCceecccccccccCHHHHHHHHhhccCCCcceeceeecccccChHHHHHHHHhhhhcCcccccccccccccCChH
Q psy10074        193 VHLGEKPYMCIYCAYRCTQKSDLKKHLRKKHEVKHCFVNIVMNSYGTNIKKCMKRHVERIHLNITKTRCELCDLRFFDKV  272 (420)
Q Consensus       193 ~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~c~~c~~~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~  272 (420)
                      .|.+++...|+.|+..|.++..|..|++.                             .......+|.|..|.+.|.+..
T Consensus       201 ~Hs~eKvvACp~Cg~~F~~~tkl~DH~rR-----------------------------qt~l~~n~fqC~~C~KrFaTek  251 (467)
T KOG3608|consen  201 THSNEKVVACPHCGELFRTKTKLFDHLRR-----------------------------QTELNTNSFQCAQCFKRFATEK  251 (467)
T ss_pred             hcCCCeEEecchHHHHhccccHHHHHHHh-----------------------------hhhhcCCchHHHHHHHHHhHHH
Confidence            99999999999999999999999999864                             2233345899999999999999


Q ss_pred             HHHhchhhcCCCCCCccCCccchhccChhHHhhhhhcccCCcccccCceecCCCCCccCChHHHhhhhhhhcCCcceecC
Q psy10074        273 GLKMHVMRKHTGEKPFHCHYCDYICRTKYDLSSHIGRKHTDKEVLEKRYVCQLCPKQFLTSGELKYHQTTVHRKRVHECS  352 (420)
Q Consensus       273 ~l~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~  352 (420)
                      .|..| ...|.+  -|+|+.|+.+....+.|.+||+..|+.    .+||+|+.|+..|.+.+.|.+|+..|. +-.|.|.
T Consensus       252 lL~~H-v~rHvn--~ykCplCdmtc~~~ssL~~H~r~rHs~----dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~  323 (467)
T KOG3608|consen  252 LLKSH-VVRHVN--CYKCPLCDMTCSSASSLTTHIRYRHSK----DKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCE  323 (467)
T ss_pred             HHHHH-HHHhhh--cccccccccCCCChHHHHHHHHhhhcc----CCCccccchhhhhccHHHHHHHHHhcc-ccceecC
Confidence            99999 566754  599999999999999999999999998    999999999999999999999999887 6789998


Q ss_pred             c--CCccccChhhHHHHHHhhcCCC--CCcccCcCccccCCHHHHHccccccccCC
Q psy10074        353 E--CGFTFFLEKTLRAHIRETHRKE--TPFPCPFCEYKAKRKFELKSHMKRKHTFE  404 (420)
Q Consensus       353 ~--C~~~f~~~~~L~~H~~~~H~~~--~~~~C~~C~~~f~~~~~l~~H~~~~H~~~  404 (420)
                      .  |.++|.+...|.+|++.+|.+.  .+|.|..|.+.|++-.+|..|+.+.|+-.
T Consensus       324 h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH~f~  379 (467)
T KOG3608|consen  324 HPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMKKHGFR  379 (467)
T ss_pred             CCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhccchhHHHHHHHhhccc
Confidence            8  9999999999999999888654  45999999999999999999999999754


No 3  
>KOG2462|consensus
Probab=99.92  E-value=5.8e-26  Score=190.86  Aligned_cols=135  Identities=29%  Similarity=0.522  Sum_probs=124.7

Q ss_pred             CcccccccccccccCChHHHHhchhhcCCC---CCCccCCccchhccChhHHhhhhhcccCCcccccCceecCCCCCccC
Q psy10074        255 NITKTRCELCDLRFFDKVGLKMHVMRKHTG---EKPFHCHYCDYICRTKYDLSSHIGRKHTDKEVLEKRYVCQLCPKQFL  331 (420)
Q Consensus       255 ~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~---~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~C~~C~~~f~  331 (420)
                      ....|+|+.||+.+.+...|.+| ++.|-.   .+.+.|++|++.+.+...|..|+ +.|.      -+.+|.+||+.|.
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrH-kQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHi-rTH~------l~c~C~iCGKaFS  198 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRH-KQTHRSLDSKKAFSCKYCGKVYVSMPALKMHI-RTHT------LPCECGICGKAFS  198 (279)
T ss_pred             cCCceeccccccccccccccchh-hcccccccccccccCCCCCceeeehHHHhhHh-hccC------CCccccccccccc
Confidence            34568999999999999999999 788864   56799999999999999999995 6664      3699999999999


Q ss_pred             ChHHHhhhhhhhcCCcceecCcCCccccChhhHHHHHHhhcCCCCCcccCcCccccCCHHHHHcccc
Q psy10074        332 TSGELKYHQTTVHRKRVHECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKRKFELKSHMK  398 (420)
Q Consensus       332 ~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~  398 (420)
                      ..+.|+.|+++|+|||||.|+.|+++|++++.|+.||+ .|++.++|+|+.|+++|..++.|.+|..
T Consensus       199 RPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQ-THS~~K~~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  199 RPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQ-THSDVKKHQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             chHHhhcccccccCCCCccCCcccchhcchHHHHHHHH-hhcCCccccCcchhhHHHHHHHHHHhhh
Confidence            99999999999999999999999999999999999999 9999999999999999999999999974


No 4  
>KOG2462|consensus
Probab=99.91  E-value=2.3e-25  Score=187.29  Aligned_cols=130  Identities=28%  Similarity=0.499  Sum_probs=121.2

Q ss_pred             CCCCccCCccchhccChhHHhhhhhcccCCcccccCceecCCCCCccCChHHHhhhhhhhcCCcceecCcCCccccChhh
Q psy10074        284 GEKPFHCHYCDYICRTKYDLSSHIGRKHTDKEVLEKRYVCQLCPKQFLTSGELKYHQTTVHRKRVHECSECGFTFFLEKT  363 (420)
Q Consensus       284 ~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~  363 (420)
                      ....|+|+.|++.+.+..+|.+| +..|...+. .+.+.|..|++.|.+..+|..|+++|.  -+.+|++||+.|.....
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrH-kQ~H~~~~s-~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWL  202 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRH-KQTHRSLDS-KKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWL  202 (279)
T ss_pred             cCCceeccccccccccccccchh-hcccccccc-cccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHH
Confidence            34569999999999999999999 788876544 778999999999999999999999997  68999999999999999


Q ss_pred             HHHHHHhhcCCCCCcccCcCccccCCHHHHHccccccccCCCCccccccchhhhcc
Q psy10074        364 LRAHIRETHRKETPFPCPFCEYKAKRKFELKSHMKRKHTFEDSLTTEETEYYKILE  419 (420)
Q Consensus       364 L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~~  419 (420)
                      |+-|+| .|+|++||.|+.|++.|.++++|+.|| +.|++.+.|+|..|++.|..+
T Consensus       203 LQGHiR-THTGEKPF~C~hC~kAFADRSNLRAHm-QTHS~~K~~qC~~C~KsFsl~  256 (279)
T KOG2462|consen  203 LQGHIR-THTGEKPFSCPHCGKAFADRSNLRAHM-QTHSDVKKHQCPRCGKSFALK  256 (279)
T ss_pred             hhcccc-cccCCCCccCCcccchhcchHHHHHHH-HhhcCCccccCcchhhHHHHH
Confidence            999999 999999999999999999999999999 999999999999999999854


No 5  
>KOG3608|consensus
Probab=99.91  E-value=2.4e-24  Score=185.41  Aligned_cols=238  Identities=22%  Similarity=0.390  Sum_probs=200.8

Q ss_pred             ceec--cccCccccC-hhHHHHHHHHhcC----------------------------------CCceeccc--ccccccC
Q psy10074        171 RYVC--FTCDYHSFC-SSHMKDHIRVHLG----------------------------------EKPYMCIY--CAYRCTQ  211 (420)
Q Consensus       171 ~~~C--~~C~~~f~~-~~~l~~H~~~h~~----------------------------------~~~~~C~~--C~~~f~~  211 (420)
                      .++|  ..|++...+ ...|.+|+-.|.=                                  ...|.|.+  |+..|.+
T Consensus        69 e~qC~w~~C~f~~~~~s~~l~RHvy~H~y~~~l~q~G~~al~~~~dig~c~~~f~~~~~ip~~g~~f~C~WedCe~~F~s  148 (467)
T KOG3608|consen   69 EHQCTWNSCDFRTENSSADLIRHVYFHCYHTKLKQQGKLALDLHPDIGACTAPFRLMEKIPALGQNFRCGWEDCEREFVS  148 (467)
T ss_pred             ceeEEeccCCccccchHHHHHhhhhhhhhHHHHHHHHHHHHhcCCCcCcccCCcchhhccccchhhhccChhhcCCcccC
Confidence            4566  468887776 5889999866520                                  01278866  9999999


Q ss_pred             HHHHHHHHhhccCC-------------CcceeceeecccccChHHHHHHHHhhhhcCcccccccccccccCChHHHHhch
Q psy10074        212 KSDLKKHLRKKHEV-------------KHCFVNIVMNSYGTNIKKCMKRHVERIHLNITKTRCELCDLRFFDKVGLKMHV  278 (420)
Q Consensus       212 ~~~l~~H~~~~h~~-------------~~~~c~~c~~~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~  278 (420)
                      ...+..|+..|.-.             ....|..-.+...+.++..|.+|+ +.|++++...|+.||..|.+...|..|.
T Consensus       149 ~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~-r~Hs~eKvvACp~Cg~~F~~~tkl~DH~  227 (467)
T KOG3608|consen  149 IVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHI-RTHSNEKVVACPHCGELFRTKTKLFDHL  227 (467)
T ss_pred             HHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHH-HhcCCCeEEecchHHHHhccccHHHHHH
Confidence            99999998766421             224566666688899999999999 9999999999999999999999999995


Q ss_pred             hh-cCCCCCCccCCccchhccChhHHhhhhhcccCCcccccCceecCCCCCccCChHHHhhhhhh-hcCCcceecCcCCc
Q psy10074        279 MR-KHTGEKPFHCHYCDYICRTKYDLSSHIGRKHTDKEVLEKRYVCQLCPKQFLTSGELKYHQTT-VHRKRVHECSECGF  356 (420)
Q Consensus       279 ~~-~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~  356 (420)
                      ++ .-.+..+|.|..|.+.|.+...|..|+.+ |      ...|+|++|+-+....++|..|++. |...+||+|+.|..
T Consensus       228 rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~r-H------vn~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~  300 (467)
T KOG3608|consen  228 RRQTELNTNSFQCAQCFKRFATEKLLKSHVVR-H------VNCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDT  300 (467)
T ss_pred             HhhhhhcCCchHHHHHHHHHhHHHHHHHHHHH-h------hhcccccccccCCCChHHHHHHHHhhhccCCCccccchhh
Confidence            43 22356789999999999999999999644 4      3469999999999999999999985 66889999999999


Q ss_pred             cccChhhHHHHHHhhcCCCCCcccCc--CccccCCHHHHHccccccccCC--CCccccccchhhhc
Q psy10074        357 TFFLEKTLRAHIRETHRKETPFPCPF--CEYKAKRKFELKSHMKRKHTFE--DSLTTEETEYYKIL  418 (420)
Q Consensus       357 ~f~~~~~L~~H~~~~H~~~~~~~C~~--C~~~f~~~~~l~~H~~~~H~~~--~~~~C~~C~~~f~~  418 (420)
                      .|.+.+.|.+|+. .|+ +..|+|..  |.++|....+|++|++.+|-|.  .+|.|..|++.||+
T Consensus       301 ~c~~esdL~kH~~-~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~  364 (467)
T KOG3608|consen  301 RCVRESDLAKHVQ-VHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTS  364 (467)
T ss_pred             hhccHHHHHHHHH-hcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhcc
Confidence            9999999999999 998 67799988  9999999999999999999664  45999999999985


No 6  
>KOG1074|consensus
Probab=99.90  E-value=1.1e-24  Score=207.23  Aligned_cols=109  Identities=29%  Similarity=0.554  Sum_probs=91.1

Q ss_pred             ccccccccccCChHHHHhchhhcCCCCCCccCCccchhccChhHHhhhhhcccCCcccccCceecC---CCCCccCChHH
Q psy10074        259 TRCELCDLRFFDKVGLKMHVMRKHTGEKPFHCHYCDYICRTKYDLSSHIGRKHTDKEVLEKRYVCQ---LCPKQFLTSGE  335 (420)
Q Consensus       259 ~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~C~---~C~~~f~~~~~  335 (420)
                      ..|-+|.++..-...|+.| ++.|+|++||+|.+|++.|.++.+|+.|+ ..|........++.|+   +|-+.|+..-.
T Consensus       606 NqCiiC~rVlSC~saLqmH-yrtHtGERPFkCKiCgRAFtTkGNLkaH~-~vHka~p~~R~q~ScP~~~ic~~kftn~V~  683 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMH-YRTHTGERPFKCKICGRAFTTKGNLKAHM-SVHKAKPPARVQFSCPSTFICQKKFTNAVT  683 (958)
T ss_pred             cceeeeeecccchhhhhhh-hhcccCcCccccccccchhccccchhhcc-cccccCccccccccCCchhhhccccccccc
Confidence            6799999999999999999 79999999999999999999999999994 7777655445679999   99999999999


Q ss_pred             HhhhhhhhcCC-c------------ceecCcCCccccChhhHHHHHH
Q psy10074        336 LKYHQTTVHRK-R------------VHECSECGFTFFLEKTLRAHIR  369 (420)
Q Consensus       336 l~~H~~~h~~~-~------------~~~C~~C~~~f~~~~~L~~H~~  369 (420)
                      |..|+++|.+. .            .=+|..|.+.|.....+..++.
T Consensus       684 lpQhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~s  730 (958)
T KOG1074|consen  684 LPQHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQIS  730 (958)
T ss_pred             ccceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhh
Confidence            99999999832 1            1357777777766555555544


No 7  
>KOG3623|consensus
Probab=99.87  E-value=3e-22  Score=187.49  Aligned_cols=111  Identities=19%  Similarity=0.367  Sum_probs=91.2

Q ss_pred             cccccccchhhhccChHHHHHhcccccchhccc-ccCCcccccchhhccccccccchhhhhccCCCCc--cccccccccc
Q psy10074         13 ADIKCCHCNKYISSDLRDLLEHCRLCPAMTRTD-LLKHKYVCYACSYATYYNGNMKKHLRIHLGDRPF--MCTLLICQYC   89 (420)
Q Consensus        13 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~-~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~--~c~~c~~~~~   89 (420)
                      ...+|++|.+.+.. ...|..|+      +..| ..+..|.|..|.++|..+..|.+||.+|.....-  .-..-.....
T Consensus       209 qlltcpycdrgykr-ltslkeHi------kyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRK  281 (1007)
T KOG3623|consen  209 QLLTCPYCDRGYKR-LTSLKEHI------KYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRK  281 (1007)
T ss_pred             hhhcchhHHHHHHH-HHHHHHHH------HHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhcc
Confidence            56899999999999 99999994      2233 3456699999999999999999999999654321  1111112256


Q ss_pred             chhhhhhhhhhhhhhhhhhhcccccccccCCCCcccccccccCCCCCc
Q psy10074         90 LICQYCNQYFVRSTQDILQHGKVCNFAPRSDANFNFVCILCNYHIPCK  137 (420)
Q Consensus        90 ~~C~~C~~~f~~~~~~l~~H~~~~~~~~~h~~~~~~~C~~C~~~f~~~  137 (420)
                      |+|..||+.|..+- .|..|+|+      |.|+++|.|+-|+++|...
T Consensus       282 FKCtECgKAFKfKH-HLKEHlRI------HSGEKPfeCpnCkKRFSHS  322 (1007)
T KOG3623|consen  282 FKCTECGKAFKFKH-HLKEHLRI------HSGEKPFECPNCKKRFSHS  322 (1007)
T ss_pred             ccccccchhhhhHH-HHHhhhee------ecCCCCcCCcccccccccC
Confidence            78899999999999 99999999      9999999999999999877


No 8  
>KOG3623|consensus
Probab=99.83  E-value=3.5e-21  Score=180.39  Aligned_cols=68  Identities=24%  Similarity=0.413  Sum_probs=62.0

Q ss_pred             eecCcCCccccChhhHHHHHHhhcCCCCCcccCcCccccCCHHHHHccccccccCCCCccccccchhhhc
Q psy10074        349 HECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKRKFELKSHMKRKHTFEDSLTTEETEYYKIL  418 (420)
Q Consensus       349 ~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~  418 (420)
                      |.|+.|.++|...++|.+|.- .|+|.+||+|.+|.+.|..+..|..|+ +.|.|++||+|..|++-|+.
T Consensus       895 yaCDqCDK~FqKqSSLaRHKY-EHsGqRPyqC~iCkKAFKHKHHLtEHk-RLHSGEKPfQCdKClKRFSH  962 (1007)
T KOG3623|consen  895 YACDQCDKAFQKQSSLARHKY-EHSGQRPYQCIICKKAFKHKHHLTEHK-RLHSGEKPFQCDKCLKRFSH  962 (1007)
T ss_pred             chHHHHHHHHHhhHHHHHhhh-hhcCCCCcccchhhHhhhhhhhhhhhh-hhccCCCcchhhhhhhhccc
Confidence            889999999999999999976 999999999999999999999999998 89999999999999998873


No 9  
>KOG3576|consensus
Probab=99.62  E-value=8.5e-17  Score=128.58  Aligned_cols=118  Identities=28%  Similarity=0.498  Sum_probs=106.6

Q ss_pred             CCCCCccCCccchhccChhHHhhhhhcccCCcccccCceecCCCCCccCChHHHhhhhhhhcCCcceecCcCCccccChh
Q psy10074        283 TGEKPFHCHYCDYICRTKYDLSSHIGRKHTDKEVLEKRYVCQLCPKQFLTSGELKYHQTTVHRKRVHECSECGFTFFLEK  362 (420)
Q Consensus       283 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~  362 (420)
                      .+...|.|.+|++.|.-...|.+| ...|++    -+.+.|..||+.|.+.-.|++|+++|+|.+||+|..|+++|++.-
T Consensus       113 sd~d~ftCrvCgK~F~lQRmlnrh-~kch~~----vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrc  187 (267)
T KOG3576|consen  113 SDQDSFTCRVCGKKFGLQRMLNRH-LKCHSD----VKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRC  187 (267)
T ss_pred             CCCCeeeeehhhhhhhHHHHHHHH-hhhccH----HHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhc
Confidence            345679999999999999999999 477777    788999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHhhcCCC----------CCcccCcCccccCCHHHHHccccccccCCC
Q psy10074        363 TLRAHIRETHRKE----------TPFPCPFCEYKAKRKFELKSHMKRKHTFED  405 (420)
Q Consensus       363 ~L~~H~~~~H~~~----------~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~  405 (420)
                      +|..|++.+|+..          +.|.|..||..-.....+..|+...|....
T Consensus       188 sleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Sp  240 (267)
T KOG3576|consen  188 SLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSP  240 (267)
T ss_pred             cHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCH
Confidence            9999999999753          569999999999999999999988887654


No 10 
>KOG3576|consensus
Probab=99.54  E-value=1.8e-15  Score=121.02  Aligned_cols=125  Identities=26%  Similarity=0.445  Sum_probs=103.5

Q ss_pred             CCCCcccccccccCCCCCccccccccccCCchhhhhhcccccccccCCCCCcceeccccCccccChhHHHHHHHHhcCCC
Q psy10074        119 SDANFNFVCILCNYHIPCKWCKYCKTKLDNNTEVLLQHCKLCVNVIRPDVSYRYVCFTCDYHSFCSSHMKDHIRVHLGEK  198 (420)
Q Consensus       119 h~~~~~~~C~~C~~~f~~~~c~~~~~~~~~~~~~l~~H~~~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~  198 (420)
                      ..+...|.|.+|++.|...             ..|+.|+ ..|+..+     .+-|..||+.|...-+|++|+++|++.+
T Consensus       112 ssd~d~ftCrvCgK~F~lQ-------------Rmlnrh~-kch~~vk-----r~lct~cgkgfndtfdlkrh~rthtgvr  172 (267)
T KOG3576|consen  112 SSDQDSFTCRVCGKKFGLQ-------------RMLNRHL-KCHSDVK-----RHLCTFCGKGFNDTFDLKRHTRTHTGVR  172 (267)
T ss_pred             CCCCCeeeeehhhhhhhHH-------------HHHHHHh-hhccHHH-----HHHHhhccCcccchhhhhhhhccccCcc
Confidence            3445679999999999998             9999999 9999988     8999999999999999999999999999


Q ss_pred             ceecccccccccCHHHHHHHHhhccCCCcceeceeecccccChHHHHHHHHhhhhcCcccccccccccccCChHHHHhch
Q psy10074        199 PYMCIYCAYRCTQKSDLKKHLRKKHEVKHCFVNIVMNSYGTNIKKCMKRHVERIHLNITKTRCELCDLRFFDKVGLKMHV  278 (420)
Q Consensus       199 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~c~~c~~~~~~~~~~~l~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~  278 (420)
                      ||+|..|++.|+.+-.|..|++..|+...          .+.          -.....+.|.|..||.+-.....+..|+
T Consensus       173 pykc~~c~kaftqrcsleshl~kvhgv~~----------~ya----------ykerr~kl~vcedcg~t~~~~e~~~~h~  232 (267)
T KOG3576|consen  173 PYKCSLCEKAFTQRCSLESHLKKVHGVQH----------QYA----------YKERRAKLYVCEDCGYTSERPEVYYLHL  232 (267)
T ss_pred             ccchhhhhHHHHhhccHHHHHHHHcCchH----------HHH----------HHHhhhheeeecccCCCCCChhHHHHHH
Confidence            99999999999999999999998887531          010          1122345688888888888888888885


Q ss_pred             hhcC
Q psy10074        279 MRKH  282 (420)
Q Consensus       279 ~~~H  282 (420)
                      ...|
T Consensus       233 ~~~h  236 (267)
T KOG3576|consen  233 KLHH  236 (267)
T ss_pred             HhcC
Confidence            4444


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.16  E-value=3.4e-11  Score=114.98  Aligned_cols=136  Identities=17%  Similarity=0.369  Sum_probs=100.7

Q ss_pred             cccccccccccCChHHHHhchhhcCCCCCCccCCc--cchhccChhHHhhhhhcccCCcccccCceecCCCCCccCChHH
Q psy10074        258 KTRCELCDLRFFDKVGLKMHVMRKHTGEKPFHCHY--CDYICRTKYDLSSHIGRKHTDKEVLEKRYVCQLCPKQFLTSGE  335 (420)
Q Consensus       258 ~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~--C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~C~~C~~~f~~~~~  335 (420)
                      ...|+.|....... .|..| . .+-.-..-.|+.  |+..|. ...+.+|              +.|+.|++.|. ...
T Consensus       407 ~V~C~NC~~~i~l~-~l~lH-e-~~C~r~~V~Cp~~~Cg~v~~-r~el~~H--------------~~C~~Cgk~f~-~s~  467 (567)
T PLN03086        407 TVECRNCKHYIPSR-SIALH-E-AYCSRHNVVCPHDGCGIVLR-VEEAKNH--------------VHCEKCGQAFQ-QGE  467 (567)
T ss_pred             eEECCCCCCccchh-HHHHH-H-hhCCCcceeCCcccccceee-ccccccC--------------ccCCCCCCccc-hHH
Confidence            34688888877654 56677 2 333334456874  888773 2233333              57999999886 677


Q ss_pred             HhhhhhhhcCCcceecCcCCccccChhhHHHHHHhhcCCCCCcccCcCccccCC----------HHHHHccccccccCCC
Q psy10074        336 LKYHQTTVHRKRVHECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKR----------KFELKSHMKRKHTFED  405 (420)
Q Consensus       336 l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~----------~~~l~~H~~~~H~~~~  405 (420)
                      |..|+.+++  +++.|+ ||..+ ....|..|+. .|...+++.|+.|++.|..          .+.|..|. ... |.+
T Consensus       468 LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~-thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE-~~C-G~r  540 (567)
T PLN03086        468 MEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQA-STCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHE-SIC-GSR  540 (567)
T ss_pred             HHHHHHhcC--CCccCC-CCCCc-chhHHHhhhh-ccCCCCceeCCCCCCccccCccccchhhhhhhHHHHH-Hhc-CCc
Confidence            899999876  789999 99755 5688999987 8888899999999998852          45788998 444 788


Q ss_pred             Cccccccchhhhcc
Q psy10074        406 SLTTEETEYYKILE  419 (420)
Q Consensus       406 ~~~C~~C~~~f~~~  419 (420)
                      ++.|..||+.|..+
T Consensus       541 t~~C~~Cgk~Vrlr  554 (567)
T PLN03086        541 TAPCDSCGRSVMLK  554 (567)
T ss_pred             ceEccccCCeeeeh
Confidence            89999999988754


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.09  E-value=2.1e-10  Score=109.65  Aligned_cols=121  Identities=21%  Similarity=0.382  Sum_probs=94.2

Q ss_pred             cccccc--cccccCChHHHHhchhhcCCCCCCccCCccchhccChhHHhhhhhcccCCcccccCceecCCCCCccCChHH
Q psy10074        258 KTRCEL--CDLRFFDKVGLKMHVMRKHTGEKPFHCHYCDYICRTKYDLSSHIGRKHTDKEVLEKRYVCQLCPKQFLTSGE  335 (420)
Q Consensus       258 ~~~C~~--C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~C~~C~~~f~~~~~  335 (420)
                      ...|+.  ||..|. +..+..|          +.|+.|++.|. ...|..|+...|       .++.|+ |+..+ .+..
T Consensus       433 ~V~Cp~~~Cg~v~~-r~el~~H----------~~C~~Cgk~f~-~s~LekH~~~~H-------kpv~Cp-Cg~~~-~R~~  491 (567)
T PLN03086        433 NVVCPHDGCGIVLR-VEEAKNH----------VHCEKCGQAFQ-QGEMEKHMKVFH-------EPLQCP-CGVVL-EKEQ  491 (567)
T ss_pred             ceeCCcccccceee-ccccccC----------ccCCCCCCccc-hHHHHHHHHhcC-------CCccCC-CCCCc-chhH
Confidence            446874  998884 3344444          47999999886 677899976654       358899 99755 6789


Q ss_pred             HhhhhhhhcCCcceecCcCCcccc----------ChhhHHHHHHhhcCCCCCcccCcCccccCCHHHHHcccccccc
Q psy10074        336 LKYHQTTVHRKRVHECSECGFTFF----------LEKTLRAHIRETHRKETPFPCPFCEYKAKRKFELKSHMKRKHT  402 (420)
Q Consensus       336 l~~H~~~h~~~~~~~C~~C~~~f~----------~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~  402 (420)
                      |..|+.+|.+.+++.|+.|+..|.          ..+.|..|.. .+ +.+++.|..|++.+..+ .|..|+..+|.
T Consensus       492 L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~-~C-G~rt~~C~~Cgk~Vrlr-dm~~H~~~~h~  565 (567)
T PLN03086        492 MVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHES-IC-GSRTAPCDSCGRSVMLK-EMDIHQIAVHQ  565 (567)
T ss_pred             HHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHH-hc-CCcceEccccCCeeeeh-hHHHHHHHhhc
Confidence            999999999999999999999985          2457999988 55 77889999999988764 57888888875


No 13 
>PHA00733 hypothetical protein
Probab=99.03  E-value=1.7e-10  Score=89.82  Aligned_cols=82  Identities=22%  Similarity=0.318  Sum_probs=56.9

Q ss_pred             cCceecCCCCCccCChHHHhhh--h---hhhcCCcceecCcCCccccChhhHHHHHHhhcCCCCCcccCcCccccCCHHH
Q psy10074        318 EKRYVCQLCPKQFLTSGELKYH--Q---TTVHRKRVHECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKRKFE  392 (420)
Q Consensus       318 ~~~~~C~~C~~~f~~~~~l~~H--~---~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~  392 (420)
                      .+++.|.+|+..|.....|..+  +   ..+++.+||.|+.|++.|.+...|..|++ .|  ..+|.|+.|++.|.....
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r-~h--~~~~~C~~CgK~F~~~~s  114 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIR-YT--EHSKVCPVCGKEFRNTDS  114 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHh-cC--CcCccCCCCCCccCCHHH
Confidence            4456666666666555544444  1   12334678888888888888888888877 44  346888888888888888


Q ss_pred             HHcccccccc
Q psy10074        393 LKSHMKRKHT  402 (420)
Q Consensus       393 l~~H~~~~H~  402 (420)
                      |..|+...|+
T Consensus       115 L~~H~~~~h~  124 (128)
T PHA00733        115 TLDHVCKKHN  124 (128)
T ss_pred             HHHHHHHhcC
Confidence            8888877775


No 14 
>PHA00733 hypothetical protein
Probab=98.89  E-value=2.4e-09  Score=83.39  Aligned_cols=85  Identities=21%  Similarity=0.313  Sum_probs=63.5

Q ss_pred             CCCCCccCCccchhccChhHHhhh--hhc--ccCCcccccCceecCCCCCccCChHHHhhhhhhhcCCcceecCcCCccc
Q psy10074        283 TGEKPFHCHYCDYICRTKYDLSSH--IGR--KHTDKEVLEKRYVCQLCPKQFLTSGELKYHQTTVHRKRVHECSECGFTF  358 (420)
Q Consensus       283 ~~~~~~~C~~C~~~f~~~~~l~~H--~~~--~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  358 (420)
                      ...+++.|.+|...|.....|..+  +.+  .+.+    .++|.|+.|++.|.+...|..|+..+  +.+|.|+.|++.|
T Consensus        36 ~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~----~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F  109 (128)
T PHA00733         36 PEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKA----VSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEF  109 (128)
T ss_pred             hhhhhHHHHHHhhhccChhhhcchHHHHhhcccCC----CCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCcc
Confidence            345667777777777666655555  111  2222    67899999999999999999998875  3578999999999


Q ss_pred             cChhhHHHHHHhhcC
Q psy10074        359 FLEKTLRAHIRETHR  373 (420)
Q Consensus       359 ~~~~~L~~H~~~~H~  373 (420)
                      .....|..|+...|.
T Consensus       110 ~~~~sL~~H~~~~h~  124 (128)
T PHA00733        110 RNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCHHHHHHHHHHhcC
Confidence            999999999886664


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=98.66  E-value=1.1e-08  Score=65.12  Aligned_cols=44  Identities=27%  Similarity=0.445  Sum_probs=32.6

Q ss_pred             ceecCcCCccccChhhHHHHHHhhcCCCCCcccCcCccccCCHHHHH
Q psy10074        348 VHECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKRKFELK  394 (420)
Q Consensus       348 ~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~  394 (420)
                      .|+|+.||+.|+....|..|++ .|.  ++|+|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r-~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLR-KHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHH-hcC--CcccCCcccceecccceeE
Confidence            4778888888888888888877 566  5777888887777666653


No 16 
>KOG3993|consensus
Probab=98.65  E-value=4.6e-09  Score=94.07  Aligned_cols=145  Identities=23%  Similarity=0.332  Sum_probs=100.9

Q ss_pred             ccccccccccccCChHHHHhchhhcCCCCCCccCCccchhccChhHHhhhhhcccCCcc---------------------
Q psy10074        257 TKTRCELCDLRFFDKVGLKMHVMRKHTGEKPFHCHYCDYICRTKYDLSSHIGRKHTDKE---------------------  315 (420)
Q Consensus       257 ~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~---------------------  315 (420)
                      ..|+|.+|...|.+...|.+| +-.-.-..-|+|+.|++.|.-..+|..| ++.|....                     
T Consensus       266 GdyiCqLCK~kYeD~F~LAQH-rC~RIV~vEYrCPEC~KVFsCPANLASH-RRWHKPR~eaa~a~~~P~k~~~~~rae~~  343 (500)
T KOG3993|consen  266 GDYICQLCKEKYEDAFALAQH-RCPRIVHVEYRCPECDKVFSCPANLASH-RRWHKPRPEAAKAGSPPPKQAVETRAEVQ  343 (500)
T ss_pred             HHHHHHHHHHhhhhHHHHhhc-cCCeeEEeeecCCcccccccCchhhhhh-hcccCCchhhhhcCCCChhhhhhhhhhhh
Confidence            348899999999999999999 4322233458999999999999999999 67774311                     


Q ss_pred             --------cccCceecCCCCCccCChHHHhhhhhhhcCCc----------------------------------------
Q psy10074        316 --------VLEKRYVCQLCPKQFLTSGELKYHQTTVHRKR----------------------------------------  347 (420)
Q Consensus       316 --------~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~----------------------------------------  347 (420)
                              ..+.-|.|..|++.|....-|+.|+.+|+...                                        
T Consensus       344 ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~  423 (500)
T KOG3993|consen  344 EAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLY  423 (500)
T ss_pred             hccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccceee
Confidence                    11334888888888888888888887776210                                        


Q ss_pred             ------ceecCcCCccccChhhHHHHHHhhcCCCCCcccCcCccccCCHHHHHccccccccCC
Q psy10074        348 ------VHECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKRKFELKSHMKRKHTFE  404 (420)
Q Consensus       348 ------~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~  404 (420)
                            .--++.++..+.++..--.+.+ --.....|.|.+|...|.+.-.|.+|+...|..+
T Consensus       424 ~a~sael~~pp~~~~ppsss~~sgg~~r-lg~~~q~f~~ky~~atfyss~~ltrhin~~Hpse  485 (500)
T KOG3993|consen  424 VAGSAELELPPYDGSPPSSSGSSGGYGR-LGIAEQGFTCKYCPATFYSSPGLTRHINKCHPSE  485 (500)
T ss_pred             eeccccccCCCCCCCCcccCCCCCcccc-ccchhhccccccchHhhhcCcchHhHhhhcChHH
Confidence                  0224555544444433222222 1112345899999999999999999999999754


No 17 
>KOG3993|consensus
Probab=98.64  E-value=9.3e-09  Score=92.15  Aligned_cols=202  Identities=12%  Similarity=0.091  Sum_probs=124.4

Q ss_pred             CcceeccccCccccChhHHHHHHHHhcCCCceecccccccccCHHHHHHHHhhccCCCcceeceeeccc-ccChHHHHHH
Q psy10074        169 SYRYVCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIYCAYRCTQKSDLKKHLRKKHEVKHCFVNIVMNSY-GTNIKKCMKR  247 (420)
Q Consensus       169 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~c~~c~~~~-~~~~~~~l~~  247 (420)
                      ...|.|..|...|.+.-.|.+|.=.......|+|+.|++.|.-..+|..|.++|......--.--.... ...+..+.++
T Consensus       265 iGdyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~e  344 (500)
T KOG3993|consen  265 IGDYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQE  344 (500)
T ss_pred             HHHHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhh
Confidence            345999999999999999999954333335699999999999999999999998754321100000000 0011111111


Q ss_pred             HH-hhhhcCcccccccccccccCChHHHHhchhhcCCCCCC----------------ccCCccchhccChhHHhhhhhcc
Q psy10074        248 HV-ERIHLNITKTRCELCDLRFFDKVGLKMHVMRKHTGEKP----------------FHCHYCDYICRTKYDLSSHIGRK  310 (420)
Q Consensus       248 h~-~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~----------------~~C~~C~~~f~~~~~l~~H~~~~  310 (420)
                      -. ......+..|.|..|++.|.....|+.|+...|.....                +.+..+.-.+.....-..+ ...
T Consensus       345 a~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~-vl~  423 (500)
T KOG3993|consen  345 AERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDE-VLY  423 (500)
T ss_pred             ccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccc-eee
Confidence            11 00112334699999999999999999995433322111                1233333222222221122 111


Q ss_pred             cCCcccccCceecCCCCCccCChHHHhhhhhhhcCCcceecCcCCccccChhhHHHHHHhhcCC
Q psy10074        311 HTDKEVLEKRYVCQLCPKQFLTSGELKYHQTTVHRKRVHECSECGFTFFLEKTLRAHIRETHRK  374 (420)
Q Consensus       311 H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~~H~~  374 (420)
                      +.+.   +..-.+++++..+.++..-..+.+.-..+..|.|.+|...|.+...|.+|+...|..
T Consensus       424 ~a~s---ael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~~ltrhin~~Hps  484 (500)
T KOG3993|consen  424 VAGS---AELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSPGLTRHINKCHPS  484 (500)
T ss_pred             eecc---ccccCCCCCCCCcccCCCCCccccccchhhccccccchHhhhcCcchHhHhhhcChH
Confidence            1111   223467888877777766666666556667899999999999999999999877754


No 18 
>PHA02768 hypothetical protein; Provisional
Probab=98.58  E-value=2.1e-08  Score=63.77  Aligned_cols=44  Identities=14%  Similarity=0.273  Sum_probs=39.0

Q ss_pred             ceecCCCCCccCChHHHhhhhhhhcCCcceecCcCCccccChhhHH
Q psy10074        320 RYVCQLCPKQFLTSGELKYHQTTVHRKRVHECSECGFTFFLEKTLR  365 (420)
Q Consensus       320 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~  365 (420)
                      .|.|+.||+.|...+.|..|+++|+  ++|+|..|++.|.+.+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            4899999999999999999999988  6899999999998877663


No 19 
>KOG1146|consensus
Probab=98.37  E-value=2.2e-07  Score=95.12  Aligned_cols=93  Identities=25%  Similarity=0.408  Sum_probs=69.7

Q ss_pred             cccccccchhhhccChHHHHHhcccccchhcccc-------------------------cCCcccccchhhccccccccc
Q psy10074         13 ADIKCCHCNKYISSDLRDLLEHCRLCPAMTRTDL-------------------------LKHKYVCYACSYATYYNGNMK   67 (420)
Q Consensus        13 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~-------------------------~~~~~~C~~C~~~f~~~~~l~   67 (420)
                      +.|.|+.|+..|.. ...|..|       ++.-+                         +.++|.|..|++.+.++.+|.
T Consensus       464 kt~~cpkc~~~yk~-a~~L~vh-------mRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Ls  535 (1406)
T KOG1146|consen  464 KTLKCPKCNWHYKL-AQTLGVH-------MRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLS  535 (1406)
T ss_pred             ccccCCccchhhhh-HHHhhhc-------ccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHH
Confidence            89999999999999 9999999       66511                         235799999999999999999


Q ss_pred             hhhhhcc--CC----------C----Cc-cccccccc---------------ccchhhhhhhhhhhhhhhhhhhccccc
Q psy10074         68 KHLRIHL--GD----------R----PF-MCTLLICQ---------------YCLICQYCNQYFVRSTQDILQHGKVCN  114 (420)
Q Consensus        68 ~H~~~h~--~~----------~----~~-~c~~c~~~---------------~~~~C~~C~~~f~~~~~~l~~H~~~~~  114 (420)
                      .||+.-.  .+          .    +. .+..++..               ..+.|..|++...-.. .|+.||....
T Consensus       536 ihlqS~~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP~~~C~vc~yetniar-nlrihmtss~  613 (1406)
T KOG1146|consen  536 IHLQSDLHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKPSWRCEVCSYETNIAR-NLRIHMTASP  613 (1406)
T ss_pred             HHHHHHhhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCCCcchhhhcchhhhhh-ccccccccCC
Confidence            9987421  10          0    00 12222222               6789999999988888 8999987743


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.34  E-value=2.8e-07  Score=49.95  Aligned_cols=24  Identities=46%  Similarity=1.041  Sum_probs=14.0

Q ss_pred             HHHHHHhhcCCCCCcccCcCccccC
Q psy10074        364 LRAHIRETHRKETPFPCPFCEYKAK  388 (420)
Q Consensus       364 L~~H~~~~H~~~~~~~C~~C~~~f~  388 (420)
                      |.+|++ .|++++||+|++|+++|.
T Consensus         2 l~~H~~-~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMR-THTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHH-HHSSSSSEEESSSSEEES
T ss_pred             HHHHhh-hcCCCCCCCCCCCcCeeC
Confidence            555655 555666666666665554


No 21 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.29  E-value=4.9e-07  Score=48.98  Aligned_cols=24  Identities=29%  Similarity=0.552  Sum_probs=16.2

Q ss_pred             HhhhhhhhcCCcceecCcCCcccc
Q psy10074        336 LKYHQTTVHRKRVHECSECGFTFF  359 (420)
Q Consensus       336 l~~H~~~h~~~~~~~C~~C~~~f~  359 (420)
                      |..|+++|++++||.|+.|+++|.
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeC
Confidence            566666666666666766666664


No 22 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.24  E-value=9.8e-07  Score=57.62  Aligned_cols=52  Identities=31%  Similarity=0.649  Sum_probs=37.8

Q ss_pred             ceecCcCCccccChhhHHHHHHhhcCCC-CCcccCcCccccCCHHHHHcccccccc
Q psy10074        348 VHECSECGFTFFLEKTLRAHIRETHRKE-TPFPCPFCEYKAKRKFELKSHMKRKHT  402 (420)
Q Consensus       348 ~~~C~~C~~~f~~~~~L~~H~~~~H~~~-~~~~C~~C~~~f~~~~~l~~H~~~~H~  402 (420)
                      .|.||.|++. .+...|..|+...|..+ +.+.||+|...+.  .+|..|+...|+
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            3778888884 45677888888777765 4588888887654  478888876663


No 23 
>PHA00732 hypothetical protein
Probab=98.12  E-value=1.8e-06  Score=60.69  Aligned_cols=44  Identities=32%  Similarity=0.696  Sum_probs=26.8

Q ss_pred             ceecCcCCccccChhhHHHHHHhhcCCCCCcccCcCccccCCHHHHHccc
Q psy10074        348 VHECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKRKFELKSHM  397 (420)
Q Consensus       348 ~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~  397 (420)
                      ||.|+.|++.|.+...|..|++..|.+   +.|+.|+++|.   .|..|+
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~---~l~~H~   44 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYR---RLNQHF   44 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeC---Chhhhh
Confidence            456666666666666666666533442   45666666665   355665


No 24 
>PHA00616 hypothetical protein
Probab=98.05  E-value=1.8e-06  Score=52.15  Aligned_cols=21  Identities=29%  Similarity=0.534  Sum_probs=9.3

Q ss_pred             eecCcCCccccChhhHHHHHH
Q psy10074        349 HECSECGFTFFLEKTLRAHIR  369 (420)
Q Consensus       349 ~~C~~C~~~f~~~~~L~~H~~  369 (420)
                      |+|+.||..|...+.|..|++
T Consensus         2 YqC~~CG~~F~~~s~l~~H~r   22 (44)
T PHA00616          2 YQCLRCGGIFRKKKEVIEHLL   22 (44)
T ss_pred             CccchhhHHHhhHHHHHHHHH
Confidence            344444444444444444444


No 25 
>PHA00732 hypothetical protein
Probab=97.88  E-value=6.8e-06  Score=57.84  Aligned_cols=39  Identities=28%  Similarity=0.519  Sum_probs=34.5

Q ss_pred             CcccCcCccccCCHHHHHccccccccCCCCccccccchhhhc
Q psy10074        377 PFPCPFCEYKAKRKFELKSHMKRKHTFEDSLTTEETEYYKIL  418 (420)
Q Consensus       377 ~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~  418 (420)
                      ||.|+.|++.|.+.+.|..|++..|++   +.|+.||+.|+.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~~   39 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYRR   39 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeCC
Confidence            589999999999999999999656764   589999999974


No 26 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.87  E-value=1.3e-05  Score=52.27  Aligned_cols=49  Identities=24%  Similarity=0.480  Sum_probs=19.6

Q ss_pred             eecCCCCCccCChHHHhhhhhhhcC--CcceecCcCCccccChhhHHHHHHhhc
Q psy10074        321 YVCQLCPKQFLTSGELKYHQTTVHR--KRVHECSECGFTFFLEKTLRAHIRETH  372 (420)
Q Consensus       321 ~~C~~C~~~f~~~~~l~~H~~~h~~--~~~~~C~~C~~~f~~~~~L~~H~~~~H  372 (420)
                      |.||+|++ -.+...|..|....+.  .+.+.||+|...+.  ..|..|+...|
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            34444444 2233344444433221  12344444444332  24455544333


No 27 
>PHA00616 hypothetical protein
Probab=97.86  E-value=7.1e-06  Score=49.64  Aligned_cols=37  Identities=14%  Similarity=0.174  Sum_probs=23.0

Q ss_pred             ceeccccCccccChhHHHHHHHHhcCCCceecccccc
Q psy10074        171 RYVCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIYCAY  207 (420)
Q Consensus       171 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~  207 (420)
                      +|+|+.||+.|...+.|..|++.|++++++.|..=..
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~~y~   37 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEYFYI   37 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeEEEE
Confidence            3566666666666666666666666666666654333


No 28 
>KOG1146|consensus
Probab=97.68  E-value=1.4e-05  Score=82.33  Aligned_cols=87  Identities=13%  Similarity=0.144  Sum_probs=62.8

Q ss_pred             cccchhhhccChHHHHHhcccccchhcccccCCcccccchhhccccccccchhhhhccCCCCccccccccc---------
Q psy10074         17 CCHCNKYISSDLRDLLEHCRLCPAMTRTDLLKHKYVCYACSYATYYNGNMKKHLRIHLGDRPFMCTLLICQ---------   87 (420)
Q Consensus        17 C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~---------   87 (420)
                      |.-|+..+.+ .+.+..|.      ...+.-.+.+.|+.|++.|.....|..||++-+.+...  .+|...         
T Consensus       439 ~~~~e~~~~s-~r~~~~~t------~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~--~~c~~gq~~~~~arg  509 (1406)
T KOG1146|consen  439 LTKAEPLLES-KRSLEGQT------VVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQS--AYCKAGQNHPRLARG  509 (1406)
T ss_pred             ccchhhhhhh-hcccccce------eeeecccccccCCccchhhhhHHHhhhcccccccccch--hHhHhcccccccccc
Confidence            4445555666 56666662      44555568899999999999999999999974433221  122211         


Q ss_pred             -------ccchhhhhhhhhhhhhhhhhhhcccc
Q psy10074         88 -------YCLICQYCNQYFVRSTQDILQHGKVC  113 (420)
Q Consensus        88 -------~~~~C~~C~~~f~~~~~~l~~H~~~~  113 (420)
                             .+|.|..|+.++.++. .|.+|+...
T Consensus       510 ~~~~~~~~p~~C~~C~~stttng-~LsihlqS~  541 (1406)
T KOG1146|consen  510 EVYRCPGKPYPCRACNYSTTTNG-NLSIHLQSD  541 (1406)
T ss_pred             ccccCCCCcccceeeeeeeecch-HHHHHHHHH
Confidence                   7889999999999999 899998764


No 29 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.58  E-value=5.9e-05  Score=39.53  Aligned_cols=22  Identities=32%  Similarity=0.567  Sum_probs=13.5

Q ss_pred             eeccccCccccChhHHHHHHHH
Q psy10074        172 YVCFTCDYHSFCSSHMKDHIRV  193 (420)
Q Consensus       172 ~~C~~C~~~f~~~~~l~~H~~~  193 (420)
                      |.|+.|++.|.+...|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4566666666666666666654


No 30 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.46  E-value=8.3e-05  Score=38.95  Aligned_cols=21  Identities=33%  Similarity=0.757  Sum_probs=10.8

Q ss_pred             eecCcCCccccChhhHHHHHH
Q psy10074        349 HECSECGFTFFLEKTLRAHIR  369 (420)
Q Consensus       349 ~~C~~C~~~f~~~~~L~~H~~  369 (420)
                      |+|+.|++.|.+...|..|++
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~   21 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMR   21 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHh
Confidence            345555555555555555544


No 31 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.38  E-value=0.00012  Score=54.97  Aligned_cols=71  Identities=25%  Similarity=0.398  Sum_probs=14.1

Q ss_pred             CCccchhccChhHHhhhhhcccCCcccccCceecCCCCCccCChHHHhhhhhhhcCCcceecCcCCccccChhhHHHHHH
Q psy10074        290 CHYCDYICRTKYDLSSHIGRKHTDKEVLEKRYVCQLCPKQFLTSGELKYHQTTVHRKRVHECSECGFTFFLEKTLRAHIR  369 (420)
Q Consensus       290 C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~  369 (420)
                      |..|+..|.+...|..|+...|..    ..+     ....+.....+..++..- ....+.|..|++.|.+...|..|++
T Consensus         2 C~~C~~~f~~~~~l~~H~~~~H~~----~~~-----~~~~l~~~~~~~~~~~~~-~~~~~~C~~C~~~f~s~~~l~~Hm~   71 (100)
T PF12756_consen    2 CLFCDESFSSVDDLLQHMKKKHGF----DIP-----DQKYLVDPNRLLNYLRKK-VKESFRCPYCNKTFRSREALQEHMR   71 (100)
T ss_dssp             ---------------------------------------------------------SSEEBSSSS-EESSHHHHHHHHH
T ss_pred             cccccccccccccccccccccccc----ccc-----cccccccccccccccccc-cCCCCCCCccCCCCcCHHHHHHHHc
Confidence            566666666666666666555543    111     111111222233332221 1124666666666666666666666


Q ss_pred             h
Q psy10074        370 E  370 (420)
Q Consensus       370 ~  370 (420)
                      .
T Consensus        72 ~   72 (100)
T PF12756_consen   72 S   72 (100)
T ss_dssp             H
T ss_pred             C
Confidence            3


No 32 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.36  E-value=0.00018  Score=38.00  Aligned_cols=21  Identities=38%  Similarity=0.820  Sum_probs=9.5

Q ss_pred             eecCcCCccccChhhHHHHHH
Q psy10074        349 HECSECGFTFFLEKTLRAHIR  369 (420)
Q Consensus       349 ~~C~~C~~~f~~~~~L~~H~~  369 (420)
                      |.|++|++.|.+...|..|+.
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~   21 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMR   21 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHH
Confidence            345555555555555555544


No 33 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.33  E-value=8.2e-05  Score=55.87  Aligned_cols=75  Identities=23%  Similarity=0.453  Sum_probs=22.6

Q ss_pred             ecCCCCCccCChHHHhhhhhhhcCCcceecCcCCccccChhhHHHHHHhhcCCCCCcccCcCccccCCHHHHHccccccc
Q psy10074        322 VCQLCPKQFLTSGELKYHQTTVHRKRVHECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKRKFELKSHMKRKH  401 (420)
Q Consensus       322 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~H  401 (420)
                      .|..|+..|.+...|..|+...++-..-    ....+.....+..+++..  ....+.|.+|++.|.+...|..||+..+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~----~~~~l~~~~~~~~~~~~~--~~~~~~C~~C~~~f~s~~~l~~Hm~~~~   74 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIP----DQKYLVDPNRLLNYLRKK--VKESFRCPYCNKTFRSREALQEHMRSKH   74 (100)
T ss_dssp             ------------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHTT
T ss_pred             Cccccccccccccccccccccccccccc----cccccccccccccccccc--cCCCCCCCccCCCCcCHHHHHHHHcCcc
Confidence            4889999999999999999776643211    112223444455554411  1236999999999999999999997654


Q ss_pred             c
Q psy10074        402 T  402 (420)
Q Consensus       402 ~  402 (420)
                      .
T Consensus        75 H   75 (100)
T PF12756_consen   75 H   75 (100)
T ss_dssp             T
T ss_pred             C
Confidence            3


No 34 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.28  E-value=0.00021  Score=37.69  Aligned_cols=23  Identities=26%  Similarity=0.615  Sum_probs=10.5

Q ss_pred             eeccccCccccChhHHHHHHHHh
Q psy10074        172 YVCFTCDYHSFCSSHMKDHIRVH  194 (420)
Q Consensus       172 ~~C~~C~~~f~~~~~l~~H~~~h  194 (420)
                      |.|++|++.|.+...|..|++.|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            34555555555555555555443


No 35 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.17  E-value=0.00018  Score=39.34  Aligned_cols=20  Identities=25%  Similarity=0.439  Sum_probs=11.0

Q ss_pred             cccCcCccccCCHHHHHccc
Q psy10074        378 FPCPFCEYKAKRKFELKSHM  397 (420)
Q Consensus       378 ~~C~~C~~~f~~~~~l~~H~  397 (420)
                      |+|..|++.|.+...|..|+
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~   21 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHK   21 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHH
T ss_pred             CCCCccCCccCChhHHHHHh
Confidence            45555555555555555555


No 36 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.02  E-value=0.00029  Score=61.44  Aligned_cols=55  Identities=25%  Similarity=0.518  Sum_probs=44.3

Q ss_pred             CCcceecCc--CCccccChhhHHHHHHhhc------------------CCCCCcccCcCccccCCHHHHHccccc
Q psy10074        345 RKRVHECSE--CGFTFFLEKTLRAHIRETH------------------RKETPFPCPFCEYKAKRKFELKSHMKR  399 (420)
Q Consensus       345 ~~~~~~C~~--C~~~f~~~~~L~~H~~~~H------------------~~~~~~~C~~C~~~f~~~~~l~~H~~~  399 (420)
                      ++|||+|++  |.+.+.....|+-|+.--|                  ...+||.|++|++.|.+...|+.|+..
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~H  420 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRKH  420 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecccc
Confidence            358888877  8888888888888877444                  124789999999999999999999743


No 37 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=96.92  E-value=0.00075  Score=36.84  Aligned_cols=23  Identities=26%  Similarity=0.518  Sum_probs=12.4

Q ss_pred             eecccccccccCHHHHHHHHhhc
Q psy10074        200 YMCIYCAYRCTQKSDLKKHLRKK  222 (420)
Q Consensus       200 ~~C~~C~~~f~~~~~l~~H~~~~  222 (420)
                      |.|..|++.|.+...|..|++.+
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCccCCccCChhHHHHHhHHh
Confidence            45555555555555555555444


No 38 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=96.87  E-value=0.00034  Score=61.06  Aligned_cols=72  Identities=17%  Similarity=0.344  Sum_probs=48.7

Q ss_pred             CCCCccCCc--cchhccChhHHhhhhhcccCCcccccCceecCCCCCccCChHHHhhhhhhhcCCcceecCcCCccccCh
Q psy10074        284 GEKPFHCHY--CDYICRTKYDLSSHIGRKHTDKEVLEKRYVCQLCPKQFLTSGELKYHQTTVHRKRVHECSECGFTFFLE  361 (420)
Q Consensus       284 ~~~~~~C~~--C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  361 (420)
                      +++||+|++  |.+.+++...|+.|+..-|......+.|  -+.            .|.......|||.|++|++.+...
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p--~p~------------~~~~F~~~~KPYrCevC~KRYKNl  411 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENP--SPE------------KMNIFSAKDKPYRCEVCDKRYKNL  411 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCC--Ccc------------ccccccccCCceeccccchhhccC
Confidence            358999987  9999999999999987777553322222  111            111123456788888888888888


Q ss_pred             hhHHHHHH
Q psy10074        362 KTLRAHIR  369 (420)
Q Consensus       362 ~~L~~H~~  369 (420)
                      ..|+-|..
T Consensus       412 NGLKYHr~  419 (423)
T COG5189         412 NGLKYHRK  419 (423)
T ss_pred             ccceeccc
Confidence            88877744


No 39 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.22  E-value=0.0013  Score=40.80  Aligned_cols=28  Identities=25%  Similarity=0.498  Sum_probs=13.5

Q ss_pred             CcceecCcCCccccChhhHHHHHHhhcC
Q psy10074        346 KRVHECSECGFTFFLEKTLRAHIRETHR  373 (420)
Q Consensus       346 ~~~~~C~~C~~~f~~~~~L~~H~~~~H~  373 (420)
                      +.|-.||+|+..+.+...|++|+...|.
T Consensus        22 ~~PatCP~C~a~~~~srnLrRHle~~H~   49 (54)
T PF09237_consen   22 EQPATCPICGAVIRQSRNLRRHLEIRHF   49 (54)
T ss_dssp             S--EE-TTT--EESSHHHHHHHHHHHTT
T ss_pred             CCCCCCCcchhhccchhhHHHHHHHHhc
Confidence            3455666666666666666666654443


No 40 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.20  E-value=0.0038  Score=32.87  Aligned_cols=23  Identities=48%  Similarity=1.068  Sum_probs=9.9

Q ss_pred             eecccccccccCHHHHHHHHhhcc
Q psy10074        200 YMCIYCAYRCTQKSDLKKHLRKKH  223 (420)
Q Consensus       200 ~~C~~C~~~f~~~~~l~~H~~~~h  223 (420)
                      |+|+.|++... +..|..|++.+|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            34455554444 445555544433


No 41 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=96.11  E-value=0.0037  Score=55.41  Aligned_cols=137  Identities=24%  Similarity=0.469  Sum_probs=87.0

Q ss_pred             ccccc--chhhccccccccchhhhhccCCCCccccccccc-ccchhhhhhhhhhhhhhhhhhhcccccccccCCCCccc-
Q psy10074         50 KYVCY--ACSYATYYNGNMKKHLRIHLGDRPFMCTLLICQ-YCLICQYCNQYFVRSTQDILQHGKVCNFAPRSDANFNF-  125 (420)
Q Consensus        50 ~~~C~--~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~-~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~h~~~~~~-  125 (420)
                      .|.|+  .|..+......|..|.+..++  .+.|..|-+. ..|.   |.....+.. .|+.|...      ...+..| 
T Consensus       151 ~F~CP~skc~~~C~~~k~lk~H~K~~H~--~~~C~~C~~nKk~F~---~E~~lF~~~-~Lr~H~~~------G~~e~GFK  218 (493)
T COG5236         151 SFKCPKSKCHRRCGSLKELKKHYKAQHG--FVLCSECIGNKKDFW---NEIRLFRSS-TLRDHKNG------GLEEEGFK  218 (493)
T ss_pred             HhcCCchhhhhhhhhHHHHHHHHHhhcC--cEEhHhhhcCcccCc---cceeeeecc-cccccccC------CccccCcC
Confidence            48886  488888888899999886553  3444332211 1111   112223344 67777655      3323222 


Q ss_pred             ---ccccccCCCCCccccccccccCCchhhhhhcccccccccCCCCCcceeccccCc-------cccChhHHHHHHHHhc
Q psy10074        126 ---VCILCNYHIPCKWCKYCKTKLDNNTEVLLQHCKLCVNVIRPDVSYRYVCFTCDY-------HSFCSSHMKDHIRVHL  195 (420)
Q Consensus       126 ---~C~~C~~~f~~~~c~~~~~~~~~~~~~l~~H~~~~h~~~~~~~~~~~~C~~C~~-------~f~~~~~l~~H~~~h~  195 (420)
                         .|..|+..|.+.             .+|..|++..|.          +|.+|++       -|++...|.+|.+.- 
T Consensus       219 GHP~C~FC~~~FYdD-------------DEL~~HcR~~HE----------~ChICD~v~p~~~QYFK~Y~~Le~HF~~~-  274 (493)
T COG5236         219 GHPLCIFCKIYFYDD-------------DELRRHCRLRHE----------ACHICDMVGPIRYQYFKSYEDLEAHFRNA-  274 (493)
T ss_pred             CCchhhhccceecCh-------------HHHHHHHHhhhh----------hhhhhhccCccchhhhhCHHHHHHHhhcC-
Confidence               478888888877             899999855553          5777764       467788888887643 


Q ss_pred             CCCceeccc--cc----ccccCHHHHHHHHhhccCC
Q psy10074        196 GEKPYMCIY--CA----YRCTQKSDLKKHLRKKHEV  225 (420)
Q Consensus       196 ~~~~~~C~~--C~----~~f~~~~~l~~H~~~~h~~  225 (420)
                         -|.|.+  |.    ..|....+|..|+...|+.
T Consensus       275 ---hy~ct~qtc~~~k~~vf~~~~el~~h~~~~h~~  307 (493)
T COG5236         275 ---HYCCTFQTCRVGKCYVFPYHTELLEHLTRFHKV  307 (493)
T ss_pred             ---ceEEEEEEEecCcEEEeccHHHHHHHHHHHhhc
Confidence               267755  42    4688889999998877754


No 42 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.04  E-value=0.0061  Score=32.48  Aligned_cols=23  Identities=35%  Similarity=0.642  Sum_probs=14.7

Q ss_pred             eeccccCccccChhHHHHHHHHh
Q psy10074        172 YVCFTCDYHSFCSSHMKDHIRVH  194 (420)
Q Consensus       172 ~~C~~C~~~f~~~~~l~~H~~~h  194 (420)
                      |.|+.|++.|.+...|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            35666666666666666666654


No 43 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.03  E-value=0.0057  Score=37.95  Aligned_cols=31  Identities=26%  Similarity=0.415  Sum_probs=17.4

Q ss_pred             cCceecCCCCCccCChHHHhhhhhhhcCCcc
Q psy10074        318 EKRYVCQLCPKQFLTSGELKYHQTTVHRKRV  348 (420)
Q Consensus       318 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  348 (420)
                      +.|-.|++|+..+....+|++|+...|+.+|
T Consensus        22 ~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   22 EQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             S--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             CCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            5566777777777777777777766665554


No 44 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.02  E-value=0.0063  Score=32.02  Aligned_cols=24  Identities=33%  Similarity=0.736  Sum_probs=19.4

Q ss_pred             eeccccCccccChhHHHHHHHHhcC
Q psy10074        172 YVCFTCDYHSFCSSHMKDHIRVHLG  196 (420)
Q Consensus       172 ~~C~~C~~~f~~~~~l~~H~~~h~~  196 (420)
                      |+|+.|++... ...|.+|++.+++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            78999999998 9999999998753


No 45 
>smart00355 ZnF_C2H2 zinc finger.
Probab=95.95  E-value=0.007  Score=32.24  Aligned_cols=20  Identities=40%  Similarity=0.901  Sum_probs=9.8

Q ss_pred             ecCcCCccccChhhHHHHHH
Q psy10074        350 ECSECGFTFFLEKTLRAHIR  369 (420)
Q Consensus       350 ~C~~C~~~f~~~~~L~~H~~  369 (420)
                      .|+.|++.|.+...|..|++
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~   21 (26)
T smart00355        2 RCPECGKVFKSKSALKEHMR   21 (26)
T ss_pred             CCCCCcchhCCHHHHHHHHH
Confidence            44445555555555555544


No 46 
>KOG2231|consensus
Probab=95.80  E-value=0.0064  Score=59.93  Aligned_cols=134  Identities=17%  Similarity=0.330  Sum_probs=60.4

Q ss_pred             cccchhhccccccccchhhhhccCCCCcccccccccccchhhhhhhhhhhhhhhhhhhccc-ccccccCCCCcccccccc
Q psy10074         52 VCYACSYATYYNGNMKKHLRIHLGDRPFMCTLLICQYCLICQYCNQYFVRSTQDILQHGKV-CNFAPRSDANFNFVCILC  130 (420)
Q Consensus        52 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~~~~~C~~C~~~f~~~~~~l~~H~~~-~~~~~~h~~~~~~~C~~C  130 (420)
                      .|..| -.|.+...|..||..-+  +.+.|.+|-.. .-.+..+.+.|...  .|..|+.. +.-..++.|  -..|..|
T Consensus       117 ~~~~c-~~~~s~~~Lk~H~~~~H--~~~~c~lC~~~-~kif~~e~k~Yt~~--el~~h~~~gd~d~~s~rG--hp~C~~C  188 (669)
T KOG2231|consen  117 ECLHC-TEFKSVENLKNHMRDQH--KLHLCSLCLQN-LKIFINERKLYTRA--ELNLHLMFGDPDDESCRG--HPLCKFC  188 (669)
T ss_pred             CCccc-cchhHHHHHHHHHHHhh--hhhcccccccc-ceeeeeeeehehHH--HHHHHHhcCCCccccccC--Cccchhh
Confidence            45555 55557777777774322  22333332111 00112334444443  34455433 110011111  1235555


Q ss_pred             cCCCCCccccccccccCCchhhhhhcccccccccCCCCCcceecccc------CccccChhHHHHHHHHhcCCCceecc-
Q psy10074        131 NYHIPCKWCKYCKTKLDNNTEVLLQHCKLCVNVIRPDVSYRYVCFTC------DYHSFCSSHMKDHIRVHLGEKPYMCI-  203 (420)
Q Consensus       131 ~~~f~~~~c~~~~~~~~~~~~~l~~H~~~~h~~~~~~~~~~~~C~~C------~~~f~~~~~l~~H~~~h~~~~~~~C~-  203 (420)
                      ...|-..             ..|..|+...|          |.|..|      +.-|.....|..|.+.++    |.|. 
T Consensus       189 ~~~fld~-------------~el~rH~~~~h----------~~chfC~~~~~~neyy~~~~dLe~HfR~~H----flCE~  241 (669)
T KOG2231|consen  189 HERFLDD-------------DELYRHLRFDH----------EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH----FLCEE  241 (669)
T ss_pred             hhhhccH-------------HHHHHhhccce----------eheeecCcccccchhcccchHHHHHhhhcC----ccccc
Confidence            5555444             66666663333          344444      344566777777776654    5565 


Q ss_pred             -ccc-ccccCHHHHHHHHh
Q psy10074        204 -YCA-YRCTQKSDLKKHLR  220 (420)
Q Consensus       204 -~C~-~~f~~~~~l~~H~~  220 (420)
                       .|. +.|.....+..+++
T Consensus       242 ~~C~~~~f~~~~~~ei~lk  260 (669)
T KOG2231|consen  242 EFCRTKKFYVAFELEIELK  260 (669)
T ss_pred             cccccceeeehhHHHHHHH
Confidence             453 22333334444444


No 47 
>KOG2482|consensus
Probab=95.73  E-value=0.015  Score=51.61  Aligned_cols=55  Identities=20%  Similarity=0.298  Sum_probs=39.0

Q ss_pred             ccccccccCCchhhhhhcccccccccCCCC----------------CcceeccccCccccChhHHHHHHHH
Q psy10074        139 CKYCKTKLDNNTEVLLQHCKLCVNVIRPDV----------------SYRYVCFTCDYHSFCSSHMKDHIRV  193 (420)
Q Consensus       139 c~~~~~~~~~~~~~l~~H~~~~h~~~~~~~----------------~~~~~C~~C~~~f~~~~~l~~H~~~  193 (420)
                      |-.|+..+.++++.+..|+-..|......+                -..+.|-.|.+.|+.+..|+.||+.
T Consensus       147 ClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  147 CLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             EEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHh
Confidence            555555555566888888745554433222                2258999999999999999999986


No 48 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=95.69  E-value=0.0066  Score=32.28  Aligned_cols=20  Identities=20%  Similarity=0.534  Sum_probs=9.9

Q ss_pred             eccccCccccChhHHHHHHH
Q psy10074        173 VCFTCDYHSFCSSHMKDHIR  192 (420)
Q Consensus       173 ~C~~C~~~f~~~~~l~~H~~  192 (420)
                      .|.+|++.|.+...|+.|++
T Consensus         2 ~C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    2 YCDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             EETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCCcCCHHHHHHHHC
Confidence            44555555555555555543


No 49 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=95.68  E-value=0.009  Score=31.75  Aligned_cols=23  Identities=30%  Similarity=0.732  Sum_probs=20.9

Q ss_pred             eecccccccccCHHHHHHHHhhc
Q psy10074        200 YMCIYCAYRCTQKSDLKKHLRKK  222 (420)
Q Consensus       200 ~~C~~C~~~f~~~~~l~~H~~~~  222 (420)
                      |.|.+|+..|.+...|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            68999999999999999999753


No 50 
>KOG2482|consensus
Probab=95.57  E-value=0.019  Score=51.04  Aligned_cols=155  Identities=19%  Similarity=0.271  Sum_probs=93.0

Q ss_pred             HHHHHhhhhcCccccccccccccc-CChHHHHhchhhcCCC---------------------CCCccCCccchhccChhH
Q psy10074        245 MKRHVERIHLNITKTRCELCDLRF-FDKVGLKMHVMRKHTG---------------------EKPFHCHYCDYICRTKYD  302 (420)
Q Consensus       245 l~~h~~~~~~~~~~~~C~~C~~~f-~~~~~l~~H~~~~H~~---------------------~~~~~C~~C~~~f~~~~~  302 (420)
                      |.+++...........|-.|...+ .+++.+..|+...|.-                     -..+.|-+|.+.|+.+..
T Consensus       131 LeqqQ~Eredt~fslqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdknt  210 (423)
T KOG2482|consen  131 LEQQQKEREDTIFSLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNT  210 (423)
T ss_pred             HHHHHHHhcCCeeeeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHH
Confidence            444443333344457899998765 4567788887777731                     124789999999999999


Q ss_pred             Hhhhhhcc-cCCcccccCce----ec--CCCCCccCCh-HHHh-----hhhhhh--------cCCcc--eecCcCCcccc
Q psy10074        303 LSSHIGRK-HTDKEVLEKRY----VC--QLCPKQFLTS-GELK-----YHQTTV--------HRKRV--HECSECGFTFF  359 (420)
Q Consensus       303 l~~H~~~~-H~~~~~~~~~~----~C--~~C~~~f~~~-~~l~-----~H~~~h--------~~~~~--~~C~~C~~~f~  359 (420)
                      |+.||+.. |...+-..+-|    .=  ..=+++.+.. +.+.     .+....        .+..+  .+|-.|.....
T Consensus       211 LkeHMrkK~HrrinPknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~a~a~~v~CLfC~~~~e  290 (423)
T KOG2482|consen  211 LKEHMRKKRHRRINPKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDDAEALSVVCLFCTNFYE  290 (423)
T ss_pred             HHHHHHhccCcccCCCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCCCCccceEEEeeccchh
Confidence            99997553 33321111111    00  0011111111 1110     000000        01122  68999999999


Q ss_pred             ChhhHHHHHHhhcCC--------------------------CCCcccCcCccccCCHHHHHccccc
Q psy10074        360 LEKTLRAHIRETHRK--------------------------ETPFPCPFCEYKAKRKFELKSHMKR  399 (420)
Q Consensus       360 ~~~~L~~H~~~~H~~--------------------------~~~~~C~~C~~~f~~~~~l~~H~~~  399 (420)
                      +...|..||..+|.=                          ...-.|-.|.-+|.....|..||..
T Consensus       291 n~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~e  356 (423)
T KOG2482|consen  291 NPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMVE  356 (423)
T ss_pred             hHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhccc
Confidence            999999999988831                          1124488899999999999999953


No 51 
>KOG2785|consensus
Probab=95.49  E-value=0.045  Score=49.74  Aligned_cols=53  Identities=21%  Similarity=0.283  Sum_probs=39.0

Q ss_pred             ceecCcCCccccChhhHHHHHHhhcCCC----------------------CCcccCcCc---cccCCHHHHHcccccc
Q psy10074        348 VHECSECGFTFFLEKTLRAHIRETHRKE----------------------TPFPCPFCE---YKAKRKFELKSHMKRK  400 (420)
Q Consensus       348 ~~~C~~C~~~f~~~~~L~~H~~~~H~~~----------------------~~~~C~~C~---~~f~~~~~l~~H~~~~  400 (420)
                      |-.|-.|+..+.+...-..||...|+-.                      .-|.|-.|+   +.|.+..+++.||+.+
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~K  243 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRDK  243 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhhc
Confidence            4567777777777777777777666432                      227788888   8888888888888653


No 52 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.20  E-value=0.017  Score=31.41  Aligned_cols=22  Identities=36%  Similarity=0.614  Sum_probs=18.6

Q ss_pred             cccCcCccccCCHHHHHccccc
Q psy10074        378 FPCPFCEYKAKRKFELKSHMKR  399 (420)
Q Consensus       378 ~~C~~C~~~f~~~~~l~~H~~~  399 (420)
                      |.|..|++.|.+...|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6789999999999999998853


No 53 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=94.95  E-value=0.018  Score=31.26  Aligned_cols=22  Identities=32%  Similarity=0.732  Sum_probs=14.7

Q ss_pred             eecCCCCCccCChHHHhhhhhh
Q psy10074        321 YVCQLCPKQFLTSGELKYHQTT  342 (420)
Q Consensus       321 ~~C~~C~~~f~~~~~l~~H~~~  342 (420)
                      |.|..|++.|.+...|..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5667777777777777666654


No 54 
>PRK04860 hypothetical protein; Provisional
Probab=94.55  E-value=0.029  Score=45.58  Aligned_cols=36  Identities=28%  Similarity=0.458  Sum_probs=17.9

Q ss_pred             ceecCcCCccccChhhHHHHHHhhcCCCCCcccCcCccccC
Q psy10074        348 VHECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAK  388 (420)
Q Consensus       348 ~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~  388 (420)
                      +|.|. |+.   ....+.+|.+ .|++.++|.|..|+..|.
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~r-i~~g~~~YrC~~C~~~l~  154 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNR-VVRGEAVYRCRRCGETLV  154 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHH-HhcCCccEECCCCCceeE
Confidence            35554 544   3344455555 555555555555554443


No 55 
>KOG2231|consensus
Probab=94.51  E-value=0.051  Score=53.82  Aligned_cols=112  Identities=29%  Similarity=0.502  Sum_probs=66.2

Q ss_pred             cccccccccCChHHHHhchhhcCCCCCCccCCccch---------hccChhHHhhhhhcccCCcccccCceecCCCCCcc
Q psy10074        260 RCELCDLRFFDKVGLKMHVMRKHTGEKPFHCHYCDY---------ICRTKYDLSSHIGRKHTDKEVLEKRYVCQLCPKQF  330 (420)
Q Consensus       260 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~---------~f~~~~~l~~H~~~~H~~~~~~~~~~~C~~C~~~f  330 (420)
                      .|..| ..|.+...|+.|+...|..   +.|..|-.         ..-+...|..|+..--.+...-..--.|..|...|
T Consensus       117 ~~~~c-~~~~s~~~Lk~H~~~~H~~---~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~f  192 (669)
T KOG2231|consen  117 ECLHC-TEFKSVENLKNHMRDQHKL---HLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERF  192 (669)
T ss_pred             CCccc-cchhHHHHHHHHHHHhhhh---hccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhh
Confidence            36666 6677777777776555643   33333321         11235566677543333211112224678888888


Q ss_pred             CChHHHhhhhhhhcCCcceecCcC------CccccChhhHHHHHHhhcCCCCCcccC--cCc
Q psy10074        331 LTSGELKYHQTTVHRKRVHECSEC------GFTFFLEKTLRAHIRETHRKETPFPCP--FCE  384 (420)
Q Consensus       331 ~~~~~l~~H~~~h~~~~~~~C~~C------~~~f~~~~~L~~H~~~~H~~~~~~~C~--~C~  384 (420)
                      .+...|..|++.++    |.|-.|      +.-|..-..|..|.+..|     |.|.  -|.
T Consensus       193 ld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~H-----flCE~~~C~  245 (669)
T KOG2231|consen  193 LDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH-----FLCEEEFCR  245 (669)
T ss_pred             ccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcC-----ccccccccc
Confidence            88888888887765    444444      456777788888888666     5666  454


No 56 
>PRK04860 hypothetical protein; Provisional
Probab=94.47  E-value=0.034  Score=45.15  Aligned_cols=39  Identities=31%  Similarity=0.557  Sum_probs=34.6

Q ss_pred             cceeccccCccccChhHHHHHHHHhcCCCceecccccccccCH
Q psy10074        170 YRYVCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIYCAYRCTQK  212 (420)
Q Consensus       170 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  212 (420)
                      .+|.|. |+.   ....+++|.++|.++.+|.|..|+..|...
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            479998 987   788999999999999999999999988643


No 57 
>KOG4173|consensus
Probab=94.20  E-value=0.012  Score=48.36  Aligned_cols=79  Identities=23%  Similarity=0.452  Sum_probs=50.9

Q ss_pred             CCccCCc--cchhccChhHHhhhhhcccCCcccccCceecCCCCCccCChHHHhhhhhhhc----------CCcceecC-
Q psy10074        286 KPFHCHY--CDYICRTKYDLSSHIGRKHTDKEVLEKRYVCQLCPKQFLTSGELKYHQTTVH----------RKRVHECS-  352 (420)
Q Consensus       286 ~~~~C~~--C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~----------~~~~~~C~-  352 (420)
                      ..+.|+.  |...|.+......|....|.+        .|..|.+.|.+...|..|+...|          |...|+|- 
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY~~~h~~--------sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~Clv  149 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHYHTLHGN--------SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLV  149 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhhhhcccc--------hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHH
Confidence            3466765  667777777777776555554        57777777777777777776544          33446663 


Q ss_pred             -cCCccccChhhHHHHHHhhc
Q psy10074        353 -ECGFTFFLEKTLRAHIRETH  372 (420)
Q Consensus       353 -~C~~~f~~~~~L~~H~~~~H  372 (420)
                       .|+..|.+...-..|+...|
T Consensus       150 EgCt~KFkT~r~RkdH~I~~H  170 (253)
T KOG4173|consen  150 EGCTEKFKTSRDRKDHMIRMH  170 (253)
T ss_pred             HhhhhhhhhhhhhhhHHHHhc
Confidence             36666666666666665555


No 58 
>KOG2785|consensus
Probab=93.58  E-value=0.13  Score=46.92  Aligned_cols=25  Identities=12%  Similarity=0.281  Sum_probs=21.3

Q ss_pred             CcceeccccCccccChhHHHHHHHH
Q psy10074        169 SYRYVCFTCDYHSFCSSHMKDHIRV  193 (420)
Q Consensus       169 ~~~~~C~~C~~~f~~~~~l~~H~~~  193 (420)
                      ..++.|.+|.+.|.+......|++.
T Consensus        66 ~~~~~c~~c~k~~~s~~a~~~hl~S   90 (390)
T KOG2785|consen   66 ESVVYCEACNKSFASPKAHENHLKS   90 (390)
T ss_pred             ccceehHHhhccccChhhHHHHHHH
Confidence            3378999999999999999999875


No 59 
>KOG2893|consensus
Probab=92.68  E-value=0.053  Score=45.67  Aligned_cols=46  Identities=20%  Similarity=0.584  Sum_probs=39.7

Q ss_pred             cccchhhhccChHHHHHhcccccchhcccccCCcccccchhhccccccccchh-hhhcc
Q psy10074         17 CCHCNKYISSDLRDLLEHCRLCPAMTRTDLLKHKYVCYACSYATYYNGNMKKH-LRIHL   74 (420)
Q Consensus        17 C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H-~~~h~   74 (420)
                      |.+|++.|.+ +.-|.+|       .+-    +-|+|-+|.+...+--.|..| |++|.
T Consensus        13 cwycnrefdd-ekiliqh-------qka----khfkchichkkl~sgpglsihcmqvhk   59 (341)
T KOG2893|consen   13 CWYCNREFDD-EKILIQH-------QKA----KHFKCHICHKKLFSGPGLSIHCMQVHK   59 (341)
T ss_pred             eeecccccch-hhhhhhh-------hhh----ccceeeeehhhhccCCCceeehhhhhh
Confidence            9999999999 9999999       432    349999999999999999999 77774


No 60 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=92.59  E-value=0.072  Score=51.62  Aligned_cols=61  Identities=25%  Similarity=0.341  Sum_probs=44.5

Q ss_pred             ccccccchhhhccChHHHHHhcccccchhc--ccccC--Cccccc--chhhccccccccchhhhhccCCCCcccc
Q psy10074         14 DIKCCHCNKYISSDLRDLLEHCRLCPAMTR--TDLLK--HKYVCY--ACSYATYYNGNMKKHLRIHLGDRPFMCT   82 (420)
Q Consensus        14 ~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~--~~~~~--~~~~C~--~C~~~f~~~~~l~~H~~~h~~~~~~~c~   82 (420)
                      ++.|..|...|.. ...|..|       .+  .|.++  +++.|+  .|++.|.....+..|...|.+..+..+.
T Consensus       289 ~~~~~~~~~~~s~-~~~l~~~-------~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  355 (467)
T COG5048         289 PIKSKQCNISFSR-SSPLTRH-------LRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEK  355 (467)
T ss_pred             CCCCccccCCccc-ccccccc-------ccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccc
Confidence            5777777777777 7777777       66  57777  777777  6777777777777777777776665543


No 61 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=92.47  E-value=0.11  Score=27.53  Aligned_cols=20  Identities=30%  Similarity=0.592  Sum_probs=13.2

Q ss_pred             eecCcCCccccChhhHHHHHH
Q psy10074        349 HECSECGFTFFLEKTLRAHIR  369 (420)
Q Consensus       349 ~~C~~C~~~f~~~~~L~~H~~  369 (420)
                      ..|+.||+.| ....|..|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            3577777777 4566777755


No 62 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=92.14  E-value=0.16  Score=38.57  Aligned_cols=25  Identities=28%  Similarity=0.861  Sum_probs=21.8

Q ss_pred             ccc----CcCccccCCHHHHHcccccccc
Q psy10074        378 FPC----PFCEYKAKRKFELKSHMKRKHT  402 (420)
Q Consensus       378 ~~C----~~C~~~f~~~~~l~~H~~~~H~  402 (420)
                      |.|    +.|++...+...+.+|++..|+
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            889    8999999999999999987774


No 63 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=91.90  E-value=0.48  Score=42.51  Aligned_cols=139  Identities=17%  Similarity=0.223  Sum_probs=78.8

Q ss_pred             hhhhhhhhhhhhhhhhhcccccccccCCCCcccccccccC---CCCCccccccccccCCchhhhhhcccccccccCCCCC
Q psy10074         93 QYCNQYFVRSTQDILQHGKVCNFAPRSDANFNFVCILCNY---HIPCKWCKYCKTKLDNNTEVLLQHCKLCVNVIRPDVS  169 (420)
Q Consensus        93 ~~C~~~f~~~~~~l~~H~~~~~~~~~h~~~~~~~C~~C~~---~f~~~~c~~~~~~~~~~~~~l~~H~~~~h~~~~~~~~  169 (420)
                      ..|..+..... .|..|.+..      .+  .+.|.+|-.   .|...      ..+... ..|..|. ....... .-.
T Consensus       157 skc~~~C~~~k-~lk~H~K~~------H~--~~~C~~C~~nKk~F~~E------~~lF~~-~~Lr~H~-~~G~~e~-GFK  218 (493)
T COG5236         157 SKCHRRCGSLK-ELKKHYKAQ------HG--FVLCSECIGNKKDFWNE------IRLFRS-STLRDHK-NGGLEEE-GFK  218 (493)
T ss_pred             hhhhhhhhhHH-HHHHHHHhh------cC--cEEhHhhhcCcccCccc------eeeeec-ccccccc-cCCcccc-CcC
Confidence            56777666666 888898773      22  255666643   33322      111111 6677776 4443332 001


Q ss_pred             cceeccccCccccChhHHHHHHHHhcCCCceecccccc-------cccCHHHHHHHHhhccCCCcceeceeecccccChH
Q psy10074        170 YRYVCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIYCAY-------RCTQKSDLKKHLRKKHEVKHCFVNIVMNSYGTNIK  242 (420)
Q Consensus       170 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~-------~f~~~~~l~~H~~~~h~~~~~~c~~c~~~~~~~~~  242 (420)
                      .--.|..|...|-+...|..|++..+.    .|.+|+.       -|.+..+|..|.+..|-.-.++--.-..-..|...
T Consensus       219 GHP~C~FC~~~FYdDDEL~~HcR~~HE----~ChICD~v~p~~~QYFK~Y~~Le~HF~~~hy~ct~qtc~~~k~~vf~~~  294 (493)
T COG5236         219 GHPLCIFCKIYFYDDDELRRHCRLRHE----ACHICDMVGPIRYQYFKSYEDLEAHFRNAHYCCTFQTCRVGKCYVFPYH  294 (493)
T ss_pred             CCchhhhccceecChHHHHHHHHhhhh----hhhhhhccCccchhhhhCHHHHHHHhhcCceEEEEEEEecCcEEEeccH
Confidence            123699999999999999999987543    5777764       46667778888765542211111111112345555


Q ss_pred             HHHHHHHhhhh
Q psy10074        243 KCMKRHVERIH  253 (420)
Q Consensus       243 ~~l~~h~~~~~  253 (420)
                      .+|..|+...|
T Consensus       295 ~el~~h~~~~h  305 (493)
T COG5236         295 TELLEHLTRFH  305 (493)
T ss_pred             HHHHHHHHHHh
Confidence            55666654444


No 64 
>KOG4173|consensus
Probab=91.82  E-value=0.07  Score=43.96  Aligned_cols=84  Identities=26%  Similarity=0.413  Sum_probs=58.3

Q ss_pred             ccccccc--cccccCChHHHHhchhhcCCCCCCccCCccchhccChhHHhhhhhcccCC-----cccccCceecCC--CC
Q psy10074        257 TKTRCEL--CDLRFFDKVGLKMHVMRKHTGEKPFHCHYCDYICRTKYDLSSHIGRKHTD-----KEVLEKRYVCQL--CP  327 (420)
Q Consensus       257 ~~~~C~~--C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~-----~~~~~~~~~C~~--C~  327 (420)
                      ..+.|++  |...|.+...+..|.-..|.+    .|..|.+.|.+...|..||...|..     .+.+...|.|-+  |+
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY~~~h~~----sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt  153 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHYHTLHGN----SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCT  153 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhhhhcccc----hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhh
Confidence            3456754  667888777777775455544    4888888888888888887777643     222255678854  88


Q ss_pred             CccCChHHHhhhhhhhc
Q psy10074        328 KQFLTSGELKYHQTTVH  344 (420)
Q Consensus       328 ~~f~~~~~l~~H~~~h~  344 (420)
                      ..|.+...-..|+..-|
T Consensus       154 ~KFkT~r~RkdH~I~~H  170 (253)
T KOG4173|consen  154 EKFKTSRDRKDHMIRMH  170 (253)
T ss_pred             hhhhhhhhhhhHHHHhc
Confidence            88888888888876443


No 65 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=91.30  E-value=0.19  Score=26.62  Aligned_cols=18  Identities=17%  Similarity=0.379  Sum_probs=8.6

Q ss_pred             eccccCccccChhHHHHHH
Q psy10074        173 VCFTCDYHSFCSSHMKDHI  191 (420)
Q Consensus       173 ~C~~C~~~f~~~~~l~~H~  191 (420)
                      .|+.|+..| ..+.|..|+
T Consensus         4 ~C~~CgR~F-~~~~l~~H~   21 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHE   21 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHH
Confidence            445555554 444444444


No 66 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=90.53  E-value=0.19  Score=28.77  Aligned_cols=10  Identities=40%  Similarity=1.175  Sum_probs=4.9

Q ss_pred             eecCCCCCcc
Q psy10074        321 YVCQLCPKQF  330 (420)
Q Consensus       321 ~~C~~C~~~f  330 (420)
                      |.|.+||..+
T Consensus         2 ~~C~~CGy~y   11 (33)
T cd00350           2 YVCPVCGYIY   11 (33)
T ss_pred             EECCCCCCEE
Confidence            4455555444


No 67 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=89.78  E-value=0.24  Score=28.61  Aligned_cols=22  Identities=32%  Similarity=0.563  Sum_probs=13.0

Q ss_pred             ceecCcCCccccChhhHHHHHH
Q psy10074        348 VHECSECGFTFFLEKTLRAHIR  369 (420)
Q Consensus       348 ~~~C~~C~~~f~~~~~L~~H~~  369 (420)
                      +|.|++|+..|.+...+..|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            3556666666666666666544


No 68 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=89.69  E-value=0.28  Score=28.28  Aligned_cols=23  Identities=22%  Similarity=0.504  Sum_probs=18.2

Q ss_pred             ceecCCCCCccCChHHHhhhhhh
Q psy10074        320 RYVCQLCPKQFLTSGELKYHQTT  342 (420)
Q Consensus       320 ~~~C~~C~~~f~~~~~l~~H~~~  342 (420)
                      +|.|++|+..|.+...+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            47788888888888888888764


No 69 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=89.10  E-value=0.66  Score=34.85  Aligned_cols=21  Identities=19%  Similarity=0.431  Sum_probs=13.4

Q ss_pred             ccccccccccccCChHHHHhc
Q psy10074        257 TKTRCELCDLRFFDKVGLKMH  277 (420)
Q Consensus       257 ~~~~C~~C~~~f~~~~~l~~H  277 (420)
                      -|..|++||-+..+...|.+-
T Consensus        14 LP~~CpiCgLtLVss~HLARS   34 (112)
T TIGR00622        14 LPVECPICGLTLILSTHLARS   34 (112)
T ss_pred             CCCcCCcCCCEEeccchHHHh
Confidence            355677777777666665544


No 70 
>KOG2893|consensus
Probab=89.06  E-value=0.13  Score=43.44  Aligned_cols=46  Identities=33%  Similarity=0.474  Sum_probs=30.0

Q ss_pred             cCcCCccccChhhHHHHHHhhcCCCCCcccCcCccccCCHHHHHccccccc
Q psy10074        351 CSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKRKFELKSHMKRKH  401 (420)
Q Consensus       351 C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~H  401 (420)
                      |=+|++.|.....|.+|++..|     |+|.+|.++.-+--.|..|--.+|
T Consensus        13 cwycnrefddekiliqhqkakh-----fkchichkkl~sgpglsihcmqvh   58 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKAKH-----FKCHICHKKLFSGPGLSIHCMQVH   58 (341)
T ss_pred             eeecccccchhhhhhhhhhhcc-----ceeeeehhhhccCCCceeehhhhh
Confidence            5566777777777777766433     777777766666555666655555


No 71 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=88.40  E-value=0.13  Score=32.50  Aligned_cols=26  Identities=23%  Similarity=0.545  Sum_probs=12.3

Q ss_pred             CcccCcCccccCCHHHHHcccccccc
Q psy10074        377 PFPCPFCEYKAKRKFELKSHMKRKHT  402 (420)
Q Consensus       377 ~~~C~~C~~~f~~~~~l~~H~~~~H~  402 (420)
                      .+.||.|+..|...-...+|+...|+
T Consensus        17 ~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          17 FLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             eeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            34444444444444444444444443


No 72 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=87.59  E-value=0.3  Score=30.95  Aligned_cols=30  Identities=23%  Similarity=0.556  Sum_probs=22.5

Q ss_pred             cCCcceecCcCCccccChhhHHHHHHhhcC
Q psy10074        344 HRKRVHECSECGFTFFLEKTLRAHIRETHR  373 (420)
Q Consensus       344 ~~~~~~~C~~C~~~f~~~~~L~~H~~~~H~  373 (420)
                      .|+..+.||.|+..|....+..+|+...|.
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            356667888888888888888888776663


No 73 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=86.90  E-value=1.3  Score=33.65  Aligned_cols=27  Identities=33%  Similarity=0.630  Sum_probs=24.0

Q ss_pred             cceec----CcCCccccChhhHHHHHHhhcC
Q psy10074        347 RVHEC----SECGFTFFLEKTLRAHIRETHR  373 (420)
Q Consensus       347 ~~~~C----~~C~~~f~~~~~L~~H~~~~H~  373 (420)
                      ..|.|    +.|++.+.+...+..|++..|+
T Consensus        79 ~G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   79 DGYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CCeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            45999    9999999999999999997774


No 74 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=86.73  E-value=0.25  Score=47.79  Aligned_cols=64  Identities=23%  Similarity=0.427  Sum_probs=56.4

Q ss_pred             cceeccccCccccChhHHHHHHH--HhcCC--Cceecc--cccccccCHHHHHHHHhhccCCCcceecee
Q psy10074        170 YRYVCFTCDYHSFCSSHMKDHIR--VHLGE--KPYMCI--YCAYRCTQKSDLKKHLRKKHEVKHCFVNIV  233 (420)
Q Consensus       170 ~~~~C~~C~~~f~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~h~~~~~~c~~c  233 (420)
                      ..+.|..|...|.....+..|.+  .|.++  .++.|+  .|++.|.....+..|...+....+..+...
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  357 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLL  357 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccccc
Confidence            36899999999999999999999  89999  899999  799999999999999998888776555443


No 75 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=84.91  E-value=1.3  Score=33.33  Aligned_cols=24  Identities=29%  Similarity=0.520  Sum_probs=17.9

Q ss_pred             ceeccccCccccChhHHHHHHHHh
Q psy10074        171 RYVCFTCDYHSFCSSHMKDHIRVH  194 (420)
Q Consensus       171 ~~~C~~C~~~f~~~~~l~~H~~~h  194 (420)
                      .|+|+.|...|--.-+.-.|...|
T Consensus        81 ~y~C~~C~~~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        81 RYVCAVCKNVFCVDCDVFVHESLH  104 (112)
T ss_pred             ceeCCCCCCccccccchhhhhhcc
Confidence            678888888887777777776665


No 76 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=83.26  E-value=0.85  Score=26.25  Aligned_cols=10  Identities=30%  Similarity=0.992  Sum_probs=4.5

Q ss_pred             eecCcCCccc
Q psy10074        349 HECSECGFTF  358 (420)
Q Consensus       349 ~~C~~C~~~f  358 (420)
                      |+|..||..+
T Consensus         3 ~~C~~CG~i~   12 (34)
T cd00729           3 WVCPVCGYIH   12 (34)
T ss_pred             EECCCCCCEe
Confidence            4444444443


No 77 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=82.06  E-value=1.1  Score=26.48  Aligned_cols=8  Identities=38%  Similarity=1.227  Sum_probs=3.1

Q ss_pred             cCcCCccc
Q psy10074        351 CSECGFTF  358 (420)
Q Consensus       351 C~~C~~~f  358 (420)
                      ||.|+..|
T Consensus         5 CP~C~~~~   12 (38)
T TIGR02098         5 CPNCKTSF   12 (38)
T ss_pred             CCCCCCEE
Confidence            33333333


No 78 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=81.71  E-value=0.52  Score=40.65  Aligned_cols=13  Identities=38%  Similarity=0.997  Sum_probs=9.5

Q ss_pred             eecCcCCccccCh
Q psy10074        349 HECSECGFTFFLE  361 (420)
Q Consensus       349 ~~C~~C~~~f~~~  361 (420)
                      ..||.||.+|...
T Consensus        49 ~vCP~CgyA~~~~   61 (214)
T PF09986_consen   49 WVCPHCGYAAFEE   61 (214)
T ss_pred             EECCCCCCccccc
Confidence            6788888877643


No 79 
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=81.39  E-value=3.5  Score=36.64  Aligned_cols=96  Identities=18%  Similarity=0.268  Sum_probs=60.5

Q ss_pred             CCccccccccc---ccchhhhhhhhhhhhhhhhhhh------cccccccccCCCCcccccccccCCCCCccccccccccC
Q psy10074         77 RPFMCTLLICQ---YCLICQYCNQYFVRSTQDILQH------GKVCNFAPRSDANFNFVCILCNYHIPCKWCKYCKTKLD  147 (420)
Q Consensus        77 ~~~~c~~c~~~---~~~~C~~C~~~f~~~~~~l~~H------~~~~~~~~~h~~~~~~~C~~C~~~f~~~~c~~~~~~~~  147 (420)
                      ..|.|+.|...   -|..|+.|+....... .|.+-      ++...+.|...+.+.-.|..|.-.|+..          
T Consensus       307 gGy~CP~CktkVCsLPi~CP~Csl~Lilst-hLarSyhhL~PLk~f~E~p~~~~~ks~~Cf~CQ~~fp~~----------  375 (421)
T COG5151         307 GGYECPVCKTKVCSLPISCPICSLQLILST-HLARSYHHLYPLKPFVEKPEGTNPKSTHCFVCQGPFPKP----------  375 (421)
T ss_pred             CceeCCcccceeecCCccCcchhHHHHHHH-HHHHHHHhhccCcccccccCCCCCCCccceeccCCCCCC----------
Confidence            34677777665   6778899987764444 33321      1111222323334445588888888776          


Q ss_pred             CchhhhhhcccccccccCCCCCcceeccccCccccChhHHHHHHHHh
Q psy10074        148 NNTEVLLQHCKLCVNVIRPDVSYRYVCFTCDYHSFCSSHMKDHIRVH  194 (420)
Q Consensus       148 ~~~~~l~~H~~~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h  194 (420)
                                 .++..........|+|+.|...|-..-..-.|...|
T Consensus       376 -----------~~~~~~~~~ss~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         376 -----------PVSPFDESTSSGRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             -----------CCCcccccccccceechhhhhhhhhhhHHHHHHHHh
Confidence                       444444434445799999999998888888887766


No 80 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=81.11  E-value=0.32  Score=41.90  Aligned_cols=12  Identities=42%  Similarity=1.065  Sum_probs=8.1

Q ss_pred             cccCcCccccCC
Q psy10074        378 FPCPFCEYKAKR  389 (420)
Q Consensus       378 ~~C~~C~~~f~~  389 (420)
                      ..||.||.+|..
T Consensus        49 ~vCP~CgyA~~~   60 (214)
T PF09986_consen   49 WVCPHCGYAAFE   60 (214)
T ss_pred             EECCCCCCcccc
Confidence            457777777664


No 81 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=80.60  E-value=0.87  Score=34.25  Aligned_cols=14  Identities=29%  Similarity=0.562  Sum_probs=6.6

Q ss_pred             cceecCcCCccccC
Q psy10074        347 RVHECSECGFTFFL  360 (420)
Q Consensus       347 ~~~~C~~C~~~f~~  360 (420)
                      .|..||.||..|.-
T Consensus        25 ~PivCP~CG~~~~~   38 (108)
T PF09538_consen   25 DPIVCPKCGTEFPP   38 (108)
T ss_pred             CCccCCCCCCccCc
Confidence            34445555554443


No 82 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=79.35  E-value=1.3  Score=28.70  Aligned_cols=8  Identities=50%  Similarity=1.593  Sum_probs=4.3

Q ss_pred             CcccCcCc
Q psy10074        377 PFPCPFCE  384 (420)
Q Consensus       377 ~~~C~~C~  384 (420)
                      +|.|+.||
T Consensus        50 ~Y~Cp~CG   57 (61)
T COG2888          50 PYRCPKCG   57 (61)
T ss_pred             ceECCCcC
Confidence            45555555


No 83 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=77.77  E-value=1.3  Score=23.64  Aligned_cols=11  Identities=27%  Similarity=0.561  Sum_probs=8.3

Q ss_pred             eeccccCcccc
Q psy10074        172 YVCFTCDYHSF  182 (420)
Q Consensus       172 ~~C~~C~~~f~  182 (420)
                      -.|+.||..|.
T Consensus        15 ~~Cp~CG~~F~   25 (26)
T PF10571_consen   15 KFCPHCGYDFE   25 (26)
T ss_pred             CcCCCCCCCCc
Confidence            46888888774


No 84 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=76.94  E-value=2  Score=25.20  Aligned_cols=6  Identities=50%  Similarity=1.420  Sum_probs=2.2

Q ss_pred             ccCcCc
Q psy10074        379 PCPFCE  384 (420)
Q Consensus       379 ~C~~C~  384 (420)
                      .|+.|+
T Consensus        27 rC~~C~   32 (37)
T PF13719_consen   27 RCPKCG   32 (37)
T ss_pred             ECCCCC
Confidence            333333


No 85 
>PHA00626 hypothetical protein
Probab=74.85  E-value=1.7  Score=27.83  Aligned_cols=12  Identities=42%  Similarity=1.107  Sum_probs=8.1

Q ss_pred             ceeccccCcccc
Q psy10074        171 RYVCFTCDYHSF  182 (420)
Q Consensus       171 ~~~C~~C~~~f~  182 (420)
                      .|+|+.|++.|.
T Consensus        23 rYkCkdCGY~ft   34 (59)
T PHA00626         23 DYVCCDCGYNDS   34 (59)
T ss_pred             ceEcCCCCCeec
Confidence            577777776664


No 86 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=74.80  E-value=2.7  Score=34.25  Aligned_cols=16  Identities=13%  Similarity=0.391  Sum_probs=7.9

Q ss_pred             eecCCCCCccCChHHH
Q psy10074        321 YVCQLCPKQFLTSGEL  336 (420)
Q Consensus       321 ~~C~~C~~~f~~~~~l  336 (420)
                      |.|+.|+..|+...++
T Consensus       110 Y~Cp~c~~r~tf~eA~  125 (158)
T TIGR00373       110 FICPNMCVRFTFNEAM  125 (158)
T ss_pred             EECCCCCcEeeHHHHH
Confidence            4455555555444444


No 87 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=73.79  E-value=1.3  Score=26.55  Aligned_cols=12  Identities=17%  Similarity=0.603  Sum_probs=6.7

Q ss_pred             cccccchhhhcc
Q psy10074         15 IKCCHCNKYISS   26 (420)
Q Consensus        15 ~~C~~C~~~f~~   26 (420)
                      |+|+.|+..|.-
T Consensus         6 y~C~~Cg~~fe~   17 (41)
T smart00834        6 YRCEDCGHTFEV   17 (41)
T ss_pred             EEcCCCCCEEEE
Confidence            455555555554


No 88 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=73.54  E-value=1.2  Score=27.34  Aligned_cols=23  Identities=22%  Similarity=0.598  Sum_probs=9.8

Q ss_pred             cceecCcCCccccCh----hhHHHHHH
Q psy10074        347 RVHECSECGFTFFLE----KTLRAHIR  369 (420)
Q Consensus       347 ~~~~C~~C~~~f~~~----~~L~~H~~  369 (420)
                      ...+|..|++.+...    +.|..|++
T Consensus        15 ~~a~C~~C~~~~~~~~~~ts~l~~HL~   41 (45)
T PF02892_consen   15 KKAKCKYCGKVIKYSSGGTSNLKRHLK   41 (45)
T ss_dssp             S-EEETTTTEE-----SSTHHHHHHHH
T ss_pred             CeEEeCCCCeEEeeCCCcHHHHHHhhh
Confidence            334566666555442    45555553


No 89 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=72.88  E-value=1.8  Score=32.58  Aligned_cols=30  Identities=27%  Similarity=0.731  Sum_probs=21.7

Q ss_pred             eecCcCCccccChhhHHHHHHhhcCCCCCcccCcCccccCCH
Q psy10074        349 HECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKRK  390 (420)
Q Consensus       349 ~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~  390 (420)
                      ..|+.||..|....            ..|..||+||..|.-.
T Consensus        10 R~Cp~CG~kFYDLn------------k~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYDLN------------KDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhccCC------------CCCccCCCCCCccCcc
Confidence            47888888887642            2577788888888755


No 90 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=72.57  E-value=1.4  Score=26.75  Aligned_cols=12  Identities=17%  Similarity=0.581  Sum_probs=6.0

Q ss_pred             cccccchhhhcc
Q psy10074         15 IKCCHCNKYISS   26 (420)
Q Consensus        15 ~~C~~C~~~f~~   26 (420)
                      |+|..||..|.-
T Consensus         6 y~C~~Cg~~fe~   17 (42)
T PF09723_consen    6 YRCEECGHEFEV   17 (42)
T ss_pred             EEeCCCCCEEEE
Confidence            445555555444


No 91 
>PF12907 zf-met2:  Zinc-binding
Probab=72.54  E-value=1.4  Score=26.39  Aligned_cols=25  Identities=28%  Similarity=0.474  Sum_probs=11.3

Q ss_pred             ccCcCccccC---CHHHHHccccccccC
Q psy10074        379 PCPFCEYKAK---RKFELKSHMKRKHTF  403 (420)
Q Consensus       379 ~C~~C~~~f~---~~~~l~~H~~~~H~~  403 (420)
                      +|.+|..+|.   +...|..|....|+.
T Consensus         3 ~C~iC~qtF~~t~~~~~L~eH~enKHpK   30 (40)
T PF12907_consen    3 ICKICRQTFMQTTNEPQLKEHAENKHPK   30 (40)
T ss_pred             CcHHhhHHHHhcCCHHHHHHHHHccCCC
Confidence            4555553332   234455555555544


No 92 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=72.03  E-value=4.3  Score=32.65  Aligned_cols=13  Identities=23%  Similarity=0.695  Sum_probs=6.2

Q ss_pred             ceecCCCCCccCC
Q psy10074        320 RYVCQLCPKQFLT  332 (420)
Q Consensus       320 ~~~C~~C~~~f~~  332 (420)
                      .|.|+.|+..|+.
T Consensus        99 ~Y~Cp~C~~~y~~  111 (147)
T smart00531       99 YYKCPNCQSKYTF  111 (147)
T ss_pred             EEECcCCCCEeeH
Confidence            3445555544443


No 93 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=71.84  E-value=1.9  Score=28.08  Aligned_cols=10  Identities=40%  Similarity=1.494  Sum_probs=5.3

Q ss_pred             CCcccCcCcc
Q psy10074        376 TPFPCPFCEY  385 (420)
Q Consensus       376 ~~~~C~~C~~  385 (420)
                      .+|.|+.||+
T Consensus        47 ~~Y~CP~CGF   56 (59)
T PRK14890         47 NPYTCPKCGF   56 (59)
T ss_pred             CceECCCCCC
Confidence            3455555553


No 94 
>KOG2186|consensus
Probab=71.27  E-value=1.8  Score=37.37  Aligned_cols=46  Identities=15%  Similarity=0.322  Sum_probs=33.2

Q ss_pred             cccccchhhhccChHHHHHhcccccchhcccccCCcccccchhhccccccccchhhh
Q psy10074         15 IKCCHCNKYISSDLRDLLEHCRLCPAMTRTDLLKHKYVCYACSYATYYNGNMKKHLR   71 (420)
Q Consensus        15 ~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~   71 (420)
                      |.|..||....-  ..+.+|       +..-.+ .-|.|..||..|.. .++..|..
T Consensus         4 FtCnvCgEsvKK--p~vekH-------~srCrn-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVKK--PQVEKH-------MSRCRN-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhccc--cchHHH-------HHhccC-CeeEEeeccccccc-chhhhhhh
Confidence            678888877776  677788       444443 56888888888887 66667753


No 95 
>PF12907 zf-met2:  Zinc-binding
Probab=70.68  E-value=2.2  Score=25.47  Aligned_cols=32  Identities=34%  Similarity=0.496  Sum_probs=22.6

Q ss_pred             eecCcCCccc---cChhhHHHHHHhhcCCCCCccc
Q psy10074        349 HECSECGFTF---FLEKTLRAHIRETHRKETPFPC  380 (420)
Q Consensus       349 ~~C~~C~~~f---~~~~~L~~H~~~~H~~~~~~~C  380 (420)
                      ++|.+|..+|   .+...|..|..+.|....+-.|
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~~~~~C   36 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKNTFEEC   36 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCCCHHHc
Confidence            5788888544   4557799998888887654444


No 96 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=69.82  E-value=4.5  Score=21.59  Aligned_cols=19  Identities=21%  Similarity=0.497  Sum_probs=11.8

Q ss_pred             ecCcCCccccChhhHHHHHH
Q psy10074        350 ECSECGFTFFLEKTLRAHIR  369 (420)
Q Consensus       350 ~C~~C~~~f~~~~~L~~H~~  369 (420)
                      .||+|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            466676666 4556666654


No 97 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=69.55  E-value=1.8  Score=27.59  Aligned_cols=12  Identities=17%  Similarity=0.642  Sum_probs=5.8

Q ss_pred             cccccchhhhcc
Q psy10074         15 IKCCHCNKYISS   26 (420)
Q Consensus        15 ~~C~~C~~~f~~   26 (420)
                      |+|..|+.+|..
T Consensus         6 y~C~~Cg~~fe~   17 (52)
T TIGR02605         6 YRCTACGHRFEV   17 (52)
T ss_pred             EEeCCCCCEeEE
Confidence            445555544444


No 98 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=69.48  E-value=1.1  Score=36.15  Aligned_cols=23  Identities=13%  Similarity=0.108  Sum_probs=18.0

Q ss_pred             Ccccccchhhccccccccchhhh
Q psy10074         49 HKYVCYACSYATYYNGNMKKHLR   71 (420)
Q Consensus        49 ~~~~C~~C~~~f~~~~~l~~H~~   71 (420)
                      +.++|+.||..|.+...+..=|.
T Consensus        27 ~~~~c~~c~~~f~~~e~~~~~~i   49 (154)
T PRK00464         27 RRRECLACGKRFTTFERVELVPL   49 (154)
T ss_pred             eeeeccccCCcceEeEeccCccc
Confidence            34899999999998877766553


No 99 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=68.66  E-value=1.9  Score=26.75  Aligned_cols=13  Identities=23%  Similarity=0.792  Sum_probs=9.5

Q ss_pred             ccccccchhhhcc
Q psy10074         14 DIKCCHCNKYISS   26 (420)
Q Consensus        14 ~~~C~~C~~~f~~   26 (420)
                      .|.|+.|+..|..
T Consensus         3 ~y~C~~CG~~~~~   15 (46)
T PRK00398          3 EYKCARCGREVEL   15 (46)
T ss_pred             EEECCCCCCEEEE
Confidence            4778888877766


No 100
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=68.51  E-value=3.6  Score=27.03  Aligned_cols=46  Identities=24%  Similarity=0.527  Sum_probs=27.0

Q ss_pred             ceeccc-cCccccChhHHHHHHHHhcCCCceeccc----ccccccCHHHHHH
Q psy10074        171 RYVCFT-CDYHSFCSSHMKDHIRVHLGEKPYMCIY----CAYRCTQKSDLKK  217 (420)
Q Consensus       171 ~~~C~~-C~~~f~~~~~l~~H~~~h~~~~~~~C~~----C~~~f~~~~~l~~  217 (420)
                      +..|+. |+..-.....|..|+.......+..|++    |...+. +..|..
T Consensus         9 ~v~C~~~cc~~~i~r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~-~~~l~~   59 (60)
T PF02176_consen    9 PVPCPNGCCNEMIPRKELDDHLENECPKRPVPCPYSPYGCKERVP-REDLEE   59 (60)
T ss_dssp             EEE-TT--S-BEEECCCHHHHHHTTSTTSEEE-SS----S--EEE-HHHHHH
T ss_pred             EeeCCCCCcccceeHHHHHHHHHccCCCCcEECCCCCCCCCCccc-hhHHhC
Confidence            567877 3333334668888888777778888888    888765 344443


No 101
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=68.42  E-value=4.1  Score=33.91  Aligned_cols=17  Identities=18%  Similarity=0.512  Sum_probs=8.9

Q ss_pred             ceecCCCCCccCChHHH
Q psy10074        320 RYVCQLCPKQFLTSGEL  336 (420)
Q Consensus       320 ~~~C~~C~~~f~~~~~l  336 (420)
                      -|.|+.|+..|+...++
T Consensus       117 ~Y~Cp~C~~rytf~eA~  133 (178)
T PRK06266        117 FFFCPNCHIRFTFDEAM  133 (178)
T ss_pred             EEECCCCCcEEeHHHHh
Confidence            35555555555555444


No 102
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=67.86  E-value=1.6  Score=35.26  Aligned_cols=18  Identities=28%  Similarity=0.512  Sum_probs=11.0

Q ss_pred             eecCCCCCccCChHHHhh
Q psy10074        321 YVCQLCPKQFLTSGELKY  338 (420)
Q Consensus       321 ~~C~~C~~~f~~~~~l~~  338 (420)
                      +.|+.||.+|.+...+..
T Consensus        29 ~~c~~c~~~f~~~e~~~~   46 (154)
T PRK00464         29 RECLACGKRFTTFERVEL   46 (154)
T ss_pred             eeccccCCcceEeEeccC
Confidence            666677766666554443


No 103
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=67.40  E-value=3.1  Score=36.00  Aligned_cols=82  Identities=17%  Similarity=0.282  Sum_probs=52.0

Q ss_pred             cCCcccccchhhccccccccchhhhhc--cCCCCcccccccccccchhhhhhhhhhhhhhhhhhhcccccccccCCCCcc
Q psy10074         47 LKHKYVCYACSYATYYNGNMKKHLRIH--LGDRPFMCTLLICQYCLICQYCNQYFVRSTQDILQHGKVCNFAPRSDANFN  124 (420)
Q Consensus        47 ~~~~~~C~~C~~~f~~~~~l~~H~~~h--~~~~~~~c~~c~~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~h~~~~~  124 (420)
                      +-+.|+|..|+...---..| .|+-+-  .....|+|.-|+....|.|--|..-|=+      .|.+.....  -....+
T Consensus       139 GGrif~CsfC~~flCEDDQF-EHQAsCQvLe~E~~KC~SCNrlGq~sCLRCK~cfCd------dHvrrKg~k--y~k~k~  209 (314)
T PF06524_consen  139 GGRIFKCSFCDNFLCEDDQF-EHQASCQVLESETFKCQSCNRLGQYSCLRCKICFCD------DHVRRKGFK--YEKGKP  209 (314)
T ss_pred             CCeEEEeecCCCeeeccchh-hhhhhhhhhhcccccccccccccchhhhheeeeehh------hhhhhcccc--cccCCC
Confidence            66789999998654433444 454321  2235688888888888888777766643      233332111  244578


Q ss_pred             cccccccCCCCCc
Q psy10074        125 FVCILCNYHIPCK  137 (420)
Q Consensus       125 ~~C~~C~~~f~~~  137 (420)
                      +.|+.|+......
T Consensus       210 ~PCPKCg~et~eT  222 (314)
T PF06524_consen  210 IPCPKCGYETQET  222 (314)
T ss_pred             CCCCCCCCccccc
Confidence            9999999877666


No 104
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=66.27  E-value=3.5  Score=33.61  Aligned_cols=34  Identities=18%  Similarity=0.448  Sum_probs=19.3

Q ss_pred             cCCcceecCcCCccccChhhHHHHHHhhcCCCCCcccCcCcccc
Q psy10074        344 HRKRVHECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKA  387 (420)
Q Consensus       344 ~~~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f  387 (420)
                      .+..-|.||.|+..|+....+.          .-|.||.||...
T Consensus       105 ~~~~~Y~Cp~c~~r~tf~eA~~----------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       105 TNNMFFICPNMCVRFTFNEAME----------LNFTCPRCGAML  138 (158)
T ss_pred             cCCCeEECCCCCcEeeHHHHHH----------cCCcCCCCCCEe
Confidence            3445566666666666655553          136666666543


No 105
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=65.37  E-value=5.1  Score=24.60  Aligned_cols=27  Identities=26%  Similarity=0.609  Sum_probs=18.0

Q ss_pred             ceeccccCccccChhHHHHHHHHhcCCCceeccccccc
Q psy10074        171 RYVCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIYCAYR  208 (420)
Q Consensus       171 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  208 (420)
                      .|.|..|+..|.-.           ...+.+|+.|+..
T Consensus         2 ~Y~C~~Cg~~~~~~-----------~~~~irC~~CG~r   28 (44)
T smart00659        2 IYICGECGRENEIK-----------SKDVVRCRECGYR   28 (44)
T ss_pred             EEECCCCCCEeecC-----------CCCceECCCCCce
Confidence            47788888776533           3356788888754


No 106
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=64.68  E-value=3.2  Score=33.42  Aligned_cols=12  Identities=25%  Similarity=0.564  Sum_probs=6.3

Q ss_pred             cccccchhhhcc
Q psy10074         15 IKCCHCNKYISS   26 (420)
Q Consensus        15 ~~C~~C~~~f~~   26 (420)
                      |.|+.|+..|..
T Consensus       100 Y~Cp~C~~~y~~  111 (147)
T smart00531      100 YKCPNCQSKYTF  111 (147)
T ss_pred             EECcCCCCEeeH
Confidence            455555555554


No 107
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=63.74  E-value=4.1  Score=31.27  Aligned_cols=13  Identities=23%  Similarity=0.089  Sum_probs=6.5

Q ss_pred             cceecCcCCcccc
Q psy10074        347 RVHECSECGFTFF  359 (420)
Q Consensus       347 ~~~~C~~C~~~f~  359 (420)
                      .|..||.||..|.
T Consensus        25 ~p~vcP~cg~~~~   37 (129)
T TIGR02300        25 RPAVSPYTGEQFP   37 (129)
T ss_pred             CCccCCCcCCccC
Confidence            3445555555543


No 108
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=62.85  E-value=6  Score=30.60  Aligned_cols=55  Identities=24%  Similarity=0.442  Sum_probs=29.3

Q ss_pred             cCceecCCCCCccCChHHHhhhhhhhcCCcceecC---cCCccccChhhHHHHHHhhcCCCCCcccCcCccccCCHH
Q psy10074        318 EKRYVCQLCPKQFLTSGELKYHQTTVHRKRVHECS---ECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKRKF  391 (420)
Q Consensus       318 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~---~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~  391 (420)
                      .+.|+|.+|..+.....-|          +|-+|-   +|+.-   -..|+.|-. .|.     .||+|.-+|.+.+
T Consensus        78 ~~lYeCnIC~etS~ee~FL----------KPneCCgY~iCn~C---ya~LWK~~~-~yp-----vCPvCkTSFKss~  135 (140)
T PF05290_consen   78 PKLYECNICKETSAEERFL----------KPNECCGYSICNAC---YANLWKFCN-LYP-----VCPVCKTSFKSSS  135 (140)
T ss_pred             CCceeccCcccccchhhcC----------CcccccchHHHHHH---HHHHHHHcc-cCC-----CCCcccccccccc
Confidence            4557777777666554433          233331   12222   245666644 332     4888887777643


No 109
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=62.13  E-value=4.3  Score=33.79  Aligned_cols=15  Identities=20%  Similarity=0.678  Sum_probs=6.8

Q ss_pred             ceecCcCCccccChh
Q psy10074        348 VHECSECGFTFFLEK  362 (420)
Q Consensus       348 ~~~C~~C~~~f~~~~  362 (420)
                      -|.||.|+..|+...
T Consensus       117 ~Y~Cp~C~~rytf~e  131 (178)
T PRK06266        117 FFFCPNCHIRFTFDE  131 (178)
T ss_pred             EEECCCCCcEEeHHH
Confidence            344444444444433


No 110
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=61.99  E-value=5.4  Score=32.58  Aligned_cols=24  Identities=25%  Similarity=0.623  Sum_probs=15.4

Q ss_pred             ceecCCCCCccCChHHHhhhhhhhcCCcceecCcCCc
Q psy10074        320 RYVCQLCPKQFLTSGELKYHQTTVHRKRVHECSECGF  356 (420)
Q Consensus       320 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~  356 (420)
                      .|.|++||..+.             ++.|-+||+||.
T Consensus       134 ~~vC~vCGy~~~-------------ge~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYTHE-------------GEAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCccc-------------CCCCCcCCCCCC
Confidence            477777776443             345677777774


No 111
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=61.28  E-value=1.9  Score=29.71  Aligned_cols=44  Identities=11%  Similarity=0.196  Sum_probs=27.5

Q ss_pred             cccccchhhhccChHHHHHhcccccchhcccccCCccccc--chhhccccccccch
Q psy10074         15 IKCCHCNKYISSDLRDLLEHCRLCPAMTRTDLLKHKYVCY--ACSYATYYNGNMKK   68 (420)
Q Consensus        15 ~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~~C~--~C~~~f~~~~~l~~   68 (420)
                      +.|+.|+....- ...-...         ....+..++|.  +||..|.+..++..
T Consensus         2 m~CP~Cg~~a~i-rtSr~~s---------~~~~~~Y~qC~N~eCg~tF~t~es~s~   47 (72)
T PRK09678          2 FHCPLCQHAAHA-RTSRYIT---------DTTKERYHQCQNVNCSATFITYESVQR   47 (72)
T ss_pred             ccCCCCCCccEE-EEChhcC---------hhhheeeeecCCCCCCCEEEEEEEEEE
Confidence            468888866533 2222222         22456678898  89999888777643


No 112
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=61.03  E-value=4.2  Score=28.81  Aligned_cols=32  Identities=16%  Similarity=0.315  Sum_probs=21.6

Q ss_pred             cccccccchhhhccChHHHHHhcccccchhcccccCCcccccchhhcccc
Q psy10074         13 ADIKCCHCNKYISSDLRDLLEHCRLCPAMTRTDLLKHKYVCYACSYATYY   62 (420)
Q Consensus        13 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~~C~~C~~~f~~   62 (420)
                      .+|.|+.|++.  .       +         .......|.|..|++.|.-
T Consensus        34 ~~~~Cp~C~~~--~-------V---------kR~a~GIW~C~kCg~~fAG   65 (89)
T COG1997          34 AKHVCPFCGRT--T-------V---------KRIATGIWKCRKCGAKFAG   65 (89)
T ss_pred             cCCcCCCCCCc--c-------e---------eeeccCeEEcCCCCCeecc
Confidence            67888888855  2       1         2224557889999888753


No 113
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=60.67  E-value=5.4  Score=41.00  Aligned_cols=49  Identities=27%  Similarity=0.614  Sum_probs=37.2

Q ss_pred             cccccccCCCCCccccccccccCCchhhhhhcccccccccCCCCCcceeccccCccccChhHHHHHHHHhcCCCceeccc
Q psy10074        125 FVCILCNYHIPCKWCKYCKTKLDNNTEVLLQHCKLCVNVIRPDVSYRYVCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIY  204 (420)
Q Consensus       125 ~~C~~C~~~f~~~~c~~~~~~~~~~~~~l~~H~~~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~  204 (420)
                      ..|..||..+   .||.|.       ..|..|. ..    .     ...|..||..               ...|..|+.
T Consensus       436 l~C~~Cg~v~---~Cp~Cd-------~~lt~H~-~~----~-----~L~CH~Cg~~---------------~~~p~~Cp~  480 (730)
T COG1198         436 LLCRDCGYIA---ECPNCD-------SPLTLHK-AT----G-----QLRCHYCGYQ---------------EPIPQSCPE  480 (730)
T ss_pred             eecccCCCcc---cCCCCC-------cceEEec-CC----C-----eeEeCCCCCC---------------CCCCCCCCC
Confidence            4699999988   588888       6677776 22    2     6899999864               457889999


Q ss_pred             cccc
Q psy10074        205 CAYR  208 (420)
Q Consensus       205 C~~~  208 (420)
                      |+-.
T Consensus       481 Cgs~  484 (730)
T COG1198         481 CGSE  484 (730)
T ss_pred             CCCC
Confidence            9865


No 114
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=58.71  E-value=3.2  Score=35.53  Aligned_cols=25  Identities=28%  Similarity=0.550  Sum_probs=12.1

Q ss_pred             cccCcCccccCCHHHHHcccccccc
Q psy10074        378 FPCPFCEYKAKRKFELKSHMKRKHT  402 (420)
Q Consensus       378 ~~C~~C~~~f~~~~~l~~H~~~~H~  402 (420)
                      |.|+.|++.|.....++.||..+|+
T Consensus        78 ~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   78 WRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             EEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             ECCCCCCcccCChHHHHHHHhhcCH
Confidence            5555555555555555555555554


No 115
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=58.52  E-value=9.6  Score=24.04  Aligned_cols=23  Identities=35%  Similarity=0.738  Sum_probs=12.3

Q ss_pred             ecCcCCccccCh-----hhHHHHHHhhc
Q psy10074        350 ECSECGFTFFLE-----KTLRAHIRETH  372 (420)
Q Consensus       350 ~C~~C~~~f~~~-----~~L~~H~~~~H  372 (420)
                      .|..|++.++..     +.|.+|++..|
T Consensus        20 ~C~~C~~~l~~~~~~gTs~L~rHl~~~h   47 (50)
T smart00614       20 KCKYCGKKLSRSSKGGTSNLRRHLRRKH   47 (50)
T ss_pred             EecCCCCEeeeCCCCCcHHHHHHHHhHC
Confidence            455555555433     46666666433


No 116
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=58.37  E-value=4.4  Score=23.30  Aligned_cols=10  Identities=40%  Similarity=1.029  Sum_probs=7.9

Q ss_pred             ceeccccCcc
Q psy10074        171 RYVCFTCDYH  180 (420)
Q Consensus       171 ~~~C~~C~~~  180 (420)
                      ++.|+.|+..
T Consensus        22 R~vC~~Cg~I   31 (34)
T PF14803_consen   22 RLVCPACGFI   31 (34)
T ss_dssp             EEEETTTTEE
T ss_pred             ceECCCCCCE
Confidence            6889988864


No 117
>KOG2272|consensus
Probab=57.95  E-value=19  Score=31.22  Aligned_cols=16  Identities=25%  Similarity=0.766  Sum_probs=12.2

Q ss_pred             ccchhhhhhhhhhhhh
Q psy10074         88 YCLICQYCNQYFVRST  103 (420)
Q Consensus        88 ~~~~C~~C~~~f~~~~  103 (420)
                      .-|.|..|++...+..
T Consensus        98 ~CF~Cd~Cn~~Lad~g  113 (332)
T KOG2272|consen   98 ACFRCDLCNKHLADQG  113 (332)
T ss_pred             ccchhHHHHHHHhhhh
Confidence            4577888888877766


No 118
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=57.03  E-value=6.6  Score=24.52  Aligned_cols=11  Identities=27%  Similarity=1.129  Sum_probs=4.6

Q ss_pred             ccCCccchhcc
Q psy10074        288 FHCHYCDYICR  298 (420)
Q Consensus       288 ~~C~~C~~~f~  298 (420)
                      |+|..|+..+.
T Consensus         2 y~C~~CgyvYd   12 (47)
T PF00301_consen    2 YQCPVCGYVYD   12 (47)
T ss_dssp             EEETTTSBEEE
T ss_pred             cCCCCCCEEEc
Confidence            34444444433


No 119
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=56.93  E-value=7.4  Score=24.43  Aligned_cols=11  Identities=27%  Similarity=0.908  Sum_probs=5.9

Q ss_pred             ceecCCCCCcc
Q psy10074        320 RYVCQLCPKQF  330 (420)
Q Consensus       320 ~~~C~~C~~~f  330 (420)
                      .|.|..|++.|
T Consensus         6 ~Y~C~~Cg~~~   16 (49)
T COG1996           6 EYKCARCGREV   16 (49)
T ss_pred             EEEhhhcCCee
Confidence            35555555555


No 120
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=56.09  E-value=6.9  Score=20.19  Aligned_cols=6  Identities=33%  Similarity=0.993  Sum_probs=2.7

Q ss_pred             ccccCc
Q psy10074        174 CFTCDY  179 (420)
Q Consensus       174 C~~C~~  179 (420)
                      |+.||.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            444443


No 121
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=55.15  E-value=5.7  Score=22.08  Aligned_cols=9  Identities=44%  Similarity=1.165  Sum_probs=4.3

Q ss_pred             ceecCcCCc
Q psy10074        348 VHECSECGF  356 (420)
Q Consensus       348 ~~~C~~C~~  356 (420)
                      .|.|+.|+.
T Consensus        19 ~~vCp~C~~   27 (30)
T PF08274_consen   19 LLVCPECGH   27 (30)
T ss_dssp             SEEETTTTE
T ss_pred             EEeCCcccc
Confidence            445555543


No 122
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=54.32  E-value=11  Score=33.61  Aligned_cols=20  Identities=25%  Similarity=0.406  Sum_probs=10.5

Q ss_pred             ceecCcCCccccChhhHHHH
Q psy10074        348 VHECSECGFTFFLEKTLRAH  367 (420)
Q Consensus       348 ~~~C~~C~~~f~~~~~L~~H  367 (420)
                      .|+|+.|...|-.--....|
T Consensus       388 rY~Ce~CK~~FC~dCdvfiH  407 (421)
T COG5151         388 RYQCELCKSTFCSDCDVFIH  407 (421)
T ss_pred             ceechhhhhhhhhhhHHHHH
Confidence            35555555555554444444


No 123
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=53.68  E-value=7.2  Score=29.99  Aligned_cols=33  Identities=18%  Similarity=0.322  Sum_probs=22.2

Q ss_pred             eecCcCCccccChhhHHHHHHhhcCCCCCcccCcCccccCCHHHH
Q psy10074        349 HECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKRKFEL  393 (420)
Q Consensus       349 ~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l  393 (420)
                      ..|+.||..|...            +..|..|++||..|.-...+
T Consensus        10 r~Cp~cg~kFYDL------------nk~p~vcP~cg~~~~~~~~~   42 (129)
T TIGR02300        10 RICPNTGSKFYDL------------NRRPAVSPYTGEQFPPEEAL   42 (129)
T ss_pred             ccCCCcCcccccc------------CCCCccCCCcCCccCcchhh
Confidence            4688888887653            22577788888887655333


No 124
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=53.58  E-value=13  Score=22.32  Aligned_cols=25  Identities=24%  Similarity=0.246  Sum_probs=20.2

Q ss_pred             ceeccccCcccc--ChhHHHHHHHHhc
Q psy10074        171 RYVCFTCDYHSF--CSSHMKDHIRVHL  195 (420)
Q Consensus       171 ~~~C~~C~~~f~--~~~~l~~H~~~h~  195 (420)
                      ...|+.|++.|.  .++.-..|.+.|.
T Consensus        13 ~~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   13 ATTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             CcCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            358999999886  5778888988874


No 125
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=53.53  E-value=8  Score=20.55  Aligned_cols=7  Identities=29%  Similarity=0.748  Sum_probs=3.3

Q ss_pred             ccccccC
Q psy10074        126 VCILCNY  132 (420)
Q Consensus       126 ~C~~C~~  132 (420)
                      .|+.||.
T Consensus         4 ~Cp~Cg~   10 (26)
T PF13248_consen    4 FCPNCGA   10 (26)
T ss_pred             CCcccCC
Confidence            3445554


No 126
>KOG4124|consensus
Probab=52.16  E-value=5.2  Score=36.26  Aligned_cols=117  Identities=16%  Similarity=0.190  Sum_probs=0.0

Q ss_pred             CCCCccCCc--cchhccChhHHhhhhhcccCCcccccCceecCCCCCccCChHHHhhhhhhhcCC---------------
Q psy10074        284 GEKPFHCHY--CDYICRTKYDLSSHIGRKHTDKEVLEKRYVCQLCPKQFLTSGELKYHQTTVHRK---------------  346 (420)
Q Consensus       284 ~~~~~~C~~--C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~---------------  346 (420)
                      .+.++.|+.  |.+..........|-...|...+....+|+|+ |+....++..|..|-..-+..               
T Consensus       175 EE~~~S~~vp~~~~~~~~~Ns~~~~S~~~~~T~~t~~~p~k~~-~~~~~~T~~~l~~HS~N~~~~~Sa~n~~~~~Q~~~~  253 (442)
T KOG4124|consen  175 EEYRVSVVVPAAAAAAAAANSSDMSSDEASSTAETTGTPKKMP-ESLVMDTSSPLSDHSMNIDVGESAANNVFAFQQKDM  253 (442)
T ss_pred             ccccccccCchhhhhhhccccccccccccccccccccCCccCc-ccccccccchhhhccccCCCCccHHHHHHHHhhccc


Q ss_pred             --------------------------------------------------------------------------------
Q psy10074        347 --------------------------------------------------------------------------------  346 (420)
Q Consensus       347 --------------------------------------------------------------------------------  346 (420)
                                                                                                      
T Consensus       254 ~~st~~~~~~~~h~~~~~~~~~~s~~~~~~s~~~ptp~v~~~a~~~s~~~~p~v~~~s~~~~~~~s~~~~s~~~~~~~~~  333 (442)
T KOG4124|consen  254 VDSTYLPPFNYDHDVFSFAPSVASADQFTESSMSPTPEVVSPAATNSAISSPFVRKSSSDLEAKPSKKQRSTPAFSHDSP  333 (442)
T ss_pred             ccccccCCcCccchhhhhhhhhhccccccccCCCCCcccccccccccccCCCceeeccCCcccCcchhccCcccccCCCc


Q ss_pred             --------------cceecCc--CCccccChhhHHHHHHhhc------------------CCCCCcccCcCccccCCHHH
Q psy10074        347 --------------RVHECSE--CGFTFFLEKTLRAHIRETH------------------RKETPFPCPFCEYKAKRKFE  392 (420)
Q Consensus       347 --------------~~~~C~~--C~~~f~~~~~L~~H~~~~H------------------~~~~~~~C~~C~~~f~~~~~  392 (420)
                                    ++|.|++  |.+.+.....|..|....|                  .-.++|.|++|.+++...-.
T Consensus       334 ~~~~~~~~~~~~~~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~  413 (442)
T KOG4124|consen  334 LTIDYPGSNLVVVDKPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNG  413 (442)
T ss_pred             eeeecCCCeEEEecCCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCC


Q ss_pred             HHccccccc
Q psy10074        393 LKSHMKRKH  401 (420)
Q Consensus       393 l~~H~~~~H  401 (420)
                      |..|+...|
T Consensus       414 l~~~~~~~~  422 (442)
T KOG4124|consen  414 LKYHRTHSH  422 (442)
T ss_pred             CCceeehhh


No 127
>KOG2593|consensus
Probab=51.92  E-value=6.9  Score=36.82  Aligned_cols=35  Identities=17%  Similarity=0.214  Sum_probs=16.1

Q ss_pred             cccccchhhccccccccchhhhhccCCCCccccccccc
Q psy10074         50 KYVCYACSYATYYNGNMKKHLRIHLGDRPFMCTLLICQ   87 (420)
Q Consensus        50 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~   87 (420)
                      .|.|+.|++.|.....+   ...-.....|.|..|++.
T Consensus       128 ~Y~Cp~C~kkyt~Lea~---~L~~~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  128 GYVCPNCQKKYTSLEAL---QLLDNETGEFHCENCGGE  162 (436)
T ss_pred             cccCCccccchhhhHHH---HhhcccCceEEEecCCCc
Confidence            35666666655544433   222222334555444443


No 128
>KOG2272|consensus
Probab=51.57  E-value=15  Score=31.73  Aligned_cols=20  Identities=15%  Similarity=0.363  Sum_probs=12.5

Q ss_pred             HhcCCCceecccccccccCH
Q psy10074        193 VHLGEKPYMCIYCAYRCTQK  212 (420)
Q Consensus       193 ~h~~~~~~~C~~C~~~f~~~  212 (420)
                      .|.-..-|.|..|.+.|-..
T Consensus       215 KhWHveHFvCa~CekPFlGH  234 (332)
T KOG2272|consen  215 KHWHVEHFVCAKCEKPFLGH  234 (332)
T ss_pred             cccchhheeehhcCCcccch
Confidence            34444557788787777653


No 129
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=51.30  E-value=5.5  Score=34.56  Aligned_cols=18  Identities=17%  Similarity=0.189  Sum_probs=9.1

Q ss_pred             CCCCcccccccccCCCCC
Q psy10074        119 SDANFNFVCILCNYHIPC  136 (420)
Q Consensus       119 h~~~~~~~C~~C~~~f~~  136 (420)
                      |.-+....|..|++.-.+
T Consensus        33 ~pcN~~MeCdkC~r~QKn   50 (314)
T PF06524_consen   33 HPCNALMECDKCQRKQKN   50 (314)
T ss_pred             CCCCccccchhhhhhccc
Confidence            444444556666554433


No 130
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=51.10  E-value=9.5  Score=31.17  Aligned_cols=25  Identities=36%  Similarity=0.836  Sum_probs=19.2

Q ss_pred             ceeccccCccccChhHHHHHHHHhcCCCceeccccccc
Q psy10074        171 RYVCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIYCAYR  208 (420)
Q Consensus       171 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  208 (420)
                      .+.|++||..+             .++.|-+||+|+..
T Consensus       134 ~~vC~vCGy~~-------------~ge~P~~CPiCga~  158 (166)
T COG1592         134 VWVCPVCGYTH-------------EGEAPEVCPICGAP  158 (166)
T ss_pred             EEEcCCCCCcc-------------cCCCCCcCCCCCCh
Confidence            58899998764             36778899999843


No 131
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=49.36  E-value=8.9  Score=24.30  Aligned_cols=9  Identities=44%  Similarity=1.283  Sum_probs=3.6

Q ss_pred             cCCccchhc
Q psy10074        289 HCHYCDYIC  297 (420)
Q Consensus       289 ~C~~C~~~f  297 (420)
                      .|..|+..+
T Consensus         3 ~C~~CgyiY   11 (50)
T cd00730           3 ECRICGYIY   11 (50)
T ss_pred             CCCCCCeEE
Confidence            344444333


No 132
>KOG2186|consensus
Probab=49.01  E-value=14  Score=32.00  Aligned_cols=50  Identities=16%  Similarity=0.327  Sum_probs=34.7

Q ss_pred             ceeccccCccccChhHHHHHHHHhcCCCceecccccccccCHHHHHHHHhhcc
Q psy10074        171 RYVCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIYCAYRCTQKSDLKKHLRKKH  223 (420)
Q Consensus       171 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h  223 (420)
                      -|.|..||....-+ .+.+|+-.-++ ..|.|--|+..|.. .++..|.+--.
T Consensus         3 ~FtCnvCgEsvKKp-~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kCIT   52 (276)
T KOG2186|consen    3 FFTCNVCGESVKKP-QVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKCIT   52 (276)
T ss_pred             EEehhhhhhhcccc-chHHHHHhccC-CeeEEeeccccccc-chhhhhhhhcc
Confidence            47788888766544 34448776655 66888888888876 77777865433


No 133
>PF14353 CpXC:  CpXC protein
Probab=48.12  E-value=3.1  Score=32.57  Aligned_cols=22  Identities=14%  Similarity=0.239  Sum_probs=16.0

Q ss_pred             cccccchhhccccccccchhhh
Q psy10074         50 KYVCYACSYATYYNGNMKKHLR   71 (420)
Q Consensus        50 ~~~C~~C~~~f~~~~~l~~H~~   71 (420)
                      .+.|+.||..|.-...+.-|-.
T Consensus        38 ~~~CP~Cg~~~~~~~p~lY~D~   59 (128)
T PF14353_consen   38 SFTCPSCGHKFRLEYPLLYHDP   59 (128)
T ss_pred             EEECCCCCCceecCCCEEEEcC
Confidence            4888888888877777666643


No 134
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=46.55  E-value=17  Score=39.39  Aligned_cols=22  Identities=23%  Similarity=0.377  Sum_probs=17.7

Q ss_pred             cccccccCCCCCcccccccccc
Q psy10074        125 FVCILCNYHIPCKWCKYCKTKL  146 (420)
Q Consensus       125 ~~C~~C~~~f~~~~c~~~~~~~  146 (420)
                      +.|+.||.......|+.||...
T Consensus       668 rkCPkCG~~t~~~fCP~CGs~t  689 (1337)
T PRK14714        668 RRCPSCGTETYENRCPDCGTHT  689 (1337)
T ss_pred             EECCCCCCccccccCcccCCcC
Confidence            7899999876666899999553


No 135
>KOG2807|consensus
Probab=46.24  E-value=23  Score=32.02  Aligned_cols=20  Identities=25%  Similarity=0.489  Sum_probs=10.6

Q ss_pred             ceecCcCCccccChhhHHHH
Q psy10074        348 VHECSECGFTFFLEKTLRAH  367 (420)
Q Consensus       348 ~~~C~~C~~~f~~~~~L~~H  367 (420)
                      .|.|..|...|-.--....|
T Consensus       345 ~y~C~~Ck~~FCldCDv~iH  364 (378)
T KOG2807|consen  345 RYRCESCKNVFCLDCDVFIH  364 (378)
T ss_pred             cEEchhccceeeccchHHHH
Confidence            45566665555544444444


No 136
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=44.97  E-value=8.8  Score=22.83  Aligned_cols=15  Identities=13%  Similarity=0.022  Sum_probs=9.6

Q ss_pred             CccccccchhhhccC
Q psy10074        406 SLTTEETEYYKILEH  420 (420)
Q Consensus       406 ~~~C~~C~~~f~~~~  420 (420)
                      +++|..|++.|-++|
T Consensus        12 ~f~C~~C~~~FC~~H   26 (39)
T smart00154       12 GFKCRHCGNLFCGEH   26 (39)
T ss_pred             CeECCccCCcccccc
Confidence            566777777666554


No 137
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=44.61  E-value=9.5  Score=23.17  Aligned_cols=15  Identities=20%  Similarity=0.428  Sum_probs=9.0

Q ss_pred             cCCcccccchhhccc
Q psy10074         47 LKHKYVCYACSYATY   61 (420)
Q Consensus        47 ~~~~~~C~~C~~~f~   61 (420)
                      ....+.|+.||.+..
T Consensus        16 ~~g~~vC~~CG~Vl~   30 (43)
T PF08271_consen   16 ERGELVCPNCGLVLE   30 (43)
T ss_dssp             TTTEEEETTT-BBEE
T ss_pred             CCCeEECCCCCCEee
Confidence            345578888876643


No 138
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=43.59  E-value=11  Score=23.87  Aligned_cols=13  Identities=23%  Similarity=0.963  Sum_probs=10.5

Q ss_pred             Ccccccchhhccc
Q psy10074         49 HKYVCYACSYATY   61 (420)
Q Consensus        49 ~~~~C~~C~~~f~   61 (420)
                      ..+.|..||+++.
T Consensus        36 ~r~~C~~Cgyt~~   48 (50)
T PRK00432         36 DRWHCGKCGYTEF   48 (50)
T ss_pred             CcEECCCcCCEEe
Confidence            5789999998764


No 139
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=43.53  E-value=18  Score=31.03  Aligned_cols=26  Identities=31%  Similarity=0.479  Sum_probs=15.5

Q ss_pred             ceecCcCCccccChhhHHHHHHhhcC
Q psy10074        348 VHECSECGFTFFLEKTLRAHIRETHR  373 (420)
Q Consensus       348 ~~~C~~C~~~f~~~~~L~~H~~~~H~  373 (420)
                      -|.|+.|++.|........|+...|.
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             EECCCCCCcccCChHHHHHHHhhcCH
Confidence            46677777777777777777766664


No 140
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=43.45  E-value=13  Score=19.47  Aligned_cols=8  Identities=38%  Similarity=1.186  Sum_probs=4.0

Q ss_pred             ceecCcCC
Q psy10074        348 VHECSECG  355 (420)
Q Consensus       348 ~~~C~~C~  355 (420)
                      +|.||.||
T Consensus        16 ~f~CPnCG   23 (24)
T PF07754_consen   16 PFPCPNCG   23 (24)
T ss_pred             eEeCCCCC
Confidence            35555554


No 141
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=41.93  E-value=11  Score=21.32  Aligned_cols=10  Identities=20%  Similarity=0.467  Sum_probs=5.3

Q ss_pred             ceeccccCcc
Q psy10074        171 RYVCFTCDYH  180 (420)
Q Consensus       171 ~~~C~~C~~~  180 (420)
                      +.+|+.||..
T Consensus        17 ~irC~~CG~R   26 (32)
T PF03604_consen   17 PIRCPECGHR   26 (32)
T ss_dssp             TSSBSSSS-S
T ss_pred             cEECCcCCCe
Confidence            3466666654


No 142
>KOG2593|consensus
Probab=41.53  E-value=21  Score=33.71  Aligned_cols=17  Identities=12%  Similarity=0.235  Sum_probs=8.0

Q ss_pred             cceecCcCCccccChhh
Q psy10074        347 RVHECSECGFTFFLEKT  363 (420)
Q Consensus       347 ~~~~C~~C~~~f~~~~~  363 (420)
                      ..|.||.|.+.|+....
T Consensus       127 ~~Y~Cp~C~kkyt~Lea  143 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTSLEA  143 (436)
T ss_pred             ccccCCccccchhhhHH
Confidence            34555555555544433


No 143
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=40.98  E-value=16  Score=36.14  Aligned_cols=49  Identities=27%  Similarity=0.670  Sum_probs=34.6

Q ss_pred             cccccccCCCCCccccccccccCCchhhhhhcccccccccCCCCCcceeccccCccccChhHHHHHHHHhcCCCceeccc
Q psy10074        125 FVCILCNYHIPCKWCKYCKTKLDNNTEVLLQHCKLCVNVIRPDVSYRYVCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIY  204 (420)
Q Consensus       125 ~~C~~C~~~f~~~~c~~~~~~~~~~~~~l~~H~~~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~  204 (420)
                      ..|..||...   .|+.|+       ..|..|.     ...     ...|..||...               ..+..|+.
T Consensus       214 ~~C~~Cg~~~---~C~~C~-------~~l~~h~-----~~~-----~l~Ch~Cg~~~---------------~~~~~Cp~  258 (505)
T TIGR00595       214 LLCRSCGYIL---CCPNCD-------VSLTYHK-----KEG-----KLRCHYCGYQE---------------PIPKTCPQ  258 (505)
T ss_pred             eEhhhCcCcc---CCCCCC-------CceEEec-----CCC-----eEEcCCCcCcC---------------CCCCCCCC
Confidence            4699999887   588887       5666664     222     57899998653               35678998


Q ss_pred             cccc
Q psy10074        205 CAYR  208 (420)
Q Consensus       205 C~~~  208 (420)
                      |+..
T Consensus       259 C~s~  262 (505)
T TIGR00595       259 CGSE  262 (505)
T ss_pred             CCCC
Confidence            8753


No 144
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=38.92  E-value=20  Score=27.30  Aligned_cols=39  Identities=10%  Similarity=0.225  Sum_probs=17.4

Q ss_pred             cccCcCccccCCHHHHHccccccccCCCCccccccchhh
Q psy10074        378 FPCPFCEYKAKRKFELKSHMKRKHTFEDSLTTEETEYYK  416 (420)
Q Consensus       378 ~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f  416 (420)
                      .+||+|..+-.....+.-=+---|..+.|..|..||.-|
T Consensus        40 ~qcp~csasirgd~~vegvlglg~dye~psfchncgs~f   78 (160)
T COG4306          40 TQCPICSASIRGDYYVEGVLGLGGDYEPPSFCHNCGSRF   78 (160)
T ss_pred             hcCCccCCcccccceeeeeeccCCCCCCcchhhcCCCCC
Confidence            456666655443222211111223334455566666655


No 145
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=38.91  E-value=16  Score=23.92  Aligned_cols=39  Identities=18%  Similarity=0.364  Sum_probs=24.6

Q ss_pred             ccccchhh-hccChHHHHHhcccccchhcccccCCcccccchhhcccc
Q psy10074         16 KCCHCNKY-ISSDLRDLLEHCRLCPAMTRTDLLKHKYVCYACSYATYY   62 (420)
Q Consensus        16 ~C~~C~~~-f~~~~~~l~~H~~~~~~~~~~~~~~~~~~C~~C~~~f~~   62 (420)
                      +|.+|++. +.+ ...|..-       .......+.|.|++|......
T Consensus         4 kCiiCd~v~~iD-~rt~~tK-------rLrN~PIrtymC~eC~~Rva~   43 (68)
T COG4896           4 KCIICDRVDEID-NRTFKTK-------RLRNKPIRTYMCPECEHRVAI   43 (68)
T ss_pred             eEEEecceeeec-chhHHHH-------HhhCCCceeEechhhHhhhch
Confidence            58888876 444 5555554       334445667889988765543


No 146
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=38.33  E-value=17  Score=21.71  Aligned_cols=32  Identities=19%  Similarity=0.621  Sum_probs=16.0

Q ss_pred             ccccccchhhhccChHHHHHhcccccchhcccccCCcccccchhhc
Q psy10074         14 DIKCCHCNKYISSDLRDLLEHCRLCPAMTRTDLLKHKYVCYACSYA   59 (420)
Q Consensus        14 ~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~~C~~C~~~   59 (420)
                      |.+|..|+..+.- .             .......+.|.|..|+..
T Consensus         2 p~rC~~C~aylNp-~-------------~~~~~~~~~w~C~~C~~~   33 (40)
T PF04810_consen    2 PVRCRRCRAYLNP-F-------------CQFDDGGKTWICNFCGTK   33 (40)
T ss_dssp             S-B-TTT--BS-T-T-------------SEEETTTTEEEETTT--E
T ss_pred             ccccCCCCCEECC-c-------------ceEcCCCCEEECcCCCCc
Confidence            5677777766665 2             334444567888888865


No 147
>KOG1280|consensus
Probab=38.26  E-value=22  Score=32.44  Aligned_cols=40  Identities=25%  Similarity=0.672  Sum_probs=31.2

Q ss_pred             CCcceecCcCCccccChhhHHHHHHhhcCCCCC-cccCcCc
Q psy10074        345 RKRVHECSECGFTFFLEKTLRAHIRETHRKETP-FPCPFCE  384 (420)
Q Consensus       345 ~~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~-~~C~~C~  384 (420)
                      ....|.|++|+..=.+...|..|+...|....+ ..|++|.
T Consensus        76 ~~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   76 DPQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             ccccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            345799999999888899999999988876543 4466664


No 148
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=38.00  E-value=13  Score=20.29  Aligned_cols=9  Identities=33%  Similarity=0.689  Sum_probs=4.4

Q ss_pred             cccchhhcc
Q psy10074         52 VCYACSYAT   60 (420)
Q Consensus        52 ~C~~C~~~f   60 (420)
                      .|-.|++.|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            344555555


No 149
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=37.97  E-value=6.3  Score=28.39  Aligned_cols=14  Identities=14%  Similarity=0.351  Sum_probs=10.5

Q ss_pred             CCcccccchhhccc
Q psy10074         48 KHKYVCYACSYATY   61 (420)
Q Consensus        48 ~~~~~C~~C~~~f~   61 (420)
                      ...|.|..|++.|.
T Consensus        52 ~GIW~C~~C~~~~A   65 (90)
T PTZ00255         52 VGIWRCKGCKKTVA   65 (90)
T ss_pred             eEEEEcCCCCCEEe
Confidence            45788888888775


No 150
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=37.05  E-value=7.3  Score=22.73  Aligned_cols=15  Identities=20%  Similarity=0.596  Sum_probs=9.3

Q ss_pred             hcccccCCcccccch
Q psy10074         42 TRTDLLKHKYVCYAC   56 (420)
Q Consensus        42 ~~~~~~~~~~~C~~C   56 (420)
                      =....+..+|.|..|
T Consensus        21 G~~~~G~qryrC~~C   35 (36)
T PF03811_consen   21 GKSPSGHQRYRCKDC   35 (36)
T ss_pred             CCCCCCCEeEecCcC
Confidence            445555666777766


No 151
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=36.67  E-value=26  Score=21.26  Aligned_cols=21  Identities=38%  Similarity=1.053  Sum_probs=14.2

Q ss_pred             eecccccccccCHHHHHHHHh
Q psy10074        200 YMCIYCAYRCTQKSDLKKHLR  220 (420)
Q Consensus       200 ~~C~~C~~~f~~~~~l~~H~~  220 (420)
                      |+|-.|.+....++.|..||+
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            566666666666777777765


No 152
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=35.65  E-value=23  Score=28.41  Aligned_cols=10  Identities=20%  Similarity=0.471  Sum_probs=4.9

Q ss_pred             eeccccCccc
Q psy10074        172 YVCFTCDYHS  181 (420)
Q Consensus       172 ~~C~~C~~~f  181 (420)
                      +.|+.|++.|
T Consensus       125 ~~C~~C~kiy  134 (147)
T PF01927_consen  125 WRCPGCGKIY  134 (147)
T ss_pred             EECCCCCCEe
Confidence            4455555444


No 153
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=35.53  E-value=27  Score=33.82  Aligned_cols=29  Identities=21%  Similarity=0.426  Sum_probs=24.1

Q ss_pred             cceecCcCCccccChhhHHHHHHhhcCCC
Q psy10074        347 RVHECSECGFTFFLEKTLRAHIRETHRKE  375 (420)
Q Consensus       347 ~~~~C~~C~~~f~~~~~L~~H~~~~H~~~  375 (420)
                      +-|.|+.|.+.|.+...+..|+...|.+.
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            34789999999999999999998888654


No 154
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=34.90  E-value=9.4  Score=27.88  Aligned_cols=11  Identities=0%  Similarity=-0.324  Sum_probs=5.4

Q ss_pred             ccccccchhhh
Q psy10074        407 LTTEETEYYKI  417 (420)
Q Consensus       407 ~~C~~C~~~f~  417 (420)
                      ..|..||..|.
T Consensus        47 ~~Cg~CGls~e   57 (104)
T COG4888          47 AVCGNCGLSFE   57 (104)
T ss_pred             EEcccCcceEE
Confidence            44555555443


No 155
>KOG1701|consensus
Probab=34.52  E-value=9.8  Score=35.70  Aligned_cols=47  Identities=13%  Similarity=0.283  Sum_probs=23.1

Q ss_pred             cccccchhhccccccccchhhhhccCCCCcccccccccccchhhhhhhhhhhhh
Q psy10074         50 KYVCYACSYATYYNGNMKKHLRIHLGDRPFMCTLLICQYCLICQYCNQYFVRST  103 (420)
Q Consensus        50 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~~~~~C~~C~~~f~~~~  103 (420)
                      =|+|..|++...-++-+..-      .++ .|+-|-....-+|..||....++.
T Consensus       302 CFtC~~C~r~L~Gq~FY~v~------~k~-~CE~cyq~tlekC~~Cg~~I~d~i  348 (468)
T KOG1701|consen  302 CFTCRTCRRQLAGQSFYQVD------GKP-YCEGCYQDTLEKCNKCGEPIMDRI  348 (468)
T ss_pred             ceehHhhhhhhccccccccC------Ccc-cchHHHHHHHHHHhhhhhHHHHHH
Confidence            37777776654333222211      122 233333334456677777666553


No 156
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=34.45  E-value=16  Score=28.65  Aligned_cols=28  Identities=32%  Similarity=0.644  Sum_probs=18.0

Q ss_pred             CCcccccchhhccccccccchhhhhccCCCC
Q psy10074         48 KHKYVCYACSYATYYNGNMKKHLRIHLGDRP   78 (420)
Q Consensus        48 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~   78 (420)
                      .....|-+||+.|.   .|.+|+..|++..|
T Consensus        70 ~d~i~clecGk~~k---~LkrHL~~~~gltp   97 (132)
T PF05443_consen   70 PDYIICLECGKKFK---TLKRHLRTHHGLTP   97 (132)
T ss_dssp             SS-EE-TBT--EES---BHHHHHHHTT-S-H
T ss_pred             cCeeEEccCCcccc---hHHHHHHHccCCCH
Confidence            34589999999998   45899999987665


No 157
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=33.78  E-value=23  Score=22.29  Aligned_cols=12  Identities=42%  Similarity=1.049  Sum_probs=9.0

Q ss_pred             ceeccccCcccc
Q psy10074        171 RYVCFTCDYHSF  182 (420)
Q Consensus       171 ~~~C~~C~~~f~  182 (420)
                      .+.|+.|+..+.
T Consensus        20 ~~vC~~Cg~~~~   31 (52)
T smart00661       20 RFVCRKCGYEEP   31 (52)
T ss_pred             EEECCcCCCeEE
Confidence            578888887654


No 158
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=33.72  E-value=11  Score=22.85  Aligned_cols=15  Identities=13%  Similarity=0.115  Sum_probs=8.0

Q ss_pred             CccccccchhhhccC
Q psy10074        406 SLTTEETEYYKILEH  420 (420)
Q Consensus       406 ~~~C~~C~~~f~~~~  420 (420)
                      ++.|..|+..|-.+|
T Consensus        13 ~~~C~~C~~~FC~~H   27 (43)
T PF01428_consen   13 PFKCKHCGKSFCLKH   27 (43)
T ss_dssp             HEE-TTTS-EE-TTT
T ss_pred             CeECCCCCcccCccc
Confidence            566777777776654


No 159
>KOG4167|consensus
Probab=33.63  E-value=12  Score=37.80  Aligned_cols=28  Identities=14%  Similarity=0.355  Sum_probs=24.9

Q ss_pred             CCcccccchhhccccccccchhhhhccC
Q psy10074         48 KHKYVCYACSYATYYNGNMKKHLRIHLG   75 (420)
Q Consensus        48 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~   75 (420)
                      ...|.|.+|++.|....++..||+.|..
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            3469999999999999999999999963


No 160
>KOG1280|consensus
Probab=33.59  E-value=37  Score=31.11  Aligned_cols=38  Identities=18%  Similarity=0.418  Sum_probs=30.0

Q ss_pred             cCceecCCCCCccCChHHHhhhhhhhcCCcc--eecCcCC
Q psy10074        318 EKRYVCQLCPKQFLTSGELKYHQTTVHRKRV--HECSECG  355 (420)
Q Consensus       318 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~--~~C~~C~  355 (420)
                      ...|.|++|+..-.+...|..|+...|.+.+  ..|++|+
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            4579999999999999999999988775543  3566664


No 161
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=33.50  E-value=17  Score=24.98  Aligned_cols=8  Identities=13%  Similarity=0.293  Sum_probs=3.1

Q ss_pred             cCCccchh
Q psy10074        289 HCHYCDYI  296 (420)
Q Consensus       289 ~C~~C~~~  296 (420)
                      +++-|++.
T Consensus        12 ~~~cC~~~   19 (71)
T PF05495_consen   12 RFPCCGKY   19 (71)
T ss_dssp             EETTTTEE
T ss_pred             ECCcccCe
Confidence            33334433


No 162
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=33.26  E-value=21  Score=23.05  Aligned_cols=8  Identities=50%  Similarity=1.190  Sum_probs=3.6

Q ss_pred             ecCcCCcc
Q psy10074        350 ECSECGFT  357 (420)
Q Consensus       350 ~C~~C~~~  357 (420)
                      .|+.||..
T Consensus        24 ~Cp~CGae   31 (54)
T TIGR01206        24 ICDECGAE   31 (54)
T ss_pred             eCCCCCCE
Confidence            44444443


No 163
>KOG2907|consensus
Probab=32.75  E-value=21  Score=26.71  Aligned_cols=11  Identities=45%  Similarity=1.286  Sum_probs=6.3

Q ss_pred             cccCcCccccC
Q psy10074        378 FPCPFCEYKAK  388 (420)
Q Consensus       378 ~~C~~C~~~f~  388 (420)
                      |.|+.|++.|+
T Consensus       103 YTC~kC~~k~~  113 (116)
T KOG2907|consen  103 YTCPKCKYKFT  113 (116)
T ss_pred             EEcCccceeee
Confidence            55666665554


No 164
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=32.64  E-value=18  Score=24.46  Aligned_cols=9  Identities=44%  Similarity=1.117  Sum_probs=3.0

Q ss_pred             ecCcCCccc
Q psy10074        350 ECSECGFTF  358 (420)
Q Consensus       350 ~C~~C~~~f  358 (420)
                      .|..|++.|
T Consensus        11 ~C~~C~~~F   19 (69)
T PF01363_consen   11 NCMICGKKF   19 (69)
T ss_dssp             B-TTT--B-
T ss_pred             cCcCcCCcC
Confidence            566666666


No 165
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=32.51  E-value=14  Score=37.33  Aligned_cols=79  Identities=16%  Similarity=0.243  Sum_probs=51.1

Q ss_pred             chhhhhhhhhhhhhhhhhhhcccccccccCCCCcccccccccCCCCCccccccccccCCchhhhhhcccccccccCCCCC
Q psy10074         90 LICQYCNQYFVRSTQDILQHGKVCNFAPRSDANFNFVCILCNYHIPCKWCKYCKTKLDNNTEVLLQHCKLCVNVIRPDVS  169 (420)
Q Consensus        90 ~~C~~C~~~f~~~~~~l~~H~~~~~~~~~h~~~~~~~C~~C~~~f~~~~c~~~~~~~~~~~~~l~~H~~~~h~~~~~~~~  169 (420)
                      -.|..|-+...+.. +-+.+.-            -..|..||-+|..-             ..|..=  +......    
T Consensus       102 a~C~~Cl~Ei~dp~-~rrY~YP------------F~~CT~CGPRfTIi-------------~alPYD--R~nTsM~----  149 (750)
T COG0068         102 ATCEDCLEEIFDPN-SRRYLYP------------FINCTNCGPRFTII-------------EALPYD--RENTSMA----  149 (750)
T ss_pred             hhhHHHHHHhcCCC-Ccceecc------------ccccCCCCcceeee-------------ccCCCC--cccCccc----
Confidence            35688888777765 2222211            13499999999877             555443  2222222    


Q ss_pred             cce-eccccCccccChhHHHHHHHHhcCCCceecccccc
Q psy10074        170 YRY-VCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIYCAY  207 (420)
Q Consensus       170 ~~~-~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~  207 (420)
                       .| -|+.|.+.|.++.+-+-|.      ++..|+.|+-
T Consensus       150 -~F~lC~~C~~EY~dP~nRRfHA------Qp~aCp~CGP  181 (750)
T COG0068         150 -DFPLCPFCDKEYKDPLNRRFHA------QPIACPKCGP  181 (750)
T ss_pred             -cCcCCHHHHHHhcCcccccccc------ccccCcccCC
Confidence             23 6999999998888877764      6788999975


No 166
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=32.50  E-value=22  Score=26.38  Aligned_cols=12  Identities=17%  Similarity=0.393  Sum_probs=5.8

Q ss_pred             CCcccCcCcccc
Q psy10074        376 TPFPCPFCEYKA  387 (420)
Q Consensus       376 ~~~~C~~C~~~f  387 (420)
                      .|..||+||++|
T Consensus        25 dPiVsPytG~s~   36 (129)
T COG4530          25 DPIVSPYTGKSY   36 (129)
T ss_pred             CccccCcccccc
Confidence            344455555544


No 167
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=32.28  E-value=32  Score=31.43  Aligned_cols=14  Identities=21%  Similarity=0.420  Sum_probs=7.4

Q ss_pred             cCCcceecCcCCcc
Q psy10074        344 HRKRVHECSECGFT  357 (420)
Q Consensus       344 ~~~~~~~C~~C~~~  357 (420)
                      .|.+-..|..|+-.
T Consensus       208 ~G~RyL~CslC~te  221 (309)
T PRK03564        208 QGLRYLHCNLCESE  221 (309)
T ss_pred             CCceEEEcCCCCCc
Confidence            34455566666544


No 168
>PRK14873 primosome assembly protein PriA; Provisional
Probab=32.23  E-value=24  Score=36.29  Aligned_cols=46  Identities=20%  Similarity=0.424  Sum_probs=0.0

Q ss_pred             cccccccCCCCCccccccccccCCchhhhhhcccccccccCCCCCcceeccccCccccChhHHHHHHHHhcCCCceeccc
Q psy10074        125 FVCILCNYHIPCKWCKYCKTKLDNNTEVLLQHCKLCVNVIRPDVSYRYVCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIY  204 (420)
Q Consensus       125 ~~C~~C~~~f~~~~c~~~~~~~~~~~~~l~~H~~~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~  204 (420)
                      ..|..||..+   .|+.|+       ..|..|. ...         ...|..||...                .+..|+.
T Consensus       384 l~C~~Cg~~~---~C~~C~-------~~L~~h~-~~~---------~l~Ch~CG~~~----------------~p~~Cp~  427 (665)
T PRK14873        384 LACARCRTPA---RCRHCT-------GPLGLPS-AGG---------TPRCRWCGRAA----------------PDWRCPR  427 (665)
T ss_pred             eEhhhCcCee---ECCCCC-------CceeEec-CCC---------eeECCCCcCCC----------------cCccCCC


Q ss_pred             cc
Q psy10074        205 CA  206 (420)
Q Consensus       205 C~  206 (420)
                      |+
T Consensus       428 Cg  429 (665)
T PRK14873        428 CG  429 (665)
T ss_pred             Cc


No 169
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=32.03  E-value=8.9  Score=27.19  Aligned_cols=14  Identities=14%  Similarity=0.235  Sum_probs=6.3

Q ss_pred             Ccccccchhhcccc
Q psy10074         49 HKYVCYACSYATYY   62 (420)
Q Consensus        49 ~~~~C~~C~~~f~~   62 (420)
                      ....|..|+..|.+
T Consensus        45 ~~~~C~~Cg~~~~~   58 (81)
T PF05129_consen   45 GILSCRVCGESFQT   58 (81)
T ss_dssp             EEEEESSS--EEEE
T ss_pred             EEEEecCCCCeEEE
Confidence            34556666555543


No 170
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=31.94  E-value=18  Score=28.87  Aligned_cols=34  Identities=21%  Similarity=0.431  Sum_probs=18.7

Q ss_pred             cccccccchhhhccChHHHHHhcccccchhcccccCCcccccchhhc
Q psy10074         13 ADIKCCHCNKYISSDLRDLLEHCRLCPAMTRTDLLKHKYVCYACSYA   59 (420)
Q Consensus        13 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~~C~~C~~~   59 (420)
                      -+|.|. |+..|.+ +.   +|       ...-.++ .|.|..|+-.
T Consensus       116 ~~Y~C~-C~q~~l~-~R---Rh-------n~~~~g~-~YrC~~C~gk  149 (156)
T COG3091         116 YPYRCQ-CQQHYLR-IR---RH-------NTVRRGE-VYRCGKCGGK  149 (156)
T ss_pred             eeEEee-cCCccch-hh---hc-------ccccccc-eEEeccCCce
Confidence            456777 7766666 32   34       3333344 5777777643


No 171
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=31.62  E-value=31  Score=26.86  Aligned_cols=9  Identities=44%  Similarity=1.191  Sum_probs=3.4

Q ss_pred             cCcCCcccc
Q psy10074        351 CSECGFTFF  359 (420)
Q Consensus       351 C~~C~~~f~  359 (420)
                      |..||+.|.
T Consensus         4 Ct~Cg~~f~   12 (131)
T PF09845_consen    4 CTKCGRVFE   12 (131)
T ss_pred             cCcCCCCcC
Confidence            333333333


No 172
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=31.40  E-value=20  Score=34.71  Aligned_cols=33  Identities=24%  Similarity=0.351  Sum_probs=28.4

Q ss_pred             cCCCCCcccCcCccccCCHHHHHccccccccCC
Q psy10074        372 HRKETPFPCPFCEYKAKRKFELKSHMKRKHTFE  404 (420)
Q Consensus       372 H~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~  404 (420)
                      +..-+-+.|+.|.+.|.+...+..|+...|.+.
T Consensus        52 n~sWrFWiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   52 NKSWRFWICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             cCceeEeeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            444556889999999999999999999999765


No 173
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=31.19  E-value=25  Score=25.75  Aligned_cols=13  Identities=15%  Similarity=0.621  Sum_probs=10.2

Q ss_pred             ccccccchhhhcc
Q psy10074         14 DIKCCHCNKYISS   26 (420)
Q Consensus        14 ~~~C~~C~~~f~~   26 (420)
                      |.+|.-||..|.+
T Consensus         2 pH~CtrCG~vf~~   14 (112)
T COG3364           2 PHQCTRCGEVFDD   14 (112)
T ss_pred             Cceeccccccccc
Confidence            5678888888887


No 174
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=30.91  E-value=32  Score=37.42  Aligned_cols=11  Identities=36%  Similarity=0.742  Sum_probs=6.0

Q ss_pred             cccCcCccccC
Q psy10074        378 FPCPFCEYKAK  388 (420)
Q Consensus       378 ~~C~~C~~~f~  388 (420)
                      |.|..|+.+|.
T Consensus      1254 ~RC~kC~~kyR 1264 (1337)
T PRK14714       1254 FRCLKCGTKYR 1264 (1337)
T ss_pred             eeecccCcccc
Confidence            55555555553


No 175
>PF12773 DZR:  Double zinc ribbon
Probab=30.65  E-value=35  Score=21.27  Aligned_cols=9  Identities=22%  Similarity=0.704  Sum_probs=4.7

Q ss_pred             eeccccCcc
Q psy10074        172 YVCFTCDYH  180 (420)
Q Consensus       172 ~~C~~C~~~  180 (420)
                      ..|+.|+..
T Consensus        30 ~~C~~Cg~~   38 (50)
T PF12773_consen   30 KICPNCGAE   38 (50)
T ss_pred             CCCcCCcCC
Confidence            455555543


No 176
>PRK04023 DNA polymerase II large subunit; Validated
Probab=30.34  E-value=39  Score=35.86  Aligned_cols=23  Identities=17%  Similarity=0.536  Sum_probs=11.4

Q ss_pred             cccccccCCCCCccccccccccC
Q psy10074        125 FVCILCNYHIPCKWCKYCKTKLD  147 (420)
Q Consensus       125 ~~C~~C~~~f~~~~c~~~~~~~~  147 (420)
                      +.|+.|+.......||.||....
T Consensus       652 ~fCP~CG~~~~~y~CPKCG~El~  674 (1121)
T PRK04023        652 YRCPRCGIEVEEDECEKCGREPT  674 (1121)
T ss_pred             eeCccccCcCCCCcCCCCCCCCC
Confidence            45555555444444555554443


No 177
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=30.21  E-value=9.6  Score=23.73  Aligned_cols=19  Identities=16%  Similarity=0.198  Sum_probs=11.4

Q ss_pred             CCcccccc--hhhcccccccc
Q psy10074         48 KHKYVCYA--CSYATYYNGNM   66 (420)
Q Consensus        48 ~~~~~C~~--C~~~f~~~~~l   66 (420)
                      +.-++|..  ||..|....++
T Consensus        23 ~~Y~qC~N~~Cg~tfv~~~~~   43 (47)
T PF04606_consen   23 ELYCQCTNPECGHTFVANLEF   43 (47)
T ss_pred             EEEEEECCCcCCCEEEEEEEE
Confidence            34467765  77777655443


No 178
>KOG2807|consensus
Probab=29.69  E-value=70  Score=29.12  Aligned_cols=19  Identities=21%  Similarity=0.424  Sum_probs=11.6

Q ss_pred             ceeccccCccccChhHHHH
Q psy10074        171 RYVCFTCDYHSFCSSHMKD  189 (420)
Q Consensus       171 ~~~C~~C~~~f~~~~~l~~  189 (420)
                      |..|++|+........|.+
T Consensus       290 P~eCpiC~ltLVss~hLAR  308 (378)
T KOG2807|consen  290 PIECPICSLTLVSSPHLAR  308 (378)
T ss_pred             CccCCccceeEecchHHHH
Confidence            4566666666666665554


No 179
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=29.22  E-value=58  Score=18.59  Aligned_cols=21  Identities=24%  Similarity=0.586  Sum_probs=14.2

Q ss_pred             ceecCcCCccccChhhHHHHHH
Q psy10074        348 VHECSECGFTFFLEKTLRAHIR  369 (420)
Q Consensus       348 ~~~C~~C~~~f~~~~~L~~H~~  369 (420)
                      .+.|+.|++.+. ...+..|+.
T Consensus         4 ~~~C~nC~R~v~-a~RfA~HLe   24 (33)
T PF08209_consen    4 YVECPNCGRPVA-ASRFAPHLE   24 (33)
T ss_dssp             EEE-TTTSSEEE-GGGHHHHHH
T ss_pred             eEECCCCcCCcc-hhhhHHHHH
Confidence            467888888776 455777776


No 180
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=29.03  E-value=17  Score=31.18  Aligned_cols=39  Identities=18%  Similarity=0.366  Sum_probs=20.2

Q ss_pred             CceecCCCCCccCChHHHhhhhhhhcCC---------------cceecCcCCcc
Q psy10074        319 KRYVCQLCPKQFLTSGELKYHQTTVHRK---------------RVHECSECGFT  357 (420)
Q Consensus       319 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~---------------~~~~C~~C~~~  357 (420)
                      +.+.||+|+-.|....-+..-+++-.++               ..+.||.|..+
T Consensus        18 k~ieCPvC~tkFkkeev~tgsiRiiagDld~~lkygninP~fY~VvvCP~C~yA   71 (267)
T COG1655          18 KTIECPVCNTKFKKEEVKTGSIRIIAGDLDFFLKYGNINPYFYDVVVCPICYYA   71 (267)
T ss_pred             ceeccCcccchhhhhheeccceeEecccccceeeccccCCceeEEEEcchhhHH
Confidence            3456666666665544433333333222               12578888864


No 181
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=28.33  E-value=36  Score=21.67  Aligned_cols=24  Identities=29%  Similarity=0.603  Sum_probs=10.0

Q ss_pred             ceecCCCCCccCChHHHhhhhhhh
Q psy10074        320 RYVCQLCPKQFLTSGELKYHQTTV  343 (420)
Q Consensus       320 ~~~C~~C~~~f~~~~~l~~H~~~h  343 (420)
                      .|.|+.|...|=..=.+..|...|
T Consensus        21 ~y~C~~C~~~FC~dCD~fiHE~LH   44 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCDVFIHETLH   44 (51)
T ss_dssp             EE--TTTT--B-HHHHHTTTTTS-
T ss_pred             eEECCCCCCccccCcChhhhcccc
Confidence            466666666665555555554443


No 182
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=28.19  E-value=31  Score=18.91  Aligned_cols=11  Identities=36%  Similarity=0.933  Sum_probs=5.0

Q ss_pred             ceeccccCccc
Q psy10074        171 RYVCFTCDYHS  181 (420)
Q Consensus       171 ~~~C~~C~~~f  181 (420)
                      .|.|..|++.+
T Consensus        15 ~Y~C~~Cdf~l   25 (30)
T PF07649_consen   15 FYRCSECDFDL   25 (30)
T ss_dssp             EEE-TTT----
T ss_pred             eEECccCCCcc
Confidence            68888887653


No 183
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=28.10  E-value=35  Score=20.39  Aligned_cols=18  Identities=22%  Similarity=0.357  Sum_probs=10.7

Q ss_pred             ceeccccCccccChhHHH
Q psy10074        171 RYVCFTCDYHSFCSSHMK  188 (420)
Q Consensus       171 ~~~C~~C~~~f~~~~~l~  188 (420)
                      ...|+.|+-.+.....|.
T Consensus        19 id~C~~C~G~W~d~~el~   36 (41)
T PF13453_consen   19 IDVCPSCGGIWFDAGELE   36 (41)
T ss_pred             EEECCCCCeEEccHHHHH
Confidence            456666666665555554


No 184
>KOG1044|consensus
Probab=28.00  E-value=30  Score=34.04  Aligned_cols=37  Identities=24%  Similarity=0.437  Sum_probs=20.5

Q ss_pred             cccccccchhhhccChHHHHHhcccccchhcccccCCcccccchhhc
Q psy10074         13 ADIKCCHCNKYISSDLRDLLEHCRLCPAMTRTDLLKHKYVCYACSYA   59 (420)
Q Consensus        13 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~~~~~~~~~C~~C~~~   59 (420)
                      ....|..|.+.-.-  .-|..+        +.|....=|+|..|+..
T Consensus        15 ~~i~c~~c~~kc~g--evlrv~--------d~~fhi~cf~c~~cg~~   51 (670)
T KOG1044|consen   15 QGIKCDKCRKKCSG--EVLRVN--------DNHFHINCFQCKKCGRN   51 (670)
T ss_pred             cceehhhhCCcccc--ceeEee--------ccccceeeeeccccCCC
Confidence            33567777766655  122222        23334455888888754


No 185
>PRK12496 hypothetical protein; Provisional
Probab=27.89  E-value=29  Score=28.46  Aligned_cols=22  Identities=27%  Similarity=0.649  Sum_probs=15.8

Q ss_pred             cccccccCCCCCc----ccccccccc
Q psy10074        125 FVCILCNYHIPCK----WCKYCKTKL  146 (420)
Q Consensus       125 ~~C~~C~~~f~~~----~c~~~~~~~  146 (420)
                      +.|.-|++.|+..    .||.||..+
T Consensus       128 ~~C~gC~~~~~~~~~~~~C~~CG~~~  153 (164)
T PRK12496        128 KVCKGCKKKYPEDYPDDVCEICGSPV  153 (164)
T ss_pred             EECCCCCccccCCCCCCcCCCCCChh
Confidence            6799999999542    477777443


No 186
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=27.57  E-value=45  Score=19.30  Aligned_cols=31  Identities=16%  Similarity=0.424  Sum_probs=16.2

Q ss_pred             hhhhhhhhhhhhhhhhhhcccccccccCCCCcccccccccCCCC
Q psy10074         92 CQYCNQYFVRSTQDILQHGKVCNFAPRSDANFNFVCILCNYHIP  135 (420)
Q Consensus        92 C~~C~~~f~~~~~~l~~H~~~~~~~~~h~~~~~~~C~~C~~~f~  135 (420)
                      |..|.+.+.+.. +-+-|...            ..|..||-.+.
T Consensus         2 C~~C~~Ey~~p~-~RR~~~~~------------isC~~CGPr~~   32 (35)
T PF07503_consen    2 CDDCLKEYFDPS-NRRFHYQF------------ISCTNCGPRYS   32 (35)
T ss_dssp             -HHHHHHHCSTT-STTTT-TT--------------BTTCC-SCC
T ss_pred             CHHHHHHHcCCC-CCcccCcC------------ccCCCCCCCEE
Confidence            577877777665 43333322            56777876554


No 187
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=27.43  E-value=19  Score=26.64  Aligned_cols=12  Identities=17%  Similarity=0.420  Sum_probs=7.0

Q ss_pred             cccCcCccccCC
Q psy10074        378 FPCPFCEYKAKR  389 (420)
Q Consensus       378 ~~C~~C~~~f~~  389 (420)
                      ..|+.|+..+..
T Consensus        43 ~~C~~CG~y~~~   54 (99)
T PRK14892         43 ITCGNCGLYTEF   54 (99)
T ss_pred             EECCCCCCccCE
Confidence            456666665543


No 188
>PRK05580 primosome assembly protein PriA; Validated
Probab=27.37  E-value=36  Score=35.26  Aligned_cols=49  Identities=29%  Similarity=0.668  Sum_probs=32.8

Q ss_pred             cccccccCCCCCccccccccccCCchhhhhhcccccccccCCCCCcceeccccCccccChhHHHHHHHHhcCCCceeccc
Q psy10074        125 FVCILCNYHIPCKWCKYCKTKLDNNTEVLLQHCKLCVNVIRPDVSYRYVCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIY  204 (420)
Q Consensus       125 ~~C~~C~~~f~~~~c~~~~~~~~~~~~~l~~H~~~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~  204 (420)
                      ..|..||...   .|+.|+       ..|..|.     ...     ...|..||...               ..+..|+.
T Consensus       382 ~~C~~Cg~~~---~C~~C~-------~~l~~h~-----~~~-----~l~Ch~Cg~~~---------------~~~~~Cp~  426 (679)
T PRK05580        382 LLCRDCGWVA---ECPHCD-------ASLTLHR-----FQR-----RLRCHHCGYQE---------------PIPKACPE  426 (679)
T ss_pred             eEhhhCcCcc---CCCCCC-------CceeEEC-----CCC-----eEECCCCcCCC---------------CCCCCCCC
Confidence            5699999888   578888       5555553     122     57888888653               24567888


Q ss_pred             cccc
Q psy10074        205 CAYR  208 (420)
Q Consensus       205 C~~~  208 (420)
                      |+..
T Consensus       427 Cg~~  430 (679)
T PRK05580        427 CGST  430 (679)
T ss_pred             CcCC
Confidence            8653


No 189
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=26.87  E-value=38  Score=34.62  Aligned_cols=22  Identities=23%  Similarity=0.744  Sum_probs=9.2

Q ss_pred             cccccCCCCCc--cccccccccCC
Q psy10074        127 CILCNYHIPCK--WCKYCKTKLDN  148 (420)
Q Consensus       127 C~~C~~~f~~~--~c~~~~~~~~~  148 (420)
                      |+.||...+..  -|+.||..+..
T Consensus        30 Cp~CG~~~~~~~~fC~~CG~~~~~   53 (645)
T PRK14559         30 CPQCGTEVPVDEAHCPNCGAETGT   53 (645)
T ss_pred             CCCCCCCCCcccccccccCCcccc
Confidence            44444433222  34444444443


No 190
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=26.79  E-value=32  Score=27.15  Aligned_cols=11  Identities=18%  Similarity=0.594  Sum_probs=5.2

Q ss_pred             ccCCccchhcc
Q psy10074        288 FHCHYCDYICR  298 (420)
Q Consensus       288 ~~C~~C~~~f~  298 (420)
                      +.|..|+..|.
T Consensus        71 ~~C~~CG~~~~   81 (135)
T PRK03824         71 LKCRNCGNEWS   81 (135)
T ss_pred             EECCCCCCEEe
Confidence            44555554443


No 191
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=26.46  E-value=18  Score=28.56  Aligned_cols=21  Identities=19%  Similarity=0.373  Sum_probs=10.8

Q ss_pred             ccccccCCCCCc---ccccccccc
Q psy10074        126 VCILCNYHIPCK---WCKYCKTKL  146 (420)
Q Consensus       126 ~C~~C~~~f~~~---~c~~~~~~~  146 (420)
                      .|+.||+.|...   .|+.|..+.
T Consensus         5 nC~~CgklF~~~~~~iCp~C~~~~   28 (137)
T TIGR03826         5 NCPKCGRLFVKTGRDVCPSCYEEE   28 (137)
T ss_pred             cccccchhhhhcCCccCHHHhHHH
Confidence            355555555432   566666433


No 192
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=26.41  E-value=32  Score=22.26  Aligned_cols=12  Identities=17%  Similarity=0.622  Sum_probs=9.8

Q ss_pred             ceeccccCcccc
Q psy10074        171 RYVCFTCDYHSF  182 (420)
Q Consensus       171 ~~~C~~C~~~f~  182 (420)
                      .|.|+.||..+-
T Consensus        14 ~~~Cp~cGipth   25 (55)
T PF13824_consen   14 NFECPDCGIPTH   25 (55)
T ss_pred             CCcCCCCCCcCc
Confidence            789999998764


No 193
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=26.29  E-value=38  Score=19.71  Aligned_cols=9  Identities=22%  Similarity=1.040  Sum_probs=4.1

Q ss_pred             ecCCCCCcc
Q psy10074        322 VCQLCPKQF  330 (420)
Q Consensus       322 ~C~~C~~~f  330 (420)
                      .|+.|+.+|
T Consensus         3 ~C~~Cg~~Y   11 (36)
T PF05191_consen    3 ICPKCGRIY   11 (36)
T ss_dssp             EETTTTEEE
T ss_pred             CcCCCCCcc
Confidence            344444444


No 194
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=26.08  E-value=33  Score=22.07  Aligned_cols=9  Identities=22%  Similarity=0.755  Sum_probs=4.4

Q ss_pred             ccccccCCC
Q psy10074        126 VCILCNYHI  134 (420)
Q Consensus       126 ~C~~C~~~f  134 (420)
                      .|..|++.|
T Consensus         7 ~C~~Cg~~~   15 (54)
T PF14446_consen    7 KCPVCGKKF   15 (54)
T ss_pred             cChhhCCcc
Confidence            345555444


No 195
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=25.89  E-value=51  Score=30.12  Aligned_cols=14  Identities=29%  Similarity=0.456  Sum_probs=7.5

Q ss_pred             cCCcceecCcCCcc
Q psy10074        344 HRKRVHECSECGFT  357 (420)
Q Consensus       344 ~~~~~~~C~~C~~~  357 (420)
                      .|.+-..|+.|+-.
T Consensus       206 ~G~RyL~CslC~te  219 (305)
T TIGR01562       206 TGLRYLSCSLCATE  219 (305)
T ss_pred             CCceEEEcCCCCCc
Confidence            34455566666544


No 196
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=25.41  E-value=46  Score=20.97  Aligned_cols=16  Identities=25%  Similarity=0.740  Sum_probs=7.5

Q ss_pred             ceecCcCCccccChhh
Q psy10074        348 VHECSECGFTFFLEKT  363 (420)
Q Consensus       348 ~~~C~~C~~~f~~~~~  363 (420)
                      .+.|..||..|..-..
T Consensus         4 ~l~C~dCg~~FvfTa~   19 (49)
T PF13451_consen    4 TLTCKDCGAEFVFTAG   19 (49)
T ss_pred             eEEcccCCCeEEEehh
Confidence            3455555554443333


No 197
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=25.35  E-value=52  Score=22.21  Aligned_cols=9  Identities=44%  Similarity=1.390  Sum_probs=3.9

Q ss_pred             eecCcCCcc
Q psy10074        349 HECSECGFT  357 (420)
Q Consensus       349 ~~C~~C~~~  357 (420)
                      |.|+.||..
T Consensus        47 ~~C~~Cg~~   55 (69)
T PF07282_consen   47 FTCPNCGFE   55 (69)
T ss_pred             EEcCCCCCE
Confidence            444444443


No 198
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=24.77  E-value=9.4  Score=22.69  Aligned_cols=7  Identities=57%  Similarity=1.293  Sum_probs=2.7

Q ss_pred             eecCCCC
Q psy10074        321 YVCQLCP  327 (420)
Q Consensus       321 ~~C~~C~  327 (420)
                      |.|..|+
T Consensus        29 y~C~~C~   35 (39)
T PF01096_consen   29 YVCCNCG   35 (39)
T ss_dssp             EEESSST
T ss_pred             EEeCCCC
Confidence            3333333


No 199
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.58  E-value=32  Score=23.75  Aligned_cols=10  Identities=60%  Similarity=1.325  Sum_probs=5.1

Q ss_pred             eecCcCCccc
Q psy10074        349 HECSECGFTF  358 (420)
Q Consensus       349 ~~C~~C~~~f  358 (420)
                      |+|..|+..|
T Consensus        13 Y~c~~cg~~~   22 (82)
T COG2331          13 YECTECGNRF   22 (82)
T ss_pred             EeecccchHH
Confidence            4555555444


No 200
>KOG1842|consensus
Probab=24.50  E-value=39  Score=32.07  Aligned_cols=24  Identities=21%  Similarity=0.528  Sum_probs=11.6

Q ss_pred             eecCCCCCccCChHHHhhhhhhhc
Q psy10074        321 YVCQLCPKQFLTSGELKYHQTTVH  344 (420)
Q Consensus       321 ~~C~~C~~~f~~~~~l~~H~~~h~  344 (420)
                      |.||+|...|.+...|..|....|
T Consensus        16 flCPiC~~dl~~~~~L~~H~d~eH   39 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLDVEH   39 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHhhhc
Confidence            445555555555555555444333


No 201
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=24.49  E-value=44  Score=21.44  Aligned_cols=27  Identities=26%  Similarity=0.500  Sum_probs=16.3

Q ss_pred             ecCcCCccccChhhHHHHHHhhcCCCCCcccCcCccccCC
Q psy10074        350 ECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKR  389 (420)
Q Consensus       350 ~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~  389 (420)
                      .|..|++.|..             ..+.+.|..||..|=.
T Consensus         4 ~C~~C~~~F~~-------------~~rk~~Cr~Cg~~~C~   30 (57)
T cd00065           4 SCMGCGKPFTL-------------TRRRHHCRNCGRIFCS   30 (57)
T ss_pred             cCcccCccccC-------------CccccccCcCcCCcCh
Confidence            46677777763             1234557777766654


No 202
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=24.33  E-value=27  Score=19.90  Aligned_cols=10  Identities=40%  Similarity=0.926  Sum_probs=4.4

Q ss_pred             cccccccCCC
Q psy10074        125 FVCILCNYHI  134 (420)
Q Consensus       125 ~~C~~C~~~f  134 (420)
                      +.|..|+.+|
T Consensus        22 ~~C~~Cg~~~   31 (33)
T PF08792_consen   22 EVCIFCGSSF   31 (33)
T ss_pred             EEcccCCcEe
Confidence            3444444443


No 203
>KOG4167|consensus
Probab=24.02  E-value=23  Score=35.82  Aligned_cols=26  Identities=12%  Similarity=0.310  Sum_probs=23.0

Q ss_pred             ceecccccccccCHHHHHHHHhhccC
Q psy10074        199 PYMCIYCAYRCTQKSDLKKHLRKKHE  224 (420)
Q Consensus       199 ~~~C~~C~~~f~~~~~l~~H~~~~h~  224 (420)
                      .|.|+.|++.|....++..||+.|..
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            49999999999999999999998753


No 204
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=23.72  E-value=35  Score=22.18  Aligned_cols=13  Identities=31%  Similarity=0.720  Sum_probs=7.1

Q ss_pred             cCCcccccchhhc
Q psy10074         47 LKHKYVCYACSYA   59 (420)
Q Consensus        47 ~~~~~~C~~C~~~   59 (420)
                      ....|.|+.|...
T Consensus        28 Pi~tYmC~eC~~R   40 (56)
T PF09963_consen   28 PIHTYMCDECKER   40 (56)
T ss_pred             CCcceeChhHHHH
Confidence            3444666666543


No 205
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=23.58  E-value=34  Score=21.47  Aligned_cols=11  Identities=27%  Similarity=1.050  Sum_probs=9.2

Q ss_pred             Ccccccchhhc
Q psy10074         49 HKYVCYACSYA   59 (420)
Q Consensus        49 ~~~~C~~C~~~   59 (420)
                      .+|.|..||++
T Consensus        36 dR~~CGkCgyT   46 (51)
T COG1998          36 DRWACGKCGYT   46 (51)
T ss_pred             ceeEeccccce
Confidence            37999999986


No 207
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=22.27  E-value=24  Score=25.46  Aligned_cols=12  Identities=33%  Similarity=0.996  Sum_probs=7.5

Q ss_pred             ceecCcCCcccc
Q psy10074        348 VHECSECGFTFF  359 (420)
Q Consensus       348 ~~~C~~C~~~f~  359 (420)
                      .|.|..|++.|+
T Consensus        53 IW~C~~C~~~~A   64 (90)
T PF01780_consen   53 IWKCKKCGKKFA   64 (90)
T ss_dssp             EEEETTTTEEEE
T ss_pred             EeecCCCCCEEe
Confidence            466666666665


No 208
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=22.04  E-value=29  Score=19.26  Aligned_cols=18  Identities=17%  Similarity=0.349  Sum_probs=7.9

Q ss_pred             cccccccccchhhhhhhh
Q psy10074         81 CTLLICQYCLICQYCNQY   98 (420)
Q Consensus        81 c~~c~~~~~~~C~~C~~~   98 (420)
                      |.+|+....|+|+.|+..
T Consensus         5 C~vC~~~~kY~Cp~C~~~   22 (30)
T PF04438_consen    5 CSVCGNPAKYRCPRCGAR   22 (30)
T ss_dssp             ETSSSSEESEE-TTT--E
T ss_pred             CccCcCCCEEECCCcCCc
Confidence            444555555556666544


No 209
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=21.86  E-value=35  Score=24.71  Aligned_cols=12  Identities=33%  Similarity=0.980  Sum_probs=7.1

Q ss_pred             ceecCcCCcccc
Q psy10074        348 VHECSECGFTFF  359 (420)
Q Consensus       348 ~~~C~~C~~~f~  359 (420)
                      .|.|..|++.|+
T Consensus        53 IW~C~~C~~~~A   64 (91)
T TIGR00280        53 IWTCRKCGAKFA   64 (91)
T ss_pred             EEEcCCCCCEEe
Confidence            456666666555


No 210
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=21.65  E-value=36  Score=34.60  Aligned_cols=60  Identities=17%  Similarity=0.388  Sum_probs=39.2

Q ss_pred             ccccchhhccccccccchhhhhccCCCCcccccccccccchhhhhhhhhhhhhhhhhhhcccccccccCCCCcccccccc
Q psy10074         51 YVCYACSYATYYNGNMKKHLRIHLGDRPFMCTLLICQYCLICQYCNQYFVRSTQDILQHGKVCNFAPRSDANFNFVCILC  130 (420)
Q Consensus        51 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~h~~~~~~~C~~C  130 (420)
                      ..|+.||=.|+-...|--- +..+....|.          .|+.|.+++.+.. +-+-|.+.            ..|+.|
T Consensus       124 ~~CT~CGPRfTIi~alPYD-R~nTsM~~F~----------lC~~C~~EY~dP~-nRRfHAQp------------~aCp~C  179 (750)
T COG0068         124 INCTNCGPRFTIIEALPYD-RENTSMADFP----------LCPFCDKEYKDPL-NRRFHAQP------------IACPKC  179 (750)
T ss_pred             cccCCCCcceeeeccCCCC-cccCccccCc----------CCHHHHHHhcCcc-cccccccc------------ccCccc
Confidence            4688888888777666443 3344444442          3588999998877 55555544            678888


Q ss_pred             cCCC
Q psy10074        131 NYHI  134 (420)
Q Consensus       131 ~~~f  134 (420)
                      |-..
T Consensus       180 GP~~  183 (750)
T COG0068         180 GPHL  183 (750)
T ss_pred             CCCe
Confidence            7644


No 211
>COG1773 Rubredoxin [Energy production and conversion]
Probab=21.50  E-value=34  Score=22.12  Aligned_cols=14  Identities=21%  Similarity=0.653  Sum_probs=7.8

Q ss_pred             cccccchhhccccc
Q psy10074         50 KYVCYACSYATYYN   63 (420)
Q Consensus        50 ~~~C~~C~~~f~~~   63 (420)
                      .|+|..||+.|.-.
T Consensus         3 ~~~C~~CG~vYd~e   16 (55)
T COG1773           3 RWRCSVCGYVYDPE   16 (55)
T ss_pred             ceEecCCceEeccc
Confidence            35666666665433


No 212
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=21.30  E-value=22  Score=28.29  Aligned_cols=22  Identities=9%  Similarity=0.134  Sum_probs=17.6

Q ss_pred             CCcccccchhhccccccccchh
Q psy10074         48 KHKYVCYACSYATYYNGNMKKH   69 (420)
Q Consensus        48 ~~~~~C~~C~~~f~~~~~l~~H   69 (420)
                      .++-.|..||+.|++-..+..-
T Consensus        26 RRRReC~~C~~RFTTyErve~~   47 (147)
T TIGR00244        26 RRRRECLECHERFTTFERAELL   47 (147)
T ss_pred             eecccCCccCCccceeeecccc
Confidence            3557899999999998877665


No 213
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=20.78  E-value=24  Score=28.13  Aligned_cols=22  Identities=9%  Similarity=0.181  Sum_probs=17.1

Q ss_pred             CCcccccchhhccccccccchh
Q psy10074         48 KHKYVCYACSYATYYNGNMKKH   69 (420)
Q Consensus        48 ~~~~~C~~C~~~f~~~~~l~~H   69 (420)
                      .++-.|..|+..|++......=
T Consensus        26 RRRReC~~C~~RFTTfE~~El~   47 (156)
T COG1327          26 RRRRECLECGERFTTFERAELR   47 (156)
T ss_pred             hhhhcccccccccchhheeeec
Confidence            4567899999999988776554


No 214
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=20.75  E-value=80  Score=20.23  Aligned_cols=12  Identities=25%  Similarity=0.847  Sum_probs=5.9

Q ss_pred             eecCcCCccccC
Q psy10074        349 HECSECGFTFFL  360 (420)
Q Consensus       349 ~~C~~C~~~f~~  360 (420)
                      ++|+.||..|..
T Consensus        29 W~C~~Cgh~w~~   40 (55)
T PF14311_consen   29 WKCPKCGHEWKA   40 (55)
T ss_pred             EECCCCCCeeEc
Confidence            455555554443


No 215
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=20.70  E-value=63  Score=26.32  Aligned_cols=11  Identities=27%  Similarity=0.498  Sum_probs=6.0

Q ss_pred             eeccccccccc
Q psy10074        200 YMCIYCAYRCT  210 (420)
Q Consensus       200 ~~C~~C~~~f~  210 (420)
                      +.|+.|++.|-
T Consensus       131 ~~C~~CgkiYW  141 (165)
T COG1656         131 YRCPKCGKIYW  141 (165)
T ss_pred             eECCCCccccc
Confidence            45555555543


No 216
>PRK04023 DNA polymerase II large subunit; Validated
Probab=20.69  E-value=66  Score=34.30  Aligned_cols=22  Identities=23%  Similarity=0.578  Sum_probs=18.1

Q ss_pred             ccccccccCCCCCccccccccc
Q psy10074        124 NFVCILCNYHIPCKWCKYCKTK  145 (420)
Q Consensus       124 ~~~C~~C~~~f~~~~c~~~~~~  145 (420)
                      ...|+.||.......||.||..
T Consensus       626 ~RfCpsCG~~t~~frCP~CG~~  647 (1121)
T PRK04023        626 RRKCPSCGKETFYRRCPFCGTH  647 (1121)
T ss_pred             CccCCCCCCcCCcccCCCCCCC
Confidence            4679999998877789999965


No 217
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=20.57  E-value=56  Score=24.89  Aligned_cols=11  Identities=18%  Similarity=0.280  Sum_probs=5.4

Q ss_pred             eecCCCCCccC
Q psy10074        321 YVCQLCPKQFL  331 (420)
Q Consensus       321 ~~C~~C~~~f~  331 (420)
                      +.|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (113)
T PRK12380         71 AWCWDCSQVVE   81 (113)
T ss_pred             EEcccCCCEEe
Confidence            45555554443


No 218
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=20.44  E-value=53  Score=25.08  Aligned_cols=11  Identities=18%  Similarity=0.594  Sum_probs=5.5

Q ss_pred             eecCCCCCccC
Q psy10074        321 YVCQLCPKQFL  331 (420)
Q Consensus       321 ~~C~~C~~~f~  331 (420)
                      ..|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (115)
T TIGR00100        71 CECEDCSEEVS   81 (115)
T ss_pred             EEcccCCCEEe
Confidence            45555554443


No 219
>KOG3408|consensus
Probab=20.26  E-value=71  Score=24.40  Aligned_cols=23  Identities=30%  Similarity=0.649  Sum_probs=18.3

Q ss_pred             ceecccccccccCHHHHHHHHhh
Q psy10074        199 PYMCIYCAYRCTQKSDLKKHLRK  221 (420)
Q Consensus       199 ~~~C~~C~~~f~~~~~l~~H~~~  221 (420)
                      .|-|-.|.+.|.+...|..|.++
T Consensus        57 qfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   57 QFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             eeehhhhhhhhcchHHHHHHHhc
Confidence            47888888888888888888764


No 220
>KOG0717|consensus
Probab=20.24  E-value=45  Score=31.96  Aligned_cols=19  Identities=37%  Similarity=0.697  Sum_probs=17.8

Q ss_pred             cccccchhhhccChHHHHHh
Q psy10074         15 IKCCHCNKYISSDLRDLLEH   34 (420)
Q Consensus        15 ~~C~~C~~~f~~~~~~l~~H   34 (420)
                      +.|.+|+++|.+ ..+|..|
T Consensus       293 lyC~vCnKsFKs-eKq~kNH  311 (508)
T KOG0717|consen  293 LYCVVCNKSFKS-EKQLKNH  311 (508)
T ss_pred             eEEeeccccccc-hHHHHhh
Confidence            789999999999 9999999


No 221
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=20.03  E-value=36  Score=27.33  Aligned_cols=52  Identities=15%  Similarity=0.340  Sum_probs=27.3

Q ss_pred             ccccccCCCCCccccccccccCCchhhhhhcccccccccCCCCCcceeccccCccccCh
Q psy10074        126 VCILCNYHIPCKWCKYCKTKLDNNTEVLLQHCKLCVNVIRPDVSYRYVCFTCDYHSFCS  184 (420)
Q Consensus       126 ~C~~C~~~f~~~~c~~~~~~~~~~~~~l~~H~~~~h~~~~~~~~~~~~C~~C~~~f~~~  184 (420)
                      -|..||...-.. ||.|+..+.+.     .|..-+-. ....-..|.-|..||+.|+.-
T Consensus        30 fC~kCG~~tI~~-Cp~C~~~IrG~-----y~v~gv~~-~g~~~~~PsYC~~CGkpyPWt   81 (158)
T PF10083_consen   30 FCSKCGAKTITS-CPNCSTPIRGD-----YHVEGVFG-LGGHYEAPSYCHNCGKPYPWT   81 (158)
T ss_pred             HHHHhhHHHHHH-CcCCCCCCCCc-----eecCCeee-eCCCCCCChhHHhCCCCCchH
Confidence            377777766664 88888777663     22211110 001111255677777777643


Done!