Query         psy10075
Match_columns 373
No_of_seqs    194 out of 2379
Neff          10.8
Searched_HMMs 46136
Date          Fri Aug 16 17:18:00 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10075.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10075hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3608|consensus               99.9 4.7E-27   1E-31  193.6  11.8  226  112-348   135-382 (467)
  2 KOG2462|consensus               99.9 2.1E-27 4.5E-32  190.9   5.7  140  196-341   127-266 (279)
  3 KOG3608|consensus               99.9 2.8E-26 6.1E-31  189.0  11.9  257   25-290    69-381 (467)
  4 KOG1074|consensus               99.9 4.6E-27 9.9E-32  213.9   2.7  200  140-342   604-931 (958)
  5 KOG1074|consensus               99.9 2.1E-26 4.6E-31  209.5   0.6   48   83-131   354-401 (958)
  6 KOG2462|consensus               99.9 3.1E-25 6.7E-30  178.5   4.6  126  228-373   128-253 (279)
  7 KOG3623|consensus               99.9 2.3E-22 4.9E-27  180.6   5.4  107   23-131   208-329 (1007)
  8 KOG3623|consensus               99.8 2.5E-22 5.3E-27  180.3   3.2   78  262-340   895-972 (1007)
  9 KOG3576|consensus               99.6 7.1E-17 1.5E-21  123.6   2.4  114  229-346   116-240 (267)
 10 KOG3576|consensus               99.6 1.2E-15 2.5E-20  117.0   2.4  131   16-167   108-238 (267)
 11 PLN03086 PRLI-interacting fact  99.2 3.6E-11 7.8E-16  109.9   9.3  146  171-343   408-565 (567)
 12 PHA00733 hypothetical protein   99.2 3.5E-11 7.7E-16   89.6   5.1   85  259-345    38-126 (128)
 13 PLN03086 PRLI-interacting fact  99.1   6E-10 1.3E-14  102.1   8.6  147  141-315   407-565 (567)
 14 PHA00733 hypothetical protein   99.0   2E-10 4.3E-15   85.6   4.4   85  228-315    38-124 (128)
 15 KOG3993|consensus               98.8 2.5E-09 5.5E-14   91.8   3.6   53  291-343   431-483 (500)
 16 PHA02768 hypothetical protein;  98.8 2.6E-09 5.5E-14   65.0   2.0   44  261-307     5-48  (55)
 17 KOG3993|consensus               98.7   5E-09 1.1E-13   90.0   1.1  198  112-316   268-484 (500)
 18 PHA02768 hypothetical protein;  98.7   1E-08 2.2E-13   62.4   1.5   44  290-335     5-48  (55)
 19 PF05605 zf-Di19:  Drought indu  98.4 2.6E-07 5.7E-12   57.7   3.5   49  291-342     3-53  (54)
 20 PF13465 zf-H2C2_2:  Zinc-finge  98.4 1.6E-07 3.4E-12   48.7   1.7   25  276-301     1-25  (26)
 21 PHA00732 hypothetical protein   98.2 9.1E-07   2E-11   59.6   3.1   44  261-310     1-44  (79)
 22 PF05605 zf-Di19:  Drought indu  98.2 1.4E-06 3.1E-11   54.4   3.6   50  262-314     3-53  (54)
 23 KOG1146|consensus               98.2 1.2E-06 2.7E-11   86.2   4.7  101    6-106   444-613 (1406)
 24 PHA00616 hypothetical protein   98.2 3.8E-07 8.2E-12   52.7   0.7   31  262-293     2-32  (44)
 25 PHA00732 hypothetical protein   98.2 1.1E-06 2.4E-11   59.2   2.5   47  290-341     1-47  (79)
 26 PHA00616 hypothetical protein   98.1 9.2E-07   2E-11   51.1   1.1   33  290-322     1-33  (44)
 27 PF13465 zf-H2C2_2:  Zinc-finge  98.0   1E-06 2.2E-11   45.6   0.2   17   76-92      8-24  (26)
 28 PF12756 zf-C2H2_2:  C2H2 type   97.9 7.8E-06 1.7E-10   58.9   2.1   73  263-341     1-73  (100)
 29 PF13894 zf-C2H2_4:  C2H2-type   97.8 1.6E-05 3.6E-10   40.3   1.8   24  319-342     1-24  (24)
 30 PF00096 zf-C2H2:  Zinc finger,  97.7 1.3E-05 2.8E-10   40.3   1.1   22  319-340     1-22  (23)
 31 PF00096 zf-C2H2:  Zinc finger,  97.6   4E-05 8.6E-10   38.4   1.7   20  262-281     1-20  (23)
 32 COG5189 SFP1 Putative transcri  97.6 2.9E-05 6.3E-10   64.8   1.7   52  259-310   347-418 (423)
 33 PF13894 zf-C2H2_4:  C2H2-type   97.5 0.00011 2.3E-09   37.2   2.2   20  262-281     1-20  (24)
 34 KOG1146|consensus               97.4 2.7E-05 5.9E-10   77.1  -0.4   75   56-130   439-537 (1406)
 35 PF12756 zf-C2H2_2:  C2H2 type   97.4 0.00013 2.8E-09   52.5   2.6   22  261-282    50-71  (100)
 36 PF13912 zf-C2H2_6:  C2H2-type   97.4 7.1E-05 1.5E-09   39.2   0.8   24  319-342     2-25  (27)
 37 PF13912 zf-C2H2_6:  C2H2-type   97.3 0.00014   3E-09   38.1   1.7   25   25-49      1-25  (27)
 38 COG5189 SFP1 Putative transcri  97.3 0.00014 2.9E-09   60.9   2.3   24  258-281   395-418 (423)
 39 PF13909 zf-H2C2_5:  C2H2-type   97.1 0.00025 5.5E-09   35.9   1.4   24  319-343     1-24  (24)
 40 KOG2482|consensus               96.8  0.0027 5.8E-08   54.0   5.7  185  155-341   129-357 (423)
 41 COG5236 Uncharacterized conser  96.8   0.002 4.3E-08   54.8   4.4  132  200-345   152-308 (493)
 42 PF09237 GAGA:  GAGA factor;  I  96.8  0.0009 1.9E-08   39.7   1.7   32   22-53     21-52  (54)
 43 PF13909 zf-H2C2_5:  C2H2-type   96.7 0.00081 1.8E-08   34.0   1.0   23  291-314     1-23  (24)
 44 smart00355 ZnF_C2H2 zinc finge  96.5  0.0023 5.1E-08   32.7   2.3   23  319-341     1-23  (26)
 45 PF12874 zf-met:  Zinc-finger o  96.5  0.0012 2.5E-08   33.8   0.7   22  319-340     1-22  (25)
 46 PF09237 GAGA:  GAGA factor;  I  96.4  0.0015 3.3E-08   38.7   1.2   22  260-281    23-44  (54)
 47 COG5236 Uncharacterized conser  96.3  0.0038 8.2E-08   53.1   3.6  132   25-167   151-307 (493)
 48 PF12874 zf-met:  Zinc-finger o  96.2  0.0024 5.2E-08   32.5   1.0   22   26-47      1-22  (25)
 49 KOG2482|consensus               96.2  0.0092   2E-07   50.9   4.9  149  183-343   128-304 (423)
 50 smart00355 ZnF_C2H2 zinc finge  96.1  0.0046 9.9E-08   31.5   2.0   19  263-281     2-20  (26)
 51 PF12171 zf-C2H2_jaz:  Zinc-fin  96.0  0.0047   1E-07   32.1   1.7   22   26-47      2-23  (27)
 52 KOG2231|consensus               95.9   0.022 4.7E-07   54.1   6.5  120  171-314   100-236 (669)
 53 PRK04860 hypothetical protein;  95.8  0.0056 1.2E-07   47.6   2.1   39  261-304   119-157 (160)
 54 PF12171 zf-C2H2_jaz:  Zinc-fin  95.4  0.0095 2.1E-07   31.0   1.3   19  292-310     3-21  (27)
 55 PRK04860 hypothetical protein;  94.7   0.014 2.9E-07   45.5   1.0   40  289-332   118-157 (160)
 56 PF13913 zf-C2HC_2:  zinc-finge  94.6   0.034 7.3E-07   28.2   2.0   19  320-339     4-22  (25)
 57 KOG4173|consensus               94.2   0.012 2.5E-07   46.4  -0.3   83  199-287    79-172 (253)
 58 PF12013 DUF3505:  Protein of u  93.6   0.095 2.1E-06   38.2   3.6   25  319-343    81-109 (109)
 59 KOG2785|consensus               93.5    0.14 2.9E-06   44.9   4.8   22  141-162     3-24  (390)
 60 smart00451 ZnF_U1 U1-like zinc  93.4   0.054 1.2E-06   30.0   1.6   21   25-45      3-23  (35)
 61 KOG2231|consensus               93.2    0.25 5.3E-06   47.3   6.4   19  202-220   185-203 (669)
 62 cd00350 rubredoxin_like Rubred  93.2   0.069 1.5E-06   29.2   1.7   10  262-271     2-11  (33)
 63 KOG2785|consensus               93.1     0.1 2.3E-06   45.6   3.6  142  199-341     3-243 (390)
 64 KOG4173|consensus               92.8   0.039 8.4E-07   43.6   0.5   81  229-315    78-171 (253)
 65 smart00451 ZnF_U1 U1-like zinc  92.5    0.11 2.3E-06   28.8   2.0   23  318-340     3-25  (35)
 66 KOG2893|consensus               91.6   0.046 9.9E-07   44.2  -0.3   45   85-134    13-57  (341)
 67 COG2888 Predicted Zn-ribbon RN  90.9    0.34 7.4E-06   30.0   3.0   11  229-239    26-36  (61)
 68 PRK14890 putative Zn-ribbon RN  90.5    0.43 9.4E-06   29.7   3.2   11  229-239    24-34  (59)
 69 PF12013 DUF3505:  Protein of u  90.3    0.35 7.5E-06   35.2   3.3   56  259-315     9-109 (109)
 70 COG5048 FOG: Zn-finger [Genera  88.9    0.24 5.2E-06   46.0   2.0   60   25-85    289-354 (467)
 71 KOG2893|consensus               88.9    0.14 3.1E-06   41.5   0.3   42  264-310    13-54  (341)
 72 COG4049 Uncharacterized protei  88.8    0.15 3.2E-06   30.9   0.3   24  319-342    18-41  (65)
 73 COG4049 Uncharacterized protei  88.3     0.3 6.5E-06   29.6   1.3   30  195-224    13-42  (65)
 74 TIGR00622 ssl1 transcription f  87.6     1.8 3.8E-05   31.3   5.1   47  293-341    58-104 (112)
 75 PF09986 DUF2225:  Uncharacteri  87.3     0.2 4.3E-06   41.4   0.3   22  260-281     4-25  (214)
 76 cd00729 rubredoxin_SM Rubredox  87.2    0.47   1E-05   26.1   1.6    9  262-270     3-11  (34)
 77 COG2888 Predicted Zn-ribbon RN  85.3    0.76 1.6E-05   28.5   2.0   14  198-211    26-39  (61)
 78 PHA00626 hypothetical protein   85.2    0.41   9E-06   29.2   0.8   12  261-272    23-34  (59)
 79 COG5048 FOG: Zn-finger [Genera  84.3    0.54 1.2E-05   43.6   1.6  150  169-322   288-450 (467)
 80 smart00659 RPOLCX RNA polymera  83.8    0.93   2E-05   26.7   1.9   10  262-271     3-12  (44)
 81 PF09986 DUF2225:  Uncharacteri  83.8    0.44 9.5E-06   39.4   0.7   23   23-45      3-25  (214)
 82 PF13719 zinc_ribbon_5:  zinc-r  83.2    0.81 1.8E-05   25.7   1.4   11  141-151    25-35  (37)
 83 PRK00464 nrdR transcriptional   83.1    0.38 8.3E-06   37.2   0.1   16  319-334    29-44  (154)
 84 PF09538 FYDLN_acid:  Protein o  82.8    0.71 1.5E-05   33.3   1.4   15  260-274    25-39  (108)
 85 PF13717 zinc_ribbon_4:  zinc-r  82.8    0.79 1.7E-05   25.6   1.2   11  141-151    25-35  (36)
 86 PRK00398 rpoP DNA-directed RNA  81.9     1.1 2.5E-05   26.6   1.8   10  262-271     4-13  (46)
 87 TIGR02098 MJ0042_CXXC MJ0042 f  81.8    0.87 1.9E-05   25.7   1.2   10  142-151    26-35  (38)
 88 TIGR00622 ssl1 transcription f  80.6     2.8   6E-05   30.3   3.6   19  141-159    15-33  (112)
 89 COG1592 Rubrerythrin [Energy p  80.4     1.2 2.7E-05   34.7   2.0   24  261-298   134-157 (166)
 90 smart00834 CxxC_CXXC_SSSS Puta  78.1     1.2 2.5E-05   25.6   1.0   30   25-61      5-34  (41)
 91 TIGR02605 CxxC_CxxC_SSSS putat  77.9     1.2 2.6E-05   27.3   1.0   29   26-61      6-34  (52)
 92 PF09723 Zn-ribbon_8:  Zinc rib  75.7     1.6 3.5E-05   25.4   1.1   29   26-61      6-34  (42)
 93 PF09538 FYDLN_acid:  Protein o  75.5       2 4.2E-05   31.1   1.7   13  141-153    26-38  (108)
 94 KOG2186|consensus               74.4     1.5 3.3E-05   36.3   1.0   45   26-73      4-48  (276)
 95 smart00531 TFIIE Transcription  73.2     2.9 6.4E-05   32.2   2.3   18   23-40     97-114 (147)
 96 PF02892 zf-BED:  BED zinc fing  72.5     3.6 7.7E-05   24.1   2.1   26  259-284    14-43  (45)
 97 COG1592 Rubrerythrin [Energy p  72.4     2.8 6.1E-05   32.8   2.0   24  230-269   134-157 (166)
 98 TIGR00373 conserved hypothetic  71.5     2.7 5.8E-05   32.9   1.8   15  262-276   110-124 (158)
 99 PF03604 DNA_RNApol_7kD:  DNA d  71.2     3.9 8.4E-05   22.1   1.8   11  262-272     1-11  (32)
100 KOG2186|consensus               71.2     1.7 3.8E-05   35.9   0.7   45  262-310     4-48  (276)
101 PF15269 zf-C2H2_7:  Zinc-finge  71.1       4 8.6E-05   23.6   1.9   23  319-341    21-43  (54)
102 COG0068 HypF Hydrogenase matur  71.0    0.54 1.2E-05   45.0  -2.5   78  231-326   102-181 (750)
103 smart00531 TFIIE Transcription  70.9     3.7 7.9E-05   31.7   2.4   12  230-241    99-110 (147)
104 COG1996 RPC10 DNA-directed RNA  70.6     2.4 5.3E-05   25.4   1.0   29   23-61      4-32  (49)
105 COG1997 RPL43A Ribosomal prote  69.7     3.1 6.7E-05   28.3   1.5   15  259-273    51-65  (89)
106 TIGR00373 conserved hypothetic  69.7     3.2   7E-05   32.4   1.9   32   22-62    106-137 (158)
107 TIGR02300 FYDLN_acid conserved  69.4     3.1 6.6E-05   30.6   1.5   15  260-274    25-39  (129)
108 PRK06266 transcription initiat  69.4     2.9 6.4E-05   33.4   1.6   12  262-273   118-129 (178)
109 PF02176 zf-TRAF:  TRAF-type zi  68.7     2.3   5E-05   26.8   0.8   44   21-65      5-54  (60)
110 PF06524 NOA36:  NOA36 protein;  67.9     4.1 8.9E-05   33.9   2.1   41  196-238   139-179 (314)
111 PF00301 Rubredoxin:  Rubredoxi  67.9     4.1   9E-05   24.3   1.6    8  319-326    35-42  (47)
112 PF08274 PhnA_Zn_Ribbon:  PhnA   67.4     1.9   4E-05   22.9   0.1    7  319-325    20-26  (30)
113 PF04959 ARS2:  Arsenite-resist  67.2     2.8   6E-05   34.5   1.1   31  315-345    74-104 (214)
114 smart00734 ZnF_Rad18 Rad18-lik  67.1     3.9 8.5E-05   20.9   1.2   18  292-310     3-20  (26)
115 PRK06266 transcription initiat  66.9       4 8.7E-05   32.6   1.9   32   22-62    114-145 (178)
116 PRK09678 DNA-binding transcrip  66.0     2.6 5.7E-05   27.8   0.6   39  291-331     2-42  (72)
117 COG2879 Uncharacterized small   65.7       9 0.00019   24.2   2.8   30  328-357    22-51  (65)
118 smart00614 ZnF_BED BED zinc fi  63.8     6.4 0.00014   23.8   2.0   25  261-285    18-47  (50)
119 PF14353 CpXC:  CpXC protein     63.0     1.8 3.9E-05   32.5  -0.7   21  290-310    38-58  (128)
120 PF04959 ARS2:  Arsenite-resist  62.5     5.7 0.00012   32.7   2.0   29  258-286    74-102 (214)
121 cd00730 rubredoxin Rubredoxin;  62.0     6.8 0.00015   23.8   1.8    7  319-325    35-41  (50)
122 smart00440 ZnF_C2C2 C2C2 Zinc   60.8     3.8 8.2E-05   23.5   0.6   11  319-329    29-39  (40)
123 KOG1280|consensus               60.4     6.8 0.00015   34.2   2.2   36  290-325    79-116 (381)
124 KOG1280|consensus               59.3      11 0.00024   32.9   3.3   41  196-237    76-116 (381)
125 PF06524 NOA36:  NOA36 protein;  57.5     7.2 0.00016   32.5   1.8   91  165-281   137-229 (314)
126 COG5151 SSL1 RNA polymerase II  55.7      16 0.00035   31.4   3.6   83  259-345   320-415 (421)
127 PF07975 C1_4:  TFIIH C1-like d  55.6     7.6 0.00017   23.6   1.3   26   23-48     19-44  (51)
128 PF10571 UPF0547:  Uncharacteri  55.1     7.4 0.00016   19.9   1.0    8  321-328    17-24  (26)
129 COG3364 Zn-ribbon containing p  54.9       8 0.00017   27.1   1.4   14  261-274     2-15  (112)
130 PF05191 ADK_lid:  Adenylate ki  53.9      12 0.00026   20.9   1.8    8  264-271     4-11  (36)
131 PF01096 TFIIS_C:  Transcriptio  53.8     3.1 6.7E-05   23.7  -0.6   10  319-328    29-38  (39)
132 PF12760 Zn_Tnp_IS1595:  Transp  51.9     8.6 0.00019   22.8   1.1    9  318-326    37-45  (46)
133 PF13878 zf-C2H2_3:  zinc-finge  51.4       7 0.00015   22.5   0.6   24   25-48     13-38  (41)
134 PTZ00255 60S ribosomal protein  48.4     8.9 0.00019   26.5   0.8   33  228-273    34-66  (90)
135 KOG2907|consensus               47.6      10 0.00022   27.2   1.0   10  291-300   103-112 (116)
136 PRK00432 30S ribosomal protein  47.2      12 0.00025   22.8   1.1   10  290-299    37-46  (50)
137 PF14369 zf-RING_3:  zinc-finge  47.1      12 0.00026   20.7   1.1    8   85-92     24-31  (35)
138 COG4530 Uncharacterized protei  46.7      11 0.00023   26.8   1.1   27  232-272    11-37  (129)
139 PF08790 zf-LYAR:  LYAR-type C2  46.3      13 0.00029   19.3   1.1   19   26-45      1-19  (28)
140 TIGR00100 hypA hydrogenase nic  46.1      13 0.00028   27.3   1.5   41    5-61     54-94  (115)
141 PF03811 Zn_Tnp_IS1:  InsA N-te  45.7      11 0.00024   21.0   0.8   29  292-324     7-35  (36)
142 PRK12380 hydrogenase nickel in  44.8      12 0.00026   27.3   1.2   41    5-61     54-94  (113)
143 PF07754 DUF1610:  Domain of un  44.6      13 0.00028   18.6   0.9   11   23-33     14-24  (24)
144 KOG3408|consensus               44.5      10 0.00022   27.6   0.7   26   22-47     54-79  (129)
145 COG4888 Uncharacterized Zn rib  44.5      10 0.00022   26.6   0.7   37   23-63     20-56  (104)
146 KOG2593|consensus               44.4      17 0.00038   33.0   2.3   36   51-90    126-161 (436)
147 PRK03824 hypA hydrogenase nick  44.0      17 0.00038   27.5   1.9   16   23-38     68-83  (135)
148 PF05495 zf-CHY:  CHY zinc fing  43.9     5.4 0.00012   26.3  -0.7   12  230-241    10-21  (71)
149 KOG2593|consensus               43.6      11 0.00023   34.2   0.8   42   18-62    121-162 (436)
150 KOG2272|consensus               43.5      17 0.00038   30.2   2.0   18  111-128    99-116 (332)
151 KOG2807|consensus               43.5      39 0.00085   29.5   4.1   25  318-342   345-369 (378)
152 TIGR00280 L37a ribosomal prote  43.2     9.6 0.00021   26.4   0.4   33  229-274    34-66  (91)
153 KOG4124|consensus               42.0     7.6 0.00017   33.9  -0.3   70  259-338   347-418 (442)
154 PF05443 ROS_MUCR:  ROS/MUCR tr  41.8      14 0.00031   27.7   1.2   27  316-345    70-96  (132)
155 KOG2807|consensus               41.7      49  0.0011   28.9   4.4   32  228-268   343-374 (378)
156 TIGR01206 lysW lysine biosynth  41.4      14 0.00031   22.8   0.9   31   25-63      2-32  (54)
157 cd00924 Cyt_c_Oxidase_Vb Cytoc  41.4      19 0.00042   25.4   1.7   26   11-37     66-91  (97)
158 PF09332 Mcm10:  Mcm10 replicat  41.3       8 0.00017   34.3  -0.3   58  260-327   251-312 (344)
159 COG5188 PRP9 Splicing factor 3  40.9      38 0.00081   29.9   3.6   21  141-161   238-258 (470)
160 PRK04023 DNA polymerase II lar  40.4      34 0.00073   35.0   3.7   11  319-329   664-674 (1121)
161 PF13240 zinc_ribbon_2:  zinc-r  40.4      14 0.00031   18.1   0.7    9   28-36      2-10  (23)
162 COG1198 PriA Primosomal protei  39.8      21 0.00046   35.5   2.3   47   25-91    435-484 (730)
163 PF01780 Ribosomal_L37ae:  Ribo  39.7     8.9 0.00019   26.5  -0.2   11   53-63     53-63  (90)
164 PRK14714 DNA polymerase II lar  38.9      39 0.00084   35.5   3.9   29  290-329   692-720 (1337)
165 PF01155 HypA:  Hydrogenase exp  38.6      14  0.0003   27.1   0.6   27   24-62     69-95  (113)
166 COG0068 HypF Hydrogenase matur  38.5      11 0.00025   36.5   0.2   55   28-90    126-181 (750)
167 COG3357 Predicted transcriptio  38.4      19 0.00042   24.7   1.2   14   52-65     57-70  (97)
168 PF13451 zf-trcl:  Probable zin  38.2      17 0.00038   21.9   0.9   14   23-36      2-15  (49)
169 PRK03976 rpl37ae 50S ribosomal  37.9      12 0.00027   25.8   0.3   32  229-273    35-66  (90)
170 PF11789 zf-Nse:  Zinc-finger o  37.3      33 0.00071   21.5   2.1   32  259-295    22-53  (57)
171 PF13453 zf-TFIIB:  Transcripti  37.0      20 0.00044   20.5   1.1   17  319-335    20-36  (41)
172 PF04606 Ogr_Delta:  Ogr/Delta-  36.7      11 0.00024   22.5  -0.1   36  293-330     2-39  (47)
173 COG5188 PRP9 Splicing factor 3  36.6      24 0.00052   31.0   1.9   27  313-339   369-396 (470)
174 COG3677 Transposase and inacti  36.5      18 0.00038   27.2   0.9   15  316-330    51-65  (129)
175 PRK04023 DNA polymerase II lar  36.5      32 0.00069   35.2   2.9   10  262-271   664-673 (1121)
176 TIGR00244 transcriptional regu  36.2      17 0.00036   27.8   0.8   18  319-336    29-46  (147)
177 KOG3507|consensus               36.2      26 0.00056   21.8   1.4   11  260-270    36-46  (62)
178 PF08271 TF_Zn_Ribbon:  TFIIB z  36.0      18 0.00039   20.9   0.8    9  262-270    20-28  (43)
179 smart00661 RPOL9 RNA polymeras  34.7      38 0.00081   20.4   2.1   11  261-271    20-30  (52)
180 PF14446 Prok-RING_1:  Prokaryo  34.5      19 0.00041   22.2   0.7   10  263-272     7-16  (54)
181 PF07503 zf-HYPF:  HypF finger;  34.0     5.1 0.00011   22.2  -1.7   10  262-271    22-31  (35)
182 COG1656 Uncharacterized conser  33.7      46   0.001   26.0   2.8   46  231-276    98-145 (165)
183 PRK03681 hypA hydrogenase nick  32.9      24 0.00051   25.9   1.1   42    5-61     54-95  (114)
184 PHA02998 RNA polymerase subuni  32.5      23 0.00049   27.9   1.0   11  319-329   172-182 (195)
185 KOG3408|consensus               31.9      21 0.00045   26.1   0.6   22  289-310    56-77  (129)
186 PF07649 C1_3:  C1-like domain;  31.7      28  0.0006   18.3   1.0   10  260-269    14-23  (30)
187 PF13824 zf-Mss51:  Zinc-finger  31.6      45 0.00098   20.7   2.0   13  318-330    14-26  (55)
188 PF04780 DUF629:  Protein of un  31.0      26 0.00056   32.6   1.3   25  319-343    58-82  (466)
189 PF04780 DUF629:  Protein of un  30.9      34 0.00074   31.9   2.0   28  141-168    57-84  (466)
190 PF05290 Baculo_IE-1:  Baculovi  30.8      38 0.00082   25.3   1.8   13   83-95    122-134 (140)
191 TIGR00686 phnA alkylphosphonat  30.7      32  0.0007   24.6   1.4   13  318-330    19-31  (109)
192 PF14311 DUF4379:  Domain of un  30.5      39 0.00086   20.8   1.7   15  262-276    29-43  (55)
193 COG1998 RPS31 Ribosomal protei  30.3      30 0.00066   20.7   1.0    8  291-298    38-45  (51)
194 smart00731 SprT SprT homologue  30.2      33 0.00071   26.4   1.6   11  261-271   112-122 (146)
195 PF05129 Elf1:  Transcription e  29.7     7.4 0.00016   26.5  -1.8   13  319-331    47-59  (81)
196 KOG1606|consensus               29.4      27 0.00059   28.3   1.0   30    1-30    103-132 (296)
197 COG1571 Predicted DNA-binding   28.6      38 0.00083   31.0   1.9   14  290-303   367-380 (421)
198 COG3091 SprT Zn-dependent meta  28.5      22 0.00048   27.2   0.3   13   25-38    117-129 (156)
199 PF13821 DUF4187:  Domain of un  28.4      47   0.001   20.6   1.7   19  291-309    28-46  (55)
200 COG1773 Rubredoxin [Energy pro  28.2      29 0.00062   21.5   0.7   13  261-273     3-15  (55)
201 COG1327 Predicted transcriptio  27.7      32 0.00069   26.4   1.0   16  319-334    29-44  (156)
202 TIGR00595 priA primosomal prot  27.3      42 0.00091   32.0   2.0   34   26-60    214-247 (505)
203 KOG1842|consensus               27.1      27 0.00058   31.9   0.6   30  259-288    13-42  (505)
204 PRK10220 hypothetical protein;  27.1      47   0.001   23.9   1.7   12  319-330    21-32  (111)
205 KOG4124|consensus               26.9      14 0.00031   32.3  -1.0   24  228-251   347-372 (442)
206 PF15135 UPF0515:  Uncharacteri  26.5      46   0.001   27.8   1.8   16  167-182   152-167 (278)
207 PF14205 Cys_rich_KTR:  Cystein  26.0      31 0.00066   21.2   0.6   12  260-271     3-14  (55)
208 TIGR00143 hypF [NiFe] hydrogen  25.9     7.9 0.00017   38.4  -3.1   27  293-325   121-147 (711)
209 PF07282 OrfB_Zn_ribbon:  Putat  25.8      77  0.0017   20.4   2.6   10  319-328    47-56  (69)
210 KOG4118|consensus               25.7      34 0.00073   21.8   0.7   27  319-345    39-65  (74)
211 smart00154 ZnF_AN1 AN1-like Zi  25.6      40 0.00087   19.1   1.0   14   25-38     12-25  (39)
212 KOG1842|consensus               24.9      54  0.0012   30.0   2.1   29  319-347    16-44  (505)
213 KOG3214|consensus               24.8      31 0.00068   24.1   0.5   40  289-332    22-61  (109)
214 PF01927 Mut7-C:  Mut7-C RNAse   24.8      54  0.0012   25.2   1.9   15  261-275   124-138 (147)
215 PF06397 Desulfoferrod_N:  Desu  24.6      13 0.00028   20.7  -1.1   11  361-371     4-14  (36)
216 PRK00564 hypA hydrogenase nick  24.3      49  0.0011   24.4   1.5   17   22-38     68-84  (117)
217 PF10013 DUF2256:  Uncharacteri  24.1      37  0.0008   19.6   0.6   16  262-277     9-24  (42)
218 PRK04351 hypothetical protein;  24.0      46   0.001   25.7   1.4   12  289-300   131-142 (149)
219 PF14803 Nudix_N_2:  Nudix N-te  23.2      46   0.001   18.3   0.9    8  262-269    23-30  (34)
220 KOG4167|consensus               23.2      14  0.0003   35.9  -1.9   27   23-49    790-816 (907)
221 PTZ00448 hypothetical protein;  23.2      57  0.0012   29.2   1.9   24  318-341   314-337 (373)
222 PF14445 Prok-RING_2:  Prokaryo  23.0      16 0.00035   21.9  -1.0   15   24-38      6-20  (57)
223 COG5152 Uncharacterized conser  23.0      72  0.0016   25.6   2.2   16   23-38    194-209 (259)
224 COG5112 UFD2 U1-like Zn-finger  23.0      29 0.00063   24.5   0.1   26   22-47     52-77  (126)
225 PF04328 DUF466:  Protein of un  22.5 1.1E+02  0.0024   19.8   2.7   30  329-358    23-52  (65)
226 PF01428 zf-AN1:  AN1-like Zinc  22.1      45 0.00097   19.3   0.8   14   24-37     12-25  (43)
227 PRK00762 hypA hydrogenase nick  22.0      54  0.0012   24.4   1.4   15   23-38     68-82  (124)
228 TIGR03831 YgiT_finger YgiT-typ  21.9      39 0.00085   19.5   0.5   12  319-330    33-44  (46)
229 PF09963 DUF2197:  Uncharacteri  21.8      33 0.00073   21.3   0.2    9  172-180     4-12  (56)
230 PF08209 Sgf11:  Sgf11 (transcr  21.2      67  0.0015   17.5   1.3   19  291-310     5-23  (33)
231 PF01363 FYVE:  FYVE zinc finge  21.1      36 0.00077   22.0   0.2    9  263-271    11-19  (69)
232 smart00132 LIM Zinc-binding do  21.0      54  0.0012   17.8   1.0   10   54-63     28-37  (39)
233 PF10276 zf-CHCC:  Zinc-finger   20.9      88  0.0019   18.0   1.7   18   18-35     22-39  (40)
234 PF03966 Trm112p:  Trm112p-like  20.9      49  0.0011   21.5   0.8   18   19-36     47-64  (68)
235 COG4957 Predicted transcriptio  20.8      44 0.00096   25.0   0.7   21  263-287    78-98  (148)
236 cd00065 FYVE FYVE domain; Zinc  20.5      58  0.0013   20.0   1.1    9  264-272     5-13  (57)
237 PF05741 zf-nanos:  Nanos RNA b  20.4      21 0.00045   22.2  -0.9    9  319-327    34-42  (55)
238 KOG0717|consensus               20.1      53  0.0011   30.4   1.1   19  262-280   293-311 (508)

No 1  
>KOG3608|consensus
Probab=99.94  E-value=4.7e-27  Score=193.62  Aligned_cols=226  Identities=27%  Similarity=0.564  Sum_probs=194.3

Q ss_pred             ccc--CCCCccccChHHHHHhhhcccCC-----------CC-CCcc--cccccccccCHHHHHHHHhhhccCCCceeccc
Q psy10075        112 FSC--NFCDYKSKTKYDITSHSLRKHSK-----------GD-KPHK--CTICESTYLTKVELKNHILKIHQGQTRFQCSF  175 (373)
Q Consensus       112 ~~C--~~C~~~f~~~~~l~~h~~~~h~~-----------~~-~~~~--C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~  175 (373)
                      |.|  ..|+..|.+...+.+|+ -.|..           ++ ..+.  +..|-+.+.++..|+.|+ +.|++++...|+.
T Consensus       135 f~C~WedCe~~F~s~~ef~dHV-~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~-r~Hs~eKvvACp~  212 (467)
T KOG3608|consen  135 FRCGWEDCEREFVSIVEFQDHV-VKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHI-RTHSNEKVVACPH  212 (467)
T ss_pred             hccChhhcCCcccCHHHHHHHH-HHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHH-HhcCCCeEEecch
Confidence            455  45888888888888883 23321           22 2233  456999999999999997 8999999999999


Q ss_pred             ccccccchhHHHhhhhhcc-CCCCccccCCCchhccCcHHHHHHHHHhcCCCCccceecCCCcccccChHHHhhhhhccC
Q psy10075        176 CDRRFYFKNECTKHYLEHH-TNEKPFKCTLCSYKAKRNFELKQHILRIHQDNIEAEYHCTYCDYICSSRTILKSHINKKH  254 (373)
Q Consensus       176 C~~~f~~~~~l~~H~~~~h-~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~  254 (373)
                      ||..|..+..|..|.++.. ....+|+|..|.+.|.+...|..|+ +.|    ..-|+|+.|..+....++|..|++..|
T Consensus       213 Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv-~rH----vn~ykCplCdmtc~~~ssL~~H~r~rH  287 (467)
T KOG3608|consen  213 CGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHV-VRH----VNCYKCPLCDMTCSSASSLTTHIRYRH  287 (467)
T ss_pred             HHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHH-HHh----hhcccccccccCCCChHHHHHHHHhhh
Confidence            9999999999999975543 3457999999999999999999998 666    457999999999999999999998888


Q ss_pred             CCCCCCCeecCCCCccccChhHHHHhhhhhccCCCCccCCC--CcccccchhhhhhhhhhccCC-Cc--ccCCCCCCCcc
Q psy10075        255 ANDEDKPFTCEHCDSKFCKKYDMKMHMSRAHYGLKPFKCSF--CEYKCTTKFGLKSHVTRIHSN-QK--YFCGSCNFSCT  329 (373)
Q Consensus       255 ~~~~~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~--C~~~f~~~~~l~~H~~~~h~~-~~--~~C~~C~~~f~  329 (373)
                      ..  ++||+|..|++.|.+.+.|..|+ ..|. +..|+|..  |.+.|.+..+|++|++.+|.+ .+  |.|..|++-|.
T Consensus       288 s~--dkpfKCd~Cd~~c~~esdL~kH~-~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft  363 (467)
T KOG3608|consen  288 SK--DKPFKCDECDTRCVRESDLAKHV-QVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFT  363 (467)
T ss_pred             cc--CCCccccchhhhhccHHHHHHHH-Hhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhc
Confidence            76  99999999999999999999999 7888 77899999  999999999999999999843 33  99999999999


Q ss_pred             ChhHHHHHHHhhccccccc
Q psy10075        330 SNTDLLEHVQTNHIIVGES  348 (373)
Q Consensus       330 ~~~~l~~H~~~~H~~~~~~  348 (373)
                      +..+|..|++..|++..+.
T Consensus       364 ~G~~L~~HL~kkH~f~~Ps  382 (467)
T KOG3608|consen  364 SGKSLSAHLMKKHGFRLPS  382 (467)
T ss_pred             cchhHHHHHHHhhcccCCC
Confidence            9999999999999865543


No 2  
>KOG2462|consensus
Probab=99.94  E-value=2.1e-27  Score=190.93  Aligned_cols=140  Identities=24%  Similarity=0.505  Sum_probs=125.7

Q ss_pred             CCCccccCCCchhccCcHHHHHHHHHhcCCCCccceecCCCcccccChHHHhhhhhccCCCCCCCCeecCCCCccccChh
Q psy10075        196 NEKPFKCTLCSYKAKRNFELKQHILRIHQDNIEAEYHCTYCDYICSSRTILKSHINKKHANDEDKPFTCEHCDSKFCKKY  275 (373)
Q Consensus       196 ~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~C~~C~~~f~~~~  275 (373)
                      ....|+|+.||+.+.+.++|.+|.+..-.....+.+.|+.|++.|.+...|..|++++.     -+..|.+|||.|...+
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~-----l~c~C~iCGKaFSRPW  201 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT-----LPCECGICGKAFSRPW  201 (279)
T ss_pred             cCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC-----CCcccccccccccchH
Confidence            44678999999999999999999744444455778999999999999999999996443     4689999999999999


Q ss_pred             HHHHhhhhhccCCCCccCCCCcccccchhhhhhhhhhccCCCcccCCCCCCCccChhHHHHHHHhh
Q psy10075        276 DMKMHMSRAHYGLKPFKCSFCEYKCTTKFGLKSHVTRIHSNQKYFCGSCNFSCTSNTDLLEHVQTN  341 (373)
Q Consensus       276 ~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~~  341 (373)
                      .|+-|+ +.|+||+||.|+.|++.|.++++|+.||++|-+.++|+|+.|++.|....-|-+|...-
T Consensus       202 LLQGHi-RTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES~  266 (279)
T KOG2462|consen  202 LLQGHI-RTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSESA  266 (279)
T ss_pred             Hhhccc-ccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhhc
Confidence            999999 99999999999999999999999999999999999999999999999999999997653


No 3  
>KOG3608|consensus
Probab=99.94  E-value=2.8e-26  Score=189.04  Aligned_cols=257  Identities=25%  Similarity=0.536  Sum_probs=189.2

Q ss_pred             ceecCC--CCccccC-hhhHhhccccCCC----------------------------------CCcccc--CcCcccccc
Q psy10075         25 NFICIL--CNYHAEN-FENIYLHLPSHFE----------------------------------QKLFSC--DLCEYQTNT   65 (373)
Q Consensus        25 ~~~C~~--C~~~f~~-~~~l~~H~~~h~~----------------------------------~~~~~C--~~C~~~f~~   65 (373)
                      .+.|..  |++...+ ...|.+|+..|.=                                  ...|.|  ..|+..|.+
T Consensus        69 e~qC~w~~C~f~~~~~s~~l~RHvy~H~y~~~l~q~G~~al~~~~dig~c~~~f~~~~~ip~~g~~f~C~WedCe~~F~s  148 (467)
T KOG3608|consen   69 EHQCTWNSCDFRTENSSADLIRHVYFHCYHTKLKQQGKLALDLHPDIGACTAPFRLMEKIPALGQNFRCGWEDCEREFVS  148 (467)
T ss_pred             ceeEEeccCCccccchHHHHHhhhhhhhhHHHHHHHHHHHHhcCCCcCcccCCcchhhccccchhhhccChhhcCCcccC
Confidence            567754  8877655 5789999876630                                  012445  458888888


Q ss_pred             hHHHHHHhhhhhcc------------C-CccccCc--cccccCCchHHHHHHhhhcCCCCCcccCCCCccccChHHHHHh
Q psy10075         66 KIYIRRHMLKIHLR------------Q-RNLECSL--CDSTFSDNMDLKKHIQRKHTNDRPFSCNFCDYKSKTKYDITSH  130 (373)
Q Consensus        66 ~~~l~~H~~~~h~~------------~-~~~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~h  130 (373)
                      ...+..|+ ..|+-            + ..+.|..  |-+.+.++..|+.|+ +.|++++...|+.|+.-|.+...|.+|
T Consensus       149 ~~ef~dHV-~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~-r~Hs~eKvvACp~Cg~~F~~~tkl~DH  226 (467)
T KOG3608|consen  149 IVEFQDHV-VKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHI-RTHSNEKVVACPHCGELFRTKTKLFDH  226 (467)
T ss_pred             HHHHHHHH-HHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHH-HhcCCCeEEecchHHHHhccccHHHHH
Confidence            88888884 44421            1 2355644  777788888888884 778888888888888888888888888


Q ss_pred             hhcccCCCCCCcccccccccccCHHHHHHHHhhhccCCCceecccccccccchhHHHhhhhhccCCCCccccCCCchhcc
Q psy10075        131 SLRKHSKGDKPHKCTICESTYLTKVELKNHILKIHQGQTRFQCSFCDRRFYFKNECTKHYLEHHTNEKPFKCTLCSYKAK  210 (373)
Q Consensus       131 ~~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~  210 (373)
                      +++.......+|.|..|.+.|.+...|..|+ ..|  ..-|+|+.|+.+....++|..|+...|..++||+|..|++.+.
T Consensus       227 ~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv-~rH--vn~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~  303 (467)
T KOG3608|consen  227 LRRQTELNTNSFQCAQCFKRFATEKLLKSHV-VRH--VNCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCV  303 (467)
T ss_pred             HHhhhhhcCCchHHHHHHHHHhHHHHHHHHH-HHh--hhcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhc
Confidence            7776666667888888888888888888886 555  4567888888888888888888877788888888888888888


Q ss_pred             CcHHHHHHHHHhcCCCCccceecCC--CcccccChHHHhhhhhccCCCCCCCCeecCCCCccccChhHHHHhhhhhccCC
Q psy10075        211 RNFELKQHILRIHQDNIEAEYHCTY--CDYICSSRTILKSHINKKHANDEDKPFTCEHCDSKFCKKYDMKMHMSRAHYGL  288 (373)
Q Consensus       211 ~~~~l~~H~~~~h~~~~~~~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~  288 (373)
                      +.++|.+|+ ..|.   +..|.|+.  |...+.+...+..|+.++|.+....+|.|-.|++.|++-.+|..|+.+.|.-.
T Consensus       304 ~esdL~kH~-~~HS---~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH~f~  379 (467)
T KOG3608|consen  304 RESDLAKHV-QVHS---KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMKKHGFR  379 (467)
T ss_pred             cHHHHHHHH-Hhcc---ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhccchhHHHHHHHhhccc
Confidence            888888887 4665   45677766  88888888888888877777777777888888888888888888876666544


Q ss_pred             CC
Q psy10075        289 KP  290 (373)
Q Consensus       289 ~~  290 (373)
                      .|
T Consensus       380 ~P  381 (467)
T KOG3608|consen  380 LP  381 (467)
T ss_pred             CC
Confidence            33


No 4  
>KOG1074|consensus
Probab=99.93  E-value=4.6e-27  Score=213.88  Aligned_cols=200  Identities=25%  Similarity=0.488  Sum_probs=153.5

Q ss_pred             CCcccccccccccCHHHHHHHHhhhccCCCceecccccccccchhHHHhhhhhccCC----CCccccC---CCchhccCc
Q psy10075        140 KPHKCTICESTYLTKVELKNHILKIHQGQTRFQCSFCDRRFYFKNECTKHYLEHHTN----EKPFKCT---LCSYKAKRN  212 (373)
Q Consensus       140 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~----~~~~~C~---~C~~~f~~~  212 (373)
                      .+..|-.|.++..-..+|+.|. +.|+|++||+|.+||+.|..+.+|..|+ ..|..    ..++.||   +|.+.|...
T Consensus       604 dPNqCiiC~rVlSC~saLqmHy-rtHtGERPFkCKiCgRAFtTkGNLkaH~-~vHka~p~~R~q~ScP~~~ic~~kftn~  681 (958)
T KOG1074|consen  604 DPNQCIICLRVLSCPSALQMHY-RTHTGERPFKCKICGRAFTTKGNLKAHM-SVHKAKPPARVQFSCPSTFICQKKFTNA  681 (958)
T ss_pred             Cccceeeeeecccchhhhhhhh-hcccCcCccccccccchhccccchhhcc-cccccCccccccccCCchhhhccccccc
Confidence            4678999999999999999998 8999999999999999999999999997 44433    3568899   999999999


Q ss_pred             HHHHHHHHHhcCCC-----------CccceecCCCcccccChHHHhhhhhccCCC-------------CCC----CCeec
Q psy10075        213 FELKQHILRIHQDN-----------IEAEYHCTYCDYICSSRTILKSHINKKHAN-------------DED----KPFTC  264 (373)
Q Consensus       213 ~~l~~H~~~~h~~~-----------~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~-------------~~~----~~~~C  264 (373)
                      ..|..|+ +.|...           ....-.|..|.+.|.+...+..++..+-..             .++    .+..+
T Consensus       682 V~lpQhI-riH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e  760 (958)
T KOG1074|consen  682 VTLPQHI-RIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPE  760 (958)
T ss_pred             ccccceE-EeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCccc
Confidence            9999998 777521           112357899999998888888777443110             011    13556


Q ss_pred             CCCCccccChhHHHHhhhhh----------------------ccCCC---------------------------------
Q psy10075        265 EHCDSKFCKKYDMKMHMSRA----------------------HYGLK---------------------------------  289 (373)
Q Consensus       265 ~~C~~~f~~~~~L~~H~~~~----------------------H~~~~---------------------------------  289 (373)
                      ..|+..+.....+..+-...                      +++++                                 
T Consensus       761 ~~~~~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg  840 (958)
T KOG1074|consen  761 NSCGRELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEG  840 (958)
T ss_pred             cccccccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhcccccccccc
Confidence            66776665554443332100                      00000                                 


Q ss_pred             --------------------------------------CccCCCCcccccchhhhhhhhhhccCCCcccCCCCCCCccCh
Q psy10075        290 --------------------------------------PFKCSFCEYKCTTKFGLKSHVTRIHSNQKYFCGSCNFSCTSN  331 (373)
Q Consensus       290 --------------------------------------~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~~C~~~f~~~  331 (373)
                                                            .-.|..|++.|.+.++|..|+++|.++++|.|.+|++.|..+
T Consensus       841 ~~t~~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttr  920 (958)
T KOG1074|consen  841 LATKTNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTR  920 (958)
T ss_pred             cccccccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhh
Confidence                                                  056999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHhhc
Q psy10075        332 TDLLEHVQTNH  342 (373)
Q Consensus       332 ~~l~~H~~~~H  342 (373)
                      .+|++||.+|+
T Consensus       921 gnLKvHMgtH~  931 (958)
T KOG1074|consen  921 GNLKVHMGTHM  931 (958)
T ss_pred             hhhhhhhcccc
Confidence            99999999997


No 5  
>KOG1074|consensus
Probab=99.92  E-value=2.1e-26  Score=209.54  Aligned_cols=48  Identities=35%  Similarity=0.768  Sum_probs=40.0

Q ss_pred             cccCccccccCCchHHHHHHhhhcCCCCCcccCCCCccccChHHHHHhh
Q psy10075         83 LECSLCDSTFSDNMDLKKHIQRKHTNDRPFSCNFCDYKSKTKYDITSHS  131 (373)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~  131 (373)
                      .+|..|.+.|...+.|+.| .++|++++||+|.+|+..|.++.+|+.|.
T Consensus       354 hkCr~CakvfgS~SaLqiH-lRSHTGERPfqCnvCG~~FSTkGNLKvH~  401 (958)
T KOG1074|consen  354 HKCRFCAKVFGSDSALQIH-LRSHTGERPFQCNVCGNRFSTKGNLKVHF  401 (958)
T ss_pred             chhhhhHhhcCchhhhhhh-hhccCCCCCeeecccccccccccceeeee
Confidence            5688888888888888888 47888888888888888888888888883


No 6  
>KOG2462|consensus
Probab=99.91  E-value=3.1e-25  Score=178.49  Aligned_cols=126  Identities=23%  Similarity=0.507  Sum_probs=117.1

Q ss_pred             ccceecCCCcccccChHHHhhhhhccCCCCCCCCeecCCCCccccChhHHHHhhhhhccCCCCccCCCCcccccchhhhh
Q psy10075        228 EAEYHCTYCDYICSSRTILKSHINKKHANDEDKPFTCEHCDSKFCKKYDMKMHMSRAHYGLKPFKCSFCEYKCTTKFGLK  307 (373)
Q Consensus       228 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~  307 (373)
                      ...|.|++||+.+.+.++|.+|.+.+-..+..+.+.|+.|++.|.....|.+|+ ++|+  -+.+|.+||+.|...=-|.
T Consensus       128 ~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHi-rTH~--l~c~C~iCGKaFSRPWLLQ  204 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHI-RTHT--LPCECGICGKAFSRPWLLQ  204 (279)
T ss_pred             CCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHh-hccC--CCcccccccccccchHHhh
Confidence            456999999999999999999998888888888999999999999999999999 8886  6799999999999999999


Q ss_pred             hhhhhccCCCcccCCCCCCCccChhHHHHHHHhhcccccccccchhHHHHHHHhhhhHhhhccccC
Q psy10075        308 SHVTRIHSNQKYFCGSCNFSCTSNTDLLEHVQTNHIIVGESSSRDFIIHSFVKNAMYHCQITLNAF  373 (373)
Q Consensus       308 ~H~~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f  373 (373)
                      -|+++|.|++||.|+.|++.|.++.||+.||++|   .+              .+.|+|+.|+|+|
T Consensus       205 GHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTH---S~--------------~K~~qC~~C~KsF  253 (279)
T KOG2462|consen  205 GHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTH---SD--------------VKKHQCPRCGKSF  253 (279)
T ss_pred             cccccccCCCCccCCcccchhcchHHHHHHHHhh---cC--------------CccccCcchhhHH
Confidence            9999999999999999999999999999999999   32              3579999999998


No 7  
>KOG3623|consensus
Probab=99.86  E-value=2.3e-22  Score=180.59  Aligned_cols=107  Identities=28%  Similarity=0.597  Sum_probs=90.9

Q ss_pred             CcceecCCCCccccChhhHhhccc-cCC-CCCccccCcCcccccchHHHHHHhhhhhcc-------------CCccccCc
Q psy10075         23 SYNFICILCNYHAENFENIYLHLP-SHF-EQKLFSCDLCEYQTNTKIYIRRHMLKIHLR-------------QRNLECSL   87 (373)
Q Consensus        23 ~~~~~C~~C~~~f~~~~~l~~H~~-~h~-~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~-------------~~~~~C~~   87 (373)
                      ...+.|+.|.+.+.....|..|++ .|. .+..|.|..|..+|..+..|.+|| ..|..             .+.|+|..
T Consensus       208 sqlltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm-~~hkpg~dqa~sltqsa~lRKFKCtE  286 (1007)
T KOG3623|consen  208 SQLLTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHM-QLHKPGGDQAISLTQSALLRKFKCTE  286 (1007)
T ss_pred             hhhhcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHH-HhhcCCCcccccccchhhhccccccc
Confidence            345789999999999999999965 333 345699999999999999999996 45522             35699999


Q ss_pred             cccccCCchHHHHHHhhhcCCCCCcccCCCCccccChHHHHHhh
Q psy10075         88 CDSTFSDNMDLKKHIQRKHTNDRPFSCNFCDYKSKTKYDITSHS  131 (373)
Q Consensus        88 C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~  131 (373)
                      |++.|..+..|..|+ ++|.|++||.|+.|.+.|.....+..||
T Consensus       287 CgKAFKfKHHLKEHl-RIHSGEKPfeCpnCkKRFSHSGSySSHm  329 (1007)
T KOG3623|consen  287 CGKAFKFKHHLKEHL-RIHSGEKPFECPNCKKRFSHSGSYSSHM  329 (1007)
T ss_pred             cchhhhhHHHHHhhh-eeecCCCCcCCcccccccccCCcccccc
Confidence            999999999999995 8999999999999999999999999994


No 8  
>KOG3623|consensus
Probab=99.85  E-value=2.5e-22  Score=180.35  Aligned_cols=78  Identities=22%  Similarity=0.554  Sum_probs=75.2

Q ss_pred             eecCCCCccccChhHHHHhhhhhccCCCCccCCCCcccccchhhhhhhhhhccCCCcccCCCCCCCccChhHHHHHHHh
Q psy10075        262 FTCEHCDSKFCKKYDMKMHMSRAHYGLKPFKCSFCEYKCTTKFGLKSHVTRIHSNQKYFCGSCNFSCTSNTDLLEHVQT  340 (373)
Q Consensus       262 ~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~  340 (373)
                      |.|..|+|+|...+.|.+|. ..|+|.+||+|.+|.+.|..+..|..|.+.|-|+++|+|..|++.|......-.||.-
T Consensus       895 yaCDqCDK~FqKqSSLaRHK-YEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHMNH  972 (1007)
T KOG3623|consen  895 YACDQCDKAFQKQSSLARHK-YEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHMNH  972 (1007)
T ss_pred             chHHHHHHHHHhhHHHHHhh-hhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhhcc
Confidence            99999999999999999999 9999999999999999999999999999999999999999999999999999999763


No 9  
>KOG3576|consensus
Probab=99.64  E-value=7.1e-17  Score=123.61  Aligned_cols=114  Identities=28%  Similarity=0.660  Sum_probs=87.7

Q ss_pred             cceecCCCcccccChHHHhhhhhccCCCCCCCCeecCCCCccccChhHHHHhhhhhccCCCCccCCCCcccccchhhhhh
Q psy10075        229 AEYHCTYCDYICSSRTILKSHINKKHANDEDKPFTCEHCDSKFCKKYDMKMHMSRAHYGLKPFKCSFCEYKCTTKFGLKS  308 (373)
Q Consensus       229 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~  308 (373)
                      ..|.|.+|++.|.-.-.|.+|++- |  ...+.|.|..||+.|.....|.+|+ +.|++.+||+|..|++.|+.+-+|..
T Consensus       116 d~ftCrvCgK~F~lQRmlnrh~kc-h--~~vkr~lct~cgkgfndtfdlkrh~-rthtgvrpykc~~c~kaftqrcsles  191 (267)
T KOG3576|consen  116 DSFTCRVCGKKFGLQRMLNRHLKC-H--SDVKRHLCTFCGKGFNDTFDLKRHT-RTHTGVRPYKCSLCEKAFTQRCSLES  191 (267)
T ss_pred             CeeeeehhhhhhhHHHHHHHHhhh-c--cHHHHHHHhhccCcccchhhhhhhh-ccccCccccchhhhhHHHHhhccHHH
Confidence            346677777777666666666642 2  2256677888888888888888888 78888888888888888888888888


Q ss_pred             hhhhccCCC-----------cccCCCCCCCccChhHHHHHHHhhccccc
Q psy10075        309 HVTRIHSNQ-----------KYFCGSCNFSCTSNTDLLEHVQTNHIIVG  346 (373)
Q Consensus       309 H~~~~h~~~-----------~~~C~~C~~~f~~~~~l~~H~~~~H~~~~  346 (373)
                      |++..|+..           .|.|..||+.-...+.+..|++.+|+...
T Consensus       192 hl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Sp  240 (267)
T KOG3576|consen  192 HLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSP  240 (267)
T ss_pred             HHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCH
Confidence            887777643           39999999999999999999999987553


No 10 
>KOG3576|consensus
Probab=99.56  E-value=1.2e-15  Score=117.02  Aligned_cols=131  Identities=22%  Similarity=0.377  Sum_probs=89.8

Q ss_pred             eeecCCCCcceecCCCCccccChhhHhhccccCCCCCccccCcCcccccchHHHHHHhhhhhccCCccccCccccccCCc
Q psy10075         16 FVSRLDDSYNFICILCNYHAENFENIYLHLPSHFEQKLFSCDLCEYQTNTKIYIRRHMLKIHLRQRNLECSLCDSTFSDN   95 (373)
Q Consensus        16 ~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~   95 (373)
                      .+....+...|.|.+|++.|.....|.+|++-|..-+.+-|.-||+.|+.-.+|.+| ...|.+-+||+|..|++.|..+
T Consensus       108 t~gsssd~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh-~rthtgvrpykc~~c~kaftqr  186 (267)
T KOG3576|consen  108 TIGSSSDQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRH-TRTHTGVRPYKCSLCEKAFTQR  186 (267)
T ss_pred             cccCCCCCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhh-hccccCccccchhhhhHHHHhh
Confidence            334444566677888888887777777888777777777777777777777777777 4677777777777777777777


Q ss_pred             hHHHHHHhhhcCCCCCcccCCCCccccChHHHHHhhhcccCCCCCCcccccccccccCHHHHHHHHhhhccC
Q psy10075         96 MDLKKHIQRKHTNDRPFSCNFCDYKSKTKYDITSHSLRKHSKGDKPHKCTICESTYLTKVELKNHILKIHQG  167 (373)
Q Consensus        96 ~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~  167 (373)
                      -.|..|++.+|.....|             .+.+-       .++.|.|..||..-.....+..|+...|..
T Consensus       187 csleshl~kvhgv~~~y-------------ayker-------r~kl~vcedcg~t~~~~e~~~~h~~~~hp~  238 (267)
T KOG3576|consen  187 CSLESHLKKVHGVQHQY-------------AYKER-------RAKLYVCEDCGYTSERPEVYYLHLKLHHPF  238 (267)
T ss_pred             ccHHHHHHHHcCchHHH-------------HHHHh-------hhheeeecccCCCCCChhHHHHHHHhcCCC
Confidence            77777777777543222             11111       345677777777777777777776444433


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.23  E-value=3.6e-11  Score=109.93  Aligned_cols=146  Identities=20%  Similarity=0.396  Sum_probs=108.4

Q ss_pred             eecccccccccchhHHHhhhhhccCCCCccccCC--CchhccCcHHHHHHHHHhcCCCCccceecCCCcccccChHHHhh
Q psy10075        171 FQCSFCDRRFYFKNECTKHYLEHHTNEKPFKCTL--CSYKAKRNFELKQHILRIHQDNIEAEYHCTYCDYICSSRTILKS  248 (373)
Q Consensus       171 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~~~~~C~~C~~~f~~~~~l~~  248 (373)
                      -.|+.|..... ...|..|. . +..-..-.|+.  |+..|.... +            ++.+.|+.|++.|. ...|..
T Consensus       408 V~C~NC~~~i~-l~~l~lHe-~-~C~r~~V~Cp~~~Cg~v~~r~e-l------------~~H~~C~~Cgk~f~-~s~Lek  470 (567)
T PLN03086        408 VECRNCKHYIP-SRSIALHE-A-YCSRHNVVCPHDGCGIVLRVEE-A------------KNHVHCEKCGQAFQ-QGEMEK  470 (567)
T ss_pred             EECCCCCCccc-hhHHHHHH-h-hCCCcceeCCcccccceeeccc-c------------ccCccCCCCCCccc-hHHHHH
Confidence            46888877766 44566774 3 34445566874  888773322 2            33458999999885 678899


Q ss_pred             hhhccCCCCCCCCeecCCCCccccChhHHHHhhhhhccCCCCccCCCCccccc----------chhhhhhhhhhccCCCc
Q psy10075        249 HINKKHANDEDKPFTCEHCDSKFCKKYDMKMHMSRAHYGLKPFKCSFCEYKCT----------TKFGLKSHVTRIHSNQK  318 (373)
Q Consensus       249 H~~~~~~~~~~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~----------~~~~l~~H~~~~h~~~~  318 (373)
                      |+...|     .++.|+ ||+.+ ....|..|+ ..|...+++.|++|++.|.          ..+.|..|.. ..+..+
T Consensus       471 H~~~~H-----kpv~Cp-Cg~~~-~R~~L~~H~-~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~-~CG~rt  541 (567)
T PLN03086        471 HMKVFH-----EPLQCP-CGVVL-EKEQMVQHQ-ASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHES-ICGSRT  541 (567)
T ss_pred             HHHhcC-----CCccCC-CCCCc-chhHHHhhh-hccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHH-hcCCcc
Confidence            986543     579999 99765 668999998 7888899999999999884          1347889984 468888


Q ss_pred             ccCCCCCCCccChhHHHHHHHhhcc
Q psy10075        319 YFCGSCNFSCTSNTDLLEHVQTNHI  343 (373)
Q Consensus       319 ~~C~~C~~~f~~~~~l~~H~~~~H~  343 (373)
                      +.|..||+.+.. ..|..|+...|.
T Consensus       542 ~~C~~Cgk~Vrl-rdm~~H~~~~h~  565 (567)
T PLN03086        542 APCDSCGRSVML-KEMDIHQIAVHQ  565 (567)
T ss_pred             eEccccCCeeee-hhHHHHHHHhhc
Confidence            999999988776 468888887764


No 12 
>PHA00733 hypothetical protein
Probab=99.17  E-value=3.5e-11  Score=89.59  Aligned_cols=85  Identities=16%  Similarity=0.333  Sum_probs=62.1

Q ss_pred             CCCeecCCCCccccChhHHHHh--hh--hhccCCCCccCCCCcccccchhhhhhhhhhccCCCcccCCCCCCCccChhHH
Q psy10075        259 DKPFTCEHCDSKFCKKYDMKMH--MS--RAHYGLKPFKCSFCEYKCTTKFGLKSHVTRIHSNQKYFCGSCNFSCTSNTDL  334 (373)
Q Consensus       259 ~~~~~C~~C~~~f~~~~~L~~H--~~--~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~~C~~~f~~~~~l  334 (373)
                      .+++.|.+|+..|.....|..+  +.  ..+.+.+||.|+.|++.|.+...|..|++.+  ..+|.|..|++.|.....|
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL  115 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDST  115 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHH
Confidence            5556666666666665555554  10  1333477888888888888888888888643  3458999999999999999


Q ss_pred             HHHHHhhcccc
Q psy10075        335 LEHVQTNHIIV  345 (373)
Q Consensus       335 ~~H~~~~H~~~  345 (373)
                      ..|+...|+|.
T Consensus       116 ~~H~~~~h~~~  126 (128)
T PHA00733        116 LDHVCKKHNIC  126 (128)
T ss_pred             HHHHHHhcCcc
Confidence            99999998864


No 13 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.05  E-value=6e-10  Score=102.09  Aligned_cols=147  Identities=17%  Similarity=0.359  Sum_probs=106.2

Q ss_pred             CcccccccccccCHHHHHHHHhhhccCCCceeccc--ccccccchhHHHhhhhhccCCCCccccCCCchhccCcHHHHHH
Q psy10075        141 PHKCTICESTYLTKVELKNHILKIHQGQTRFQCSF--CDRRFYFKNECTKHYLEHHTNEKPFKCTLCSYKAKRNFELKQH  218 (373)
Q Consensus       141 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H  218 (373)
                      ...|+.|.+.... ..|..|.  .+.....-.|+.  |+..|. +..+..|          +.|+.|++.|. ...|..|
T Consensus       407 ~V~C~NC~~~i~l-~~l~lHe--~~C~r~~V~Cp~~~Cg~v~~-r~el~~H----------~~C~~Cgk~f~-~s~LekH  471 (567)
T PLN03086        407 TVECRNCKHYIPS-RSIALHE--AYCSRHNVVCPHDGCGIVLR-VEEAKNH----------VHCEKCGQAFQ-QGEMEKH  471 (567)
T ss_pred             eEECCCCCCccch-hHHHHHH--hhCCCcceeCCcccccceee-ccccccC----------ccCCCCCCccc-hHHHHHH
Confidence            3578888876553 4566774  444455667874  888885 3333333          47999999985 5778999


Q ss_pred             HHHhcCCCCccceecCCCcccccChHHHhhhhhccCCCCCCCCeecCCCCcccc----------ChhHHHHhhhhhccCC
Q psy10075        219 ILRIHQDNIEAEYHCTYCDYICSSRTILKSHINKKHANDEDKPFTCEHCDSKFC----------KKYDMKMHMSRAHYGL  288 (373)
Q Consensus       219 ~~~~h~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~C~~C~~~f~----------~~~~L~~H~~~~H~~~  288 (373)
                      +...|     .++.|+ ||+.+ .+..|..|+..   +-+.+++.|+.|++.|.          ....|..|. ... +.
T Consensus       472 ~~~~H-----kpv~Cp-Cg~~~-~R~~L~~H~~t---hCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE-~~C-G~  539 (567)
T PLN03086        472 MKVFH-----EPLQCP-CGVVL-EKEQMVQHQAS---TCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHE-SIC-GS  539 (567)
T ss_pred             HHhcC-----CCccCC-CCCCc-chhHHHhhhhc---cCCCCceeCCCCCCccccCccccchhhhhhhHHHHH-Hhc-CC
Confidence            85433     678999 99755 66899999742   23478999999999985          245899998 554 78


Q ss_pred             CCccCCCCcccccchhhhhhhhhhccC
Q psy10075        289 KPFKCSFCEYKCTTKFGLKSHVTRIHS  315 (373)
Q Consensus       289 ~~~~C~~C~~~f~~~~~l~~H~~~~h~  315 (373)
                      +++.|..|++.+ ....|..|+...|.
T Consensus       540 rt~~C~~Cgk~V-rlrdm~~H~~~~h~  565 (567)
T PLN03086        540 RTAPCDSCGRSV-MLKEMDIHQIAVHQ  565 (567)
T ss_pred             cceEccccCCee-eehhHHHHHHHhhc
Confidence            889999999987 46678888866654


No 14 
>PHA00733 hypothetical protein
Probab=99.05  E-value=2e-10  Score=85.58  Aligned_cols=85  Identities=16%  Similarity=0.300  Sum_probs=61.1

Q ss_pred             ccceecCCCcccccChHHHhhh--hhccCCCCCCCCeecCCCCccccChhHHHHhhhhhccCCCCccCCCCcccccchhh
Q psy10075        228 EAEYHCTYCDYICSSRTILKSH--INKKHANDEDKPFTCEHCDSKFCKKYDMKMHMSRAHYGLKPFKCSFCEYKCTTKFG  305 (373)
Q Consensus       228 ~~~~~C~~C~~~f~~~~~l~~H--~~~~~~~~~~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~  305 (373)
                      .+++.|.+|+..|.+...|..+  +..+....+.+||.|+.|++.|.....|..|+ +.|  +.+|.|..|++.|.....
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~-r~h--~~~~~C~~CgK~F~~~~s  114 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHI-RYT--EHSKVCPVCGKEFRNTDS  114 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHH-hcC--CcCccCCCCCCccCCHHH
Confidence            5667777777777766666555  22222333477888888888888888888888 444  356888888888888888


Q ss_pred             hhhhhhhccC
Q psy10075        306 LKSHVTRIHS  315 (373)
Q Consensus       306 l~~H~~~~h~  315 (373)
                      |..|+...|+
T Consensus       115 L~~H~~~~h~  124 (128)
T PHA00733        115 TLDHVCKKHN  124 (128)
T ss_pred             HHHHHHHhcC
Confidence            8888866664


No 15 
>KOG3993|consensus
Probab=98.82  E-value=2.5e-09  Score=91.76  Aligned_cols=53  Identities=13%  Similarity=0.051  Sum_probs=41.8

Q ss_pred             ccCCCCcccccchhhhhhhhhhccCCCcccCCCCCCCccChhHHHHHHHhhcc
Q psy10075        291 FKCSFCEYKCTTKFGLKSHVTRIHSNQKYFCGSCNFSCTSNTDLLEHVQTNHI  343 (373)
Q Consensus       291 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~~H~  343 (373)
                      -.|++|+..+.++..=..+.+.-+..+.|.|.+|.-.|.+..+|..|+..-|.
T Consensus       431 ~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~~ltrhin~~Hp  483 (500)
T KOG3993|consen  431 ELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSPGLTRHINKCHP  483 (500)
T ss_pred             cCCCCCCCCcccCCCCCccccccchhhccccccchHhhhcCcchHhHhhhcCh
Confidence            34777777777776666666556666779999999999999999999988774


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=98.79  E-value=2.6e-09  Score=64.97  Aligned_cols=44  Identities=23%  Similarity=0.387  Sum_probs=33.6

Q ss_pred             CeecCCCCccccChhHHHHhhhhhccCCCCccCCCCcccccchhhhh
Q psy10075        261 PFTCEHCDSKFCKKYDMKMHMSRAHYGLKPFKCSFCEYKCTTKFGLK  307 (373)
Q Consensus       261 ~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~  307 (373)
                      .|.|+.||+.|+..+.|..|+ +.|+  ++|+|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~-r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHL-RKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHH-HhcC--CcccCCcccceecccceeE
Confidence            477888888888888888888 5565  5788888888887666654


No 17 
>KOG3993|consensus
Probab=98.68  E-value=5e-09  Score=89.98  Aligned_cols=198  Identities=16%  Similarity=0.223  Sum_probs=106.7

Q ss_pred             cccCCCCccccChHHHHHhhhcccCCCCCCcccccccccccCHHHHHHHHhhhccCCCceec-ccc-cccccchhHHHhh
Q psy10075        112 FSCNFCDYKSKTKYDITSHSLRKHSKGDKPHKCTICESTYLTKVELKNHILKIHQGQTRFQC-SFC-DRRFYFKNECTKH  189 (373)
Q Consensus       112 ~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C-~~C-~~~f~~~~~l~~H  189 (373)
                      |.|.+|...|.+...|..|  +.-..-...|+|++|+++|+-..+|..|. ++|-....-.= ..= .+.-.....+...
T Consensus       268 yiCqLCK~kYeD~F~LAQH--rC~RIV~vEYrCPEC~KVFsCPANLASHR-RWHKPR~eaa~a~~~P~k~~~~~rae~~e  344 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQH--RCPRIVHVEYRCPECDKVFSCPANLASHR-RWHKPRPEAAKAGSPPPKQAVETRAEVQE  344 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhc--cCCeeEEeeecCCcccccccCchhhhhhh-cccCCchhhhhcCCCChhhhhhhhhhhhh
Confidence            7777787777777777777  23222344577888888888777887774 66632211000 000 0000000000000


Q ss_pred             hhhc---cCCCCccccCCCchhccCcHHHHHHHHHhcCCCCccc--------------eecCCCcccccChHHHhhhhhc
Q psy10075        190 YLEH---HTNEKPFKCTLCSYKAKRNFELKQHILRIHQDNIEAE--------------YHCTYCDYICSSRTILKSHINK  252 (373)
Q Consensus       190 ~~~~---h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~--------------~~C~~C~~~f~~~~~l~~H~~~  252 (373)
                       ...   ...+.-|.|.+|++.|++...|+.|+...|.....+.              +.+..+...+.....-..+. .
T Consensus       345 -a~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~v-l  422 (500)
T KOG3993|consen  345 -AERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEV-L  422 (500)
T ss_pred             -ccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccce-e
Confidence             000   0223468899999999999999999755553321110              22333332222211111111 0


Q ss_pred             cCCCCCCCCeecCCCCccccChhHHHHhhhhhccCCCCccCCCCcccccchhhhhhhhhhccCC
Q psy10075        253 KHANDEDKPFTCEHCDSKFCKKYDMKMHMSRAHYGLKPFKCSFCEYKCTTKFGLKSHVTRIHSN  316 (373)
Q Consensus       253 ~~~~~~~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~  316 (373)
                      .+... .....++.|+..+..+..=..+. +.-.....|.|.+|...|.+...|.+|+..-|..
T Consensus       423 ~~a~s-ael~~pp~~~~ppsss~~sgg~~-rlg~~~q~f~~ky~~atfyss~~ltrhin~~Hps  484 (500)
T KOG3993|consen  423 YVAGS-AELELPPYDGSPPSSSGSSGGYG-RLGIAEQGFTCKYCPATFYSSPGLTRHINKCHPS  484 (500)
T ss_pred             eeecc-ccccCCCCCCCCcccCCCCCccc-cccchhhccccccchHhhhcCcchHhHhhhcChH
Confidence            11111 12246788887777765544444 2223345689999999999999999999666643


No 18 
>PHA02768 hypothetical protein; Provisional
Probab=98.65  E-value=1e-08  Score=62.40  Aligned_cols=44  Identities=9%  Similarity=0.319  Sum_probs=39.2

Q ss_pred             CccCCCCcccccchhhhhhhhhhccCCCcccCCCCCCCccChhHHH
Q psy10075        290 PFKCSFCEYKCTTKFGLKSHVTRIHSNQKYFCGSCNFSCTSNTDLL  335 (373)
Q Consensus       290 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~~C~~~f~~~~~l~  335 (373)
                      -|.|+.||+.|+..++|..|+++|.  .+|+|..|++.|....+|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            4899999999999999999998876  6899999999999877664


No 19 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.42  E-value=2.6e-07  Score=57.73  Aligned_cols=49  Identities=24%  Similarity=0.604  Sum_probs=29.8

Q ss_pred             ccCCCCcccccchhhhhhhhhhccCCCc--ccCCCCCCCccChhHHHHHHHhhc
Q psy10075        291 FKCSFCEYKCTTKFGLKSHVTRIHSNQK--YFCGSCNFSCTSNTDLLEHVQTNH  342 (373)
Q Consensus       291 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~--~~C~~C~~~f~~~~~l~~H~~~~H  342 (373)
                      |.||+|++. .+..+|..|+...|..+.  +.|++|...+.  .+|..|+..+|
T Consensus         3 f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            566666663 345666666666665432  66777766433  36777766665


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.39  E-value=1.6e-07  Score=48.72  Aligned_cols=25  Identities=40%  Similarity=0.999  Sum_probs=20.3

Q ss_pred             HHHHhhhhhccCCCCccCCCCccccc
Q psy10075        276 DMKMHMSRAHYGLKPFKCSFCEYKCT  301 (373)
Q Consensus       276 ~L~~H~~~~H~~~~~~~C~~C~~~f~  301 (373)
                      +|..|+ +.|++++||.|+.|++.|.
T Consensus         1 ~l~~H~-~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHM-RTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHH-HHHSSSSSEEESSSSEEES
T ss_pred             CHHHHh-hhcCCCCCCCCCCCcCeeC
Confidence            477888 6788888888888888875


No 21 
>PHA00732 hypothetical protein
Probab=98.24  E-value=9.1e-07  Score=59.55  Aligned_cols=44  Identities=27%  Similarity=0.531  Sum_probs=27.9

Q ss_pred             CeecCCCCccccChhHHHHhhhhhccCCCCccCCCCcccccchhhhhhhh
Q psy10075        261 PFTCEHCDSKFCKKYDMKMHMSRAHYGLKPFKCSFCEYKCTTKFGLKSHV  310 (373)
Q Consensus       261 ~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~  310 (373)
                      ||.|+.|++.|.+...|..|++..|.+   +.|+.|++.|.   .+..|+
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~---~l~~H~   44 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYR---RLNQHF   44 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeC---Chhhhh
Confidence            466777777777777777776334542   46777777764   466666


No 22 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.23  E-value=1.4e-06  Score=54.37  Aligned_cols=50  Identities=26%  Similarity=0.456  Sum_probs=28.5

Q ss_pred             eecCCCCccccChhHHHHhhhhhccCC-CCccCCCCcccccchhhhhhhhhhcc
Q psy10075        262 FTCEHCDSKFCKKYDMKMHMSRAHYGL-KPFKCSFCEYKCTTKFGLKSHVTRIH  314 (373)
Q Consensus       262 ~~C~~C~~~f~~~~~L~~H~~~~H~~~-~~~~C~~C~~~f~~~~~l~~H~~~~h  314 (373)
                      |.||.|++ ..+...|..|....|..+ +.+.||+|...+.  .+|..|+...|
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            56666666 334556666665555543 3466666665533  36666665554


No 23 
>KOG1146|consensus
Probab=98.22  E-value=1.2e-06  Score=86.16  Aligned_cols=101  Identities=21%  Similarity=0.357  Sum_probs=77.4

Q ss_pred             hhhhcccccce--eecCCCCcceecCCCCccccChhhHhhccccCC-------------------------CCCccccCc
Q psy10075          6 EILNHSRECAF--VSRLDDSYNFICILCNYHAENFENIYLHLPSHF-------------------------EQKLFSCDL   58 (373)
Q Consensus         6 ~~~~~~~~~~~--~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~-------------------------~~~~~~C~~   58 (373)
                      ..+.+.+....  +.+++-++.|+|+.|+..|...+.|..|++..+                         +.++|.|..
T Consensus       444 ~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~  523 (1406)
T KOG1146|consen  444 PLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRA  523 (1406)
T ss_pred             hhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCccccee
Confidence            34444555444  555666799999999999999999999998722                         236799999


Q ss_pred             CcccccchHHHHHHhhhh-hc-----------------------------------c------CCccccCccccccCCch
Q psy10075         59 CEYQTNTKIYIRRHMLKI-HL-----------------------------------R------QRNLECSLCDSTFSDNM   96 (373)
Q Consensus        59 C~~~f~~~~~l~~H~~~~-h~-----------------------------------~------~~~~~C~~C~~~f~~~~   96 (373)
                      |...+..+..|..|++.. |.                                   +      ...|.|..|+....-..
T Consensus       524 C~~stttng~LsihlqS~~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP~~~C~vc~yetniar  603 (1406)
T KOG1146|consen  524 CNYSTTTNGNLSIHLQSDLHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKPSWRCEVCSYETNIAR  603 (1406)
T ss_pred             eeeeeecchHHHHHHHHHhhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCCCcchhhhcchhhhhh
Confidence            999999999999997432 20                                   0      12489999999988888


Q ss_pred             HHHHHHhhhc
Q psy10075         97 DLKKHIQRKH  106 (373)
Q Consensus        97 ~l~~H~~~~h  106 (373)
                      .|..||..++
T Consensus       604 nlrihmtss~  613 (1406)
T KOG1146|consen  604 NLRIHMTASP  613 (1406)
T ss_pred             ccccccccCC
Confidence            8988876554


No 24 
>PHA00616 hypothetical protein
Probab=98.21  E-value=3.8e-07  Score=52.72  Aligned_cols=31  Identities=19%  Similarity=0.380  Sum_probs=15.4

Q ss_pred             eecCCCCccccChhHHHHhhhhhccCCCCccC
Q psy10075        262 FTCEHCDSKFCKKYDMKMHMSRAHYGLKPFKC  293 (373)
Q Consensus       262 ~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C  293 (373)
                      |+|+.||+.|...++|..|+ +.|++++++.|
T Consensus         2 YqC~~CG~~F~~~s~l~~H~-r~~hg~~~~~~   32 (44)
T PHA00616          2 YQCLRCGGIFRKKKEVIEHL-LSVHKQNKLTL   32 (44)
T ss_pred             CccchhhHHHhhHHHHHHHH-HHhcCCCccce
Confidence            45555555555555555555 44444444444


No 25 
>PHA00732 hypothetical protein
Probab=98.18  E-value=1.1e-06  Score=59.18  Aligned_cols=47  Identities=36%  Similarity=0.638  Sum_probs=40.1

Q ss_pred             CccCCCCcccccchhhhhhhhhhccCCCcccCCCCCCCccChhHHHHHHHhh
Q psy10075        290 PFKCSFCEYKCTTKFGLKSHVTRIHSNQKYFCGSCNFSCTSNTDLLEHVQTN  341 (373)
Q Consensus       290 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~~  341 (373)
                      ||.|..|++.|.+.++|..|++.+|.+  +.|+.|++.|.   .+..|+.+.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~--~~C~~CgKsF~---~l~~H~~~~   47 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL--TKCPVCNKSYR---RLNQHFYSQ   47 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC--CccCCCCCEeC---Chhhhhccc
Confidence            589999999999999999999755543  58999999998   588888665


No 26 
>PHA00616 hypothetical protein
Probab=98.13  E-value=9.2e-07  Score=51.13  Aligned_cols=33  Identities=18%  Similarity=0.291  Sum_probs=28.8

Q ss_pred             CccCCCCcccccchhhhhhhhhhccCCCcccCC
Q psy10075        290 PFKCSFCEYKCTTKFGLKSHVTRIHSNQKYFCG  322 (373)
Q Consensus       290 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~  322 (373)
                      ||+|+.||+.|..+++|..|++++|+..++.|+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            688999999999999999999889988887765


No 27 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.05  E-value=1e-06  Score=45.63  Aligned_cols=17  Identities=24%  Similarity=0.782  Sum_probs=7.3

Q ss_pred             hhccCCccccCcccccc
Q psy10075         76 IHLRQRNLECSLCDSTF   92 (373)
Q Consensus        76 ~h~~~~~~~C~~C~~~f   92 (373)
                      .|.++++|.|+.|++.|
T Consensus         8 ~H~~~k~~~C~~C~k~F   24 (26)
T PF13465_consen    8 THTGEKPYKCPYCGKSF   24 (26)
T ss_dssp             HHSSSSSEEESSSSEEE
T ss_pred             hcCCCCCCCCCCCcCee
Confidence            34444444444444443


No 28 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.86  E-value=7.8e-06  Score=58.93  Aligned_cols=73  Identities=23%  Similarity=0.346  Sum_probs=20.5

Q ss_pred             ecCCCCccccChhHHHHhhhhhccCCCCccCCCCcccccchhhhhhhhhhccCCCcccCCCCCCCccChhHHHHHHHhh
Q psy10075        263 TCEHCDSKFCKKYDMKMHMSRAHYGLKPFKCSFCEYKCTTKFGLKSHVTRIHSNQKYFCGSCNFSCTSNTDLLEHVQTN  341 (373)
Q Consensus       263 ~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~~  341 (373)
                      .|..|+..|.+...|..|+...|.-..+     ....+.....+..++. ......+.|.+|+..|.+...|..||+.+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~-----~~~~l~~~~~~~~~~~-~~~~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIP-----DQKYLVDPNRLLNYLR-KKVKESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             ------------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             Cccccccccccccccccccccccccccc-----cccccccccccccccc-cccCCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            4788888888888888888667754432     1122234455555542 22233588999999999999999998865


No 29 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.76  E-value=1.6e-05  Score=40.34  Aligned_cols=24  Identities=33%  Similarity=0.693  Sum_probs=15.5

Q ss_pred             ccCCCCCCCccChhHHHHHHHhhc
Q psy10075        319 YFCGSCNFSCTSNTDLLEHVQTNH  342 (373)
Q Consensus       319 ~~C~~C~~~f~~~~~l~~H~~~~H  342 (373)
                      |.|++|++.|.+...|..|++++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            467777777777777777777664


No 30 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.73  E-value=1.3e-05  Score=40.27  Aligned_cols=22  Identities=32%  Similarity=0.637  Sum_probs=13.3

Q ss_pred             ccCCCCCCCccChhHHHHHHHh
Q psy10075        319 YFCGSCNFSCTSNTDLLEHVQT  340 (373)
Q Consensus       319 ~~C~~C~~~f~~~~~l~~H~~~  340 (373)
                      |.|+.|++.|.++.+|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4566666666666666666554


No 31 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.60  E-value=4e-05  Score=38.45  Aligned_cols=20  Identities=35%  Similarity=0.851  Sum_probs=11.7

Q ss_pred             eecCCCCccccChhHHHHhh
Q psy10075        262 FTCEHCDSKFCKKYDMKMHM  281 (373)
Q Consensus       262 ~~C~~C~~~f~~~~~L~~H~  281 (373)
                      |.|+.|++.|.+...|..|+
T Consensus         1 y~C~~C~~~f~~~~~l~~H~   20 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHM   20 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHH
Confidence            45555666666666666555


No 32 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.59  E-value=2.9e-05  Score=64.77  Aligned_cols=52  Identities=33%  Similarity=0.742  Sum_probs=39.8

Q ss_pred             CCCeecCC--CCccccChhHHHHhhhhhcc------------------CCCCccCCCCcccccchhhhhhhh
Q psy10075        259 DKPFTCEH--CDSKFCKKYDMKMHMSRAHY------------------GLKPFKCSFCEYKCTTKFGLKSHV  310 (373)
Q Consensus       259 ~~~~~C~~--C~~~f~~~~~L~~H~~~~H~------------------~~~~~~C~~C~~~f~~~~~l~~H~  310 (373)
                      ++||+|++  |.|.|++...|..|+.--|-                  ..+||+|+.|++++.+...|+.|+
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecc
Confidence            58999987  99999999999999854452                  236677777777777777777775


No 33 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.46  E-value=0.00011  Score=37.21  Aligned_cols=20  Identities=35%  Similarity=0.855  Sum_probs=9.1

Q ss_pred             eecCCCCccccChhHHHHhh
Q psy10075        262 FTCEHCDSKFCKKYDMKMHM  281 (373)
Q Consensus       262 ~~C~~C~~~f~~~~~L~~H~  281 (373)
                      |.|++|++.|.+...|..|+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~   20 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHM   20 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHH
Confidence            34555555555555555554


No 34 
>KOG1146|consensus
Probab=97.43  E-value=2.7e-05  Score=77.14  Aligned_cols=75  Identities=21%  Similarity=0.471  Sum_probs=48.3

Q ss_pred             cCcCcccccchHHHHHHhhhhhccCCccccCccccccCCchHHHHHHhhhcC------------------------CCCC
Q psy10075         56 CDLCEYQTNTKIYIRRHMLKIHLRQRNLECSLCDSTFSDNMDLKKHIQRKHT------------------------NDRP  111 (373)
Q Consensus        56 C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~------------------------~~~~  111 (373)
                      |.-++..+.+...+.-|+...+...+.++|+.|++.|.....|..||+..|.                        +..+
T Consensus       439 ~~~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p  518 (1406)
T KOG1146|consen  439 LTKAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKP  518 (1406)
T ss_pred             ccchhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCc
Confidence            3444455555555555555556666778888888888888888888766553                        2345


Q ss_pred             cccCCCCccccChHHHHHh
Q psy10075        112 FSCNFCDYKSKTKYDITSH  130 (373)
Q Consensus       112 ~~C~~C~~~f~~~~~l~~h  130 (373)
                      |.|..|...+....+|..|
T Consensus       519 ~~C~~C~~stttng~Lsih  537 (1406)
T KOG1146|consen  519 YPCRACNYSTTTNGNLSIH  537 (1406)
T ss_pred             ccceeeeeeeecchHHHHH
Confidence            6666666666666666666


No 35 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.37  E-value=0.00013  Score=52.50  Aligned_cols=22  Identities=27%  Similarity=0.711  Sum_probs=13.6

Q ss_pred             CeecCCCCccccChhHHHHhhh
Q psy10075        261 PFTCEHCDSKFCKKYDMKMHMS  282 (373)
Q Consensus       261 ~~~C~~C~~~f~~~~~L~~H~~  282 (373)
                      .+.|..|++.|.+...|..||+
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~   71 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMR   71 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHH
T ss_pred             CCCCCccCCCCcCHHHHHHHHc
Confidence            4666666666666666666664


No 36 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.36  E-value=7.1e-05  Score=39.20  Aligned_cols=24  Identities=25%  Similarity=0.512  Sum_probs=15.5

Q ss_pred             ccCCCCCCCccChhHHHHHHHhhc
Q psy10075        319 YFCGSCNFSCTSNTDLLEHVQTNH  342 (373)
Q Consensus       319 ~~C~~C~~~f~~~~~l~~H~~~~H  342 (373)
                      |+|..|++.|.+..+|..|++.|+
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCccCCccCChhHHHHHhHHhc
Confidence            566666666666666666666554


No 37 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.32  E-value=0.00014  Score=38.07  Aligned_cols=25  Identities=24%  Similarity=0.363  Sum_probs=18.1

Q ss_pred             ceecCCCCccccChhhHhhccccCC
Q psy10075         25 NFICILCNYHAENFENIYLHLPSHF   49 (373)
Q Consensus        25 ~~~C~~C~~~f~~~~~l~~H~~~h~   49 (373)
                      ||.|..|++.|.+..+|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5677777777777777777776653


No 38 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.31  E-value=0.00014  Score=60.91  Aligned_cols=24  Identities=38%  Similarity=0.881  Sum_probs=22.2

Q ss_pred             CCCCeecCCCCccccChhHHHHhh
Q psy10075        258 EDKPFTCEHCDSKFCKKYDMKMHM  281 (373)
Q Consensus       258 ~~~~~~C~~C~~~f~~~~~L~~H~  281 (373)
                      ..+||+|++|+|+|++...|..|+
T Consensus       395 ~~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         395 KDKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             cCCceeccccchhhccCccceecc
Confidence            469999999999999999999997


No 39 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.13  E-value=0.00025  Score=35.86  Aligned_cols=24  Identities=29%  Similarity=0.769  Sum_probs=14.5

Q ss_pred             ccCCCCCCCccChhHHHHHHHhhcc
Q psy10075        319 YFCGSCNFSCTSNTDLLEHVQTNHI  343 (373)
Q Consensus       319 ~~C~~C~~~f~~~~~l~~H~~~~H~  343 (373)
                      |+|+.|++... +.+|.+|++.+|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            56777776666 6677777766653


No 40 
>KOG2482|consensus
Probab=96.83  E-value=0.0027  Score=53.98  Aligned_cols=185  Identities=16%  Similarity=0.234  Sum_probs=87.7

Q ss_pred             HHHHHHHhhhccCCCceeccccccccc-chhHHHhhhhhccCCC---------------------CccccCCCchhccCc
Q psy10075        155 VELKNHILKIHQGQTRFQCSFCDRRFY-FKNECTKHYLEHHTNE---------------------KPFKCTLCSYKAKRN  212 (373)
Q Consensus       155 ~~l~~H~~~~h~~~~~~~C~~C~~~f~-~~~~l~~H~~~~h~~~---------------------~~~~C~~C~~~f~~~  212 (373)
                      ..|+++.+..-......+|-.|...+. .++.+..|+...|.-.                     ..+.|-+|.+.|+.+
T Consensus       129 eaLeqqQ~Eredt~fslqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdk  208 (423)
T KOG2482|consen  129 EALEQQQKEREDTIFSLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDK  208 (423)
T ss_pred             HHHHHHHHHhcCCeeeeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCc
Confidence            345555432223345578888876654 5677777765554311                     236677777777777


Q ss_pred             HHHHHHHHHh-cCCCCccc------eecCC--Cccccc-ChHHH--------hhhhhccCC--CCCCCC--eecCCCCcc
Q psy10075        213 FELKQHILRI-HQDNIEAE------YHCTY--CDYICS-SRTIL--------KSHINKKHA--NDEDKP--FTCEHCDSK  270 (373)
Q Consensus       213 ~~l~~H~~~~-h~~~~~~~------~~C~~--C~~~f~-~~~~l--------~~H~~~~~~--~~~~~~--~~C~~C~~~  270 (373)
                      ..|+.||+.. |.....+.      |.=..  =|+... ..+.+        .++-..+..  ..+..+  ..|-.|...
T Consensus       209 ntLkeHMrkK~HrrinPknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~a~a~~v~CLfC~~~  288 (423)
T KOG2482|consen  209 NTLKEHMRKKRHRRINPKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDDAEALSVVCLFCTNF  288 (423)
T ss_pred             HHHHHHHHhccCcccCCCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCCCCccceEEEeeccc
Confidence            7777777432 21100100      11100  011110 00000        000000000  011112  578888888


Q ss_pred             ccChhHHHHhhhhhccCCCCccCCCCcccccchhhhhhhhhhccCCCcccCCCCCCCccChhHHHHHHHhh
Q psy10075        271 FCKKYDMKMHMSRAHYGLKPFKCSFCEYKCTTKFGLKSHVTRIHSNQKYFCGSCNFSCTSNTDLLEHVQTN  341 (373)
Q Consensus       271 f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~~  341 (373)
                      ..+...|..||+.+|.-.---.=+-=+-.|..+-.+..=+++  ....-.|..|..+|..+..|+.||..+
T Consensus       289 ~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRk--q~~~~~c~~cd~~F~~e~~l~~hm~e~  357 (423)
T KOG2482|consen  289 YENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRK--QKKKSRCAECDLSFWKEPGLLIHMVED  357 (423)
T ss_pred             hhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHH--HhhccccccccccccCcchhhhhcccc
Confidence            777888888887767321000000000111111112111111  111246888889999999999997743


No 41 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=96.75  E-value=0.002  Score=54.78  Aligned_cols=132  Identities=26%  Similarity=0.461  Sum_probs=78.1

Q ss_pred             cccCC--CchhccCcHHHHHHHHHhcCCCCccceecCCC---ccccc------ChHHHhhhhhccCCCCCCCCe-ecCCC
Q psy10075        200 FKCTL--CSYKAKRNFELKQHILRIHQDNIEAEYHCTYC---DYICS------SRTILKSHINKKHANDEDKPF-TCEHC  267 (373)
Q Consensus       200 ~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~~~~~C~~C---~~~f~------~~~~l~~H~~~~~~~~~~~~~-~C~~C  267 (373)
                      |.||.  |......-..|..|....|..     +.|.+|   .+.|.      +...|..|...-..+.|-+.. .|..|
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H~~-----~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC  226 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQHGF-----VLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFC  226 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhcCc-----EEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhc
Confidence            55554  444444445666666554432     555555   23333      344566665322222222222 58888


Q ss_pred             CccccChhHHHHhhhhhccCCCCccCCCCcc-------cccchhhhhhhhhhccCCCcccCCC--CC----CCccChhHH
Q psy10075        268 DSKFCKKYDMKMHMSRAHYGLKPFKCSFCEY-------KCTTKFGLKSHVTRIHSNQKYFCGS--CN----FSCTSNTDL  334 (373)
Q Consensus       268 ~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~-------~f~~~~~l~~H~~~~h~~~~~~C~~--C~----~~f~~~~~l  334 (373)
                      ...|..-..|..|++..|.     +|-+|.+       .|.+-.+|..|.+..|    |.|.+  |.    +.|+....|
T Consensus       227 ~~~FYdDDEL~~HcR~~HE-----~ChICD~v~p~~~QYFK~Y~~Le~HF~~~h----y~ct~qtc~~~k~~vf~~~~el  297 (493)
T COG5236         227 KIYFYDDDELRRHCRLRHE-----ACHICDMVGPIRYQYFKSYEDLEAHFRNAH----YCCTFQTCRVGKCYVFPYHTEL  297 (493)
T ss_pred             cceecChHHHHHHHHhhhh-----hhhhhhccCccchhhhhCHHHHHHHhhcCc----eEEEEEEEecCcEEEeccHHHH
Confidence            8888888888888866662     2555543       5666678888874333    44442  32    568888899


Q ss_pred             HHHHHhhcccc
Q psy10075        335 LEHVQTNHIIV  345 (373)
Q Consensus       335 ~~H~~~~H~~~  345 (373)
                      ++|+...|++.
T Consensus       298 ~~h~~~~h~~~  308 (493)
T COG5236         298 LEHLTRFHKVN  308 (493)
T ss_pred             HHHHHHHhhcc
Confidence            99998888854


No 42 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.75  E-value=0.0009  Score=39.65  Aligned_cols=32  Identities=19%  Similarity=0.229  Sum_probs=18.5

Q ss_pred             CCcceecCCCCccccChhhHhhccccCCCCCc
Q psy10075         22 DSYNFICILCNYHAENFENIYLHLPSHFEQKL   53 (373)
Q Consensus        22 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~   53 (373)
                      ++.|-+|++|+.+++...+|.+|+.+.++.+|
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            56677777777777777777777766555443


No 43 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.68  E-value=0.00081  Score=33.96  Aligned_cols=23  Identities=43%  Similarity=0.940  Sum_probs=10.4

Q ss_pred             ccCCCCcccccchhhhhhhhhhcc
Q psy10075        291 FKCSFCEYKCTTKFGLKSHVTRIH  314 (373)
Q Consensus       291 ~~C~~C~~~f~~~~~l~~H~~~~h  314 (373)
                      |+|+.|++... ...|..|++.+|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            34555555444 445555554443


No 44 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.55  E-value=0.0023  Score=32.70  Aligned_cols=23  Identities=35%  Similarity=0.639  Sum_probs=18.5

Q ss_pred             ccCCCCCCCccChhHHHHHHHhh
Q psy10075        319 YFCGSCNFSCTSNTDLLEHVQTN  341 (373)
Q Consensus       319 ~~C~~C~~~f~~~~~l~~H~~~~  341 (373)
                      |.|..|++.|.+...|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            57888888888888888888754


No 45 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.45  E-value=0.0012  Score=33.75  Aligned_cols=22  Identities=32%  Similarity=0.807  Sum_probs=15.2

Q ss_pred             ccCCCCCCCccChhHHHHHHHh
Q psy10075        319 YFCGSCNFSCTSNTDLLEHVQT  340 (373)
Q Consensus       319 ~~C~~C~~~f~~~~~l~~H~~~  340 (373)
                      |.|.+|++.|.+...|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4577777777777777777654


No 46 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.43  E-value=0.0015  Score=38.74  Aligned_cols=22  Identities=23%  Similarity=0.644  Sum_probs=7.2

Q ss_pred             CCeecCCCCccccChhHHHHhh
Q psy10075        260 KPFTCEHCDSKFCKKYDMKMHM  281 (373)
Q Consensus       260 ~~~~C~~C~~~f~~~~~L~~H~  281 (373)
                      .|-.|++|+..+.+..+|.+|+
T Consensus        23 ~PatCP~C~a~~~~srnLrRHl   44 (54)
T PF09237_consen   23 QPATCPICGAVIRQSRNLRRHL   44 (54)
T ss_dssp             --EE-TTT--EESSHHHHHHHH
T ss_pred             CCCCCCcchhhccchhhHHHHH
Confidence            3334444444444444444444


No 47 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=96.35  E-value=0.0038  Score=53.15  Aligned_cols=132  Identities=21%  Similarity=0.426  Sum_probs=84.4

Q ss_pred             ceecCC--CCccccChhhHhhccccCCCCCccccCcCc---------ccccchHHHHHHhhhhhccCCc----cccCccc
Q psy10075         25 NFICIL--CNYHAENFENIYLHLPSHFEQKLFSCDLCE---------YQTNTKIYIRRHMLKIHLRQRN----LECSLCD   89 (373)
Q Consensus        25 ~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~---------~~f~~~~~l~~H~~~~h~~~~~----~~C~~C~   89 (373)
                      .|.|+.  |..+......|..|++..++  .+.|.+|-         ....+...|..| ...-..+..    -.|..|+
T Consensus       151 ~F~CP~skc~~~C~~~k~lk~H~K~~H~--~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H-~~~G~~e~GFKGHP~C~FC~  227 (493)
T COG5236         151 SFKCPKSKCHRRCGSLKELKKHYKAQHG--FVLCSECIGNKKDFWNEIRLFRSSTLRDH-KNGGLEEEGFKGHPLCIFCK  227 (493)
T ss_pred             HhcCCchhhhhhhhhHHHHHHHHHhhcC--cEEhHhhhcCcccCccceeeeeccccccc-ccCCccccCcCCCchhhhcc
Confidence            366776  77777778888889876554  25565553         223566777888 333332322    4588999


Q ss_pred             cccCCchHHHHHHhhhcCCCCCcccCCCC----ccccChHHHHHhhhcccCCCCCCccccc--cc----ccccCHHHHHH
Q psy10075         90 STFSDNMDLKKHIQRKHTNDRPFSCNFCD----YKSKTKYDITSHSLRKHSKGDKPHKCTI--CE----STYLTKVELKN  159 (373)
Q Consensus        90 ~~f~~~~~l~~H~~~~h~~~~~~~C~~C~----~~f~~~~~l~~h~~~~h~~~~~~~~C~~--C~----~~f~~~~~l~~  159 (373)
                      ..|.+-..|..|++..|.  +-+.|+.-+    .-|.+...|..|....|      |.|..  |-    .+|.....|..
T Consensus       228 ~~FYdDDEL~~HcR~~HE--~ChICD~v~p~~~QYFK~Y~~Le~HF~~~h------y~ct~qtc~~~k~~vf~~~~el~~  299 (493)
T COG5236         228 IYFYDDDELRRHCRLRHE--ACHICDMVGPIRYQYFKSYEDLEAHFRNAH------YCCTFQTCRVGKCYVFPYHTELLE  299 (493)
T ss_pred             ceecChHHHHHHHHhhhh--hhhhhhccCccchhhhhCHHHHHHHhhcCc------eEEEEEEEecCcEEEeccHHHHHH
Confidence            999999999999877763  223333222    23777788888844333      44432  21    57888888888


Q ss_pred             HHhhhccC
Q psy10075        160 HILKIHQG  167 (373)
Q Consensus       160 H~~~~h~~  167 (373)
                      |+.+.|..
T Consensus       300 h~~~~h~~  307 (493)
T COG5236         300 HLTRFHKV  307 (493)
T ss_pred             HHHHHhhc
Confidence            88777743


No 48 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.17  E-value=0.0024  Score=32.54  Aligned_cols=22  Identities=32%  Similarity=0.564  Sum_probs=13.2

Q ss_pred             eecCCCCccccChhhHhhcccc
Q psy10075         26 FICILCNYHAENFENIYLHLPS   47 (373)
Q Consensus        26 ~~C~~C~~~f~~~~~l~~H~~~   47 (373)
                      |.|++|+++|.+...|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4566666666666666666543


No 49 
>KOG2482|consensus
Probab=96.17  E-value=0.0092  Score=50.85  Aligned_cols=149  Identities=19%  Similarity=0.297  Sum_probs=79.7

Q ss_pred             hhHHHhhhhhccCCCCccccCCCchhcc-CcHHHHHHHHHhcCCCCccceecCCCcccccChHHHhhhhhccCCCCCCCC
Q psy10075        183 KNECTKHYLEHHTNEKPFKCTLCSYKAK-RNFELKQHILRIHQDNIEAEYHCTYCDYICSSRTILKSHINKKHANDEDKP  261 (373)
Q Consensus       183 ~~~l~~H~~~~h~~~~~~~C~~C~~~f~-~~~~l~~H~~~~h~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~  261 (373)
                      +..|..+++..-......+|-.|+..+. .++.+..|+-..|.-+...|-       .......|..|++..     -..
T Consensus       128 ~eaLeqqQ~Eredt~fslqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpD-------niVyvnelLehLkek-----L~r  195 (423)
T KOG2482|consen  128 KEALEQQQKEREDTIFSLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPD-------NIVYVNELLEHLKEK-----LER  195 (423)
T ss_pred             HHHHHHHHHHhcCCeeeeEEEEecchhcccHHHHHHHHHHHhhhccCCCc-------ceeeHHHHHHHHHHH-----Hhh
Confidence            5677777766545556678999987654 456778888777765443331       111223445554321     123


Q ss_pred             eecCCCCccccChhHHHHhhhhh-ccCCCC--------ccCCC--Ccccccc-hhhhhhhhh-------------hccCC
Q psy10075        262 FTCEHCDSKFCKKYDMKMHMSRA-HYGLKP--------FKCSF--CEYKCTT-KFGLKSHVT-------------RIHSN  316 (373)
Q Consensus       262 ~~C~~C~~~f~~~~~L~~H~~~~-H~~~~~--------~~C~~--C~~~f~~-~~~l~~H~~-------------~~h~~  316 (373)
                      +.|-.|.+.|..+..|..||+.. |..-.|        |.=.+  =|++..- .+.+.+-..             ..++.
T Consensus       196 ~~CLyCekifrdkntLkeHMrkK~HrrinPknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~a  275 (423)
T KOG2482|consen  196 LRCLYCEKIFRDKNTLKEHMRKKRHRRINPKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDDA  275 (423)
T ss_pred             heeeeeccccCCcHHHHHHHHhccCcccCCCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCCC
Confidence            56777777777777777777432 322222        00000  0111110 011100000             00111


Q ss_pred             Cc--ccCCCCCCCccChhHHHHHHHhhcc
Q psy10075        317 QK--YFCGSCNFSCTSNTDLLEHVQTNHI  343 (373)
Q Consensus       317 ~~--~~C~~C~~~f~~~~~l~~H~~~~H~  343 (373)
                      .+  .+|-.|.....+...|.+||+..|-
T Consensus       276 ~a~~v~CLfC~~~~en~~~l~eHmk~vHe  304 (423)
T KOG2482|consen  276 EALSVVCLFCTNFYENPVFLFEHMKIVHE  304 (423)
T ss_pred             CccceEEEeeccchhhHHHHHHHHHHHHH
Confidence            22  5888888888888888889888875


No 50 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.13  E-value=0.0046  Score=31.55  Aligned_cols=19  Identities=37%  Similarity=0.716  Sum_probs=9.9

Q ss_pred             ecCCCCccccChhHHHHhh
Q psy10075        263 TCEHCDSKFCKKYDMKMHM  281 (373)
Q Consensus       263 ~C~~C~~~f~~~~~L~~H~  281 (373)
                      .|+.|++.|.....|..|+
T Consensus         2 ~C~~C~~~f~~~~~l~~H~   20 (26)
T smart00355        2 RCPECGKVFKSKSALKEHM   20 (26)
T ss_pred             CCCCCcchhCCHHHHHHHH
Confidence            4555555555555555555


No 51 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.02  E-value=0.0047  Score=32.14  Aligned_cols=22  Identities=23%  Similarity=0.428  Sum_probs=17.6

Q ss_pred             eecCCCCccccChhhHhhcccc
Q psy10075         26 FICILCNYHAENFENIYLHLPS   47 (373)
Q Consensus        26 ~~C~~C~~~f~~~~~l~~H~~~   47 (373)
                      |.|.+|++.|.+...|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6788888888888888888764


No 52 
>KOG2231|consensus
Probab=95.87  E-value=0.022  Score=54.07  Aligned_cols=120  Identities=25%  Similarity=0.446  Sum_probs=60.9

Q ss_pred             eecccccccccchhHHHhhhhhccCCCCccccCCCchhccCcHHHHHHHHHhcCCCCccceecCCCc---cc------cc
Q psy10075        171 FQCSFCDRRFYFKNECTKHYLEHHTNEKPFKCTLCSYKAKRNFELKQHILRIHQDNIEAEYHCTYCD---YI------CS  241 (373)
Q Consensus       171 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~C~~C~---~~------f~  241 (373)
                      +.|.+|++.+.-.        .     ..-.|..| -.|.+...|+.|+...|..     +.|..|-   +.      ..
T Consensus       100 ~~C~~C~~~~~~~--------~-----~~~~~~~c-~~~~s~~~Lk~H~~~~H~~-----~~c~lC~~~~kif~~e~k~Y  160 (669)
T KOG2231|consen  100 HSCHICDRRFRAL--------Y-----NKKECLHC-TEFKSVENLKNHMRDQHKL-----HLCSLCLQNLKIFINERKLY  160 (669)
T ss_pred             hhcCccccchhhh--------c-----ccCCCccc-cchhHHHHHHHHHHHhhhh-----hccccccccceeeeeeeehe
Confidence            6688887776411        0     01125555 5555666677776555533     3333331   11      12


Q ss_pred             ChHHHhhhhhccCC-CCCCCC-eecCCCCccccChhHHHHhhhhhccCCCCccCCCCc------ccccchhhhhhhhhhc
Q psy10075        242 SRTILKSHINKKHA-NDEDKP-FTCEHCDSKFCKKYDMKMHMSRAHYGLKPFKCSFCE------YKCTTKFGLKSHVTRI  313 (373)
Q Consensus       242 ~~~~l~~H~~~~~~-~~~~~~-~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~------~~f~~~~~l~~H~~~~  313 (373)
                      +...|..|++.-.. ....+. -.|..|...|-....|..|++..|     |.|..|.      ..|.+-..|..|.+..
T Consensus       161 t~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~rH~~~~h-----~~chfC~~~~~~neyy~~~~dLe~HfR~~  235 (669)
T KOG2231|consen  161 TRAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYRHLRFDH-----EFCHFCDYKTGQNEYYNDYDDLEEHFRKG  235 (669)
T ss_pred             hHHHHHHHHhcCCCccccccCCccchhhhhhhccHHHHHHhhccce-----eheeecCcccccchhcccchHHHHHhhhc
Confidence            44556666543222 111111 356677777777777777775555     4455552      2444556666666433


Q ss_pred             c
Q psy10075        314 H  314 (373)
Q Consensus       314 h  314 (373)
                      |
T Consensus       236 H  236 (669)
T KOG2231|consen  236 H  236 (669)
T ss_pred             C
Confidence            3


No 53 
>PRK04860 hypothetical protein; Provisional
Probab=95.83  E-value=0.0056  Score=47.57  Aligned_cols=39  Identities=23%  Similarity=0.575  Sum_probs=29.7

Q ss_pred             CeecCCCCccccChhHHHHhhhhhccCCCCccCCCCcccccchh
Q psy10075        261 PFTCEHCDSKFCKKYDMKMHMSRAHYGLKPFKCSFCEYKCTTKF  304 (373)
Q Consensus       261 ~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~  304 (373)
                      +|.|. |+.   ....+..|. ++|+++++|.|..|+..|....
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~-ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHN-RVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHH-HHhcCCccEECCCCCceeEEec
Confidence            58887 876   666778888 8888888888888888776443


No 54 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.35  E-value=0.0095  Score=30.96  Aligned_cols=19  Identities=26%  Similarity=0.560  Sum_probs=8.1

Q ss_pred             cCCCCcccccchhhhhhhh
Q psy10075        292 KCSFCEYKCTTKFGLKSHV  310 (373)
Q Consensus       292 ~C~~C~~~f~~~~~l~~H~  310 (373)
                      .|..|++.|.+...+..|+
T Consensus         3 ~C~~C~k~f~~~~~~~~H~   21 (27)
T PF12171_consen    3 YCDACDKYFSSENQLKQHM   21 (27)
T ss_dssp             BBTTTTBBBSSHHHHHCCT
T ss_pred             CcccCCCCcCCHHHHHHHH
Confidence            3444444444444444443


No 55 
>PRK04860 hypothetical protein; Provisional
Probab=94.67  E-value=0.014  Score=45.47  Aligned_cols=40  Identities=18%  Similarity=0.543  Sum_probs=34.2

Q ss_pred             CCccCCCCcccccchhhhhhhhhhccCCCcccCCCCCCCccChh
Q psy10075        289 KPFKCSFCEYKCTTKFGLKSHVTRIHSNQKYFCGSCNFSCTSNT  332 (373)
Q Consensus       289 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~~C~~~f~~~~  332 (373)
                      -+|.|. |+.   ....+.+|.+.+.++.+|.|..|+..|....
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEec
Confidence            479998 987   6788999998888889999999999887543


No 56 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=94.59  E-value=0.034  Score=28.24  Aligned_cols=19  Identities=21%  Similarity=0.352  Sum_probs=10.8

Q ss_pred             cCCCCCCCccChhHHHHHHH
Q psy10075        320 FCGSCNFSCTSNTDLLEHVQ  339 (373)
Q Consensus       320 ~C~~C~~~f~~~~~l~~H~~  339 (373)
                      .|++||+.| ....|..|+.
T Consensus         4 ~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHHH
Confidence            466666666 4455655543


No 57 
>KOG4173|consensus
Probab=94.21  E-value=0.012  Score=46.40  Aligned_cols=83  Identities=25%  Similarity=0.508  Sum_probs=43.9

Q ss_pred             ccccCC--CchhccCcHHHHHHHHHhcCCCCccceecCCCcccccChHHHhhhhhccCC-------CCCCCCeecCC--C
Q psy10075        199 PFKCTL--CSYKAKRNFELKQHILRIHQDNIEAEYHCTYCDYICSSRTILKSHINKKHA-------NDEDKPFTCEH--C  267 (373)
Q Consensus       199 ~~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~-------~~~~~~~~C~~--C  267 (373)
                      .+.|++  |...|.+......|....|.+      .|..|.+.|.+.--|..|+.++|.       ..|...|.|-+  |
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~~------sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgC  152 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHGN------SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGC  152 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhcccc------hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhh
Confidence            355554  555555555555555444433      566666666666666666554442       12344455532  6


Q ss_pred             CccccChhHHHHhhhhhccC
Q psy10075        268 DSKFCKKYDMKMHMSRAHYG  287 (373)
Q Consensus       268 ~~~f~~~~~L~~H~~~~H~~  287 (373)
                      +..|.+...-..|+-..|.-
T Consensus       153 t~KFkT~r~RkdH~I~~Hk~  172 (253)
T KOG4173|consen  153 TEKFKTSRDRKDHMIRMHKY  172 (253)
T ss_pred             hhhhhhhhhhhhHHHHhccC
Confidence            66666655555555445543


No 58 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=93.62  E-value=0.095  Score=38.16  Aligned_cols=25  Identities=24%  Similarity=0.549  Sum_probs=21.1

Q ss_pred             ccC----CCCCCCccChhHHHHHHHhhcc
Q psy10075        319 YFC----GSCNFSCTSNTDLLEHVQTNHI  343 (373)
Q Consensus       319 ~~C----~~C~~~f~~~~~l~~H~~~~H~  343 (373)
                      |.|    ..|++...+...+.+|++.+|+
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            888    8888888888888888888874


No 59 
>KOG2785|consensus
Probab=93.48  E-value=0.14  Score=44.90  Aligned_cols=22  Identities=18%  Similarity=0.403  Sum_probs=18.9

Q ss_pred             CcccccccccccCHHHHHHHHh
Q psy10075        141 PHKCTICESTYLTKVELKNHIL  162 (373)
Q Consensus       141 ~~~C~~C~~~f~~~~~l~~H~~  162 (373)
                      .|.|..|...|.+...-+.|++
T Consensus         3 ~ftC~tC~v~F~~ad~Qr~HyK   24 (390)
T KOG2785|consen    3 GFTCNTCNVEFDDADEQRAHYK   24 (390)
T ss_pred             cceeeceeeeeccHHHHHHHhh
Confidence            5889999999999888888874


No 60 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=93.43  E-value=0.054  Score=30.04  Aligned_cols=21  Identities=33%  Similarity=0.592  Sum_probs=11.6

Q ss_pred             ceecCCCCccccChhhHhhcc
Q psy10075         25 NFICILCNYHAENFENIYLHL   45 (373)
Q Consensus        25 ~~~C~~C~~~f~~~~~l~~H~   45 (373)
                      +|.|++|++.|.+...+..|+
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~   23 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHL   23 (35)
T ss_pred             CeEccccCCccCCHHHHHHHH
Confidence            455555555555555555554


No 61 
>KOG2231|consensus
Probab=93.17  E-value=0.25  Score=47.26  Aligned_cols=19  Identities=26%  Similarity=0.553  Sum_probs=9.7

Q ss_pred             cCCCchhccCcHHHHHHHH
Q psy10075        202 CTLCSYKAKRNFELKQHIL  220 (373)
Q Consensus       202 C~~C~~~f~~~~~l~~H~~  220 (373)
                      |..|...|.....|.+|+.
T Consensus       185 C~~C~~~fld~~el~rH~~  203 (669)
T KOG2231|consen  185 CKFCHERFLDDDELYRHLR  203 (669)
T ss_pred             chhhhhhhccHHHHHHhhc
Confidence            4455555555555555543


No 62 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=93.16  E-value=0.069  Score=29.23  Aligned_cols=10  Identities=20%  Similarity=0.893  Sum_probs=4.5

Q ss_pred             eecCCCCccc
Q psy10075        262 FTCEHCDSKF  271 (373)
Q Consensus       262 ~~C~~C~~~f  271 (373)
                      |+|.+||..+
T Consensus         2 ~~C~~CGy~y   11 (33)
T cd00350           2 YVCPVCGYIY   11 (33)
T ss_pred             EECCCCCCEE
Confidence            3444444443


No 63 
>KOG2785|consensus
Probab=93.14  E-value=0.1  Score=45.57  Aligned_cols=142  Identities=18%  Similarity=0.273  Sum_probs=89.8

Q ss_pred             ccccCCCchhccCcHHHHHHHHH-hcCCC---------------------------------CccceecCCCcccccChH
Q psy10075        199 PFKCTLCSYKAKRNFELKQHILR-IHQDN---------------------------------IEAEYHCTYCDYICSSRT  244 (373)
Q Consensus       199 ~~~C~~C~~~f~~~~~l~~H~~~-~h~~~---------------------------------~~~~~~C~~C~~~f~~~~  244 (373)
                      -|.|.-|...|.+....+.|+.+ .|.-+                                 ...++.|..|++.|.+..
T Consensus         3 ~ftC~tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lPPItaE~F~~k~~s~~~~~~~~~e~~~~~~~c~~c~k~~~s~~   82 (390)
T KOG2785|consen    3 GFTCNTCNVEFDDADEQRAHYKSDWHRYNLKRKVASLPPITAEEFNEKVLSDDSEKEENLEEAESVVYCEACNKSFASPK   82 (390)
T ss_pred             cceeeceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCCCcCHHHHhHHHhhhhhhhhhhhhhcccceehHHhhccccChh
Confidence            47899999999998888888743 33111                                 122478999999999888


Q ss_pred             HHhhhhhccC-CCCCC-------------CCee-------------cCCCCccccChhHHHHhhhhh------------c
Q psy10075        245 ILKSHINKKH-ANDED-------------KPFT-------------CEHCDSKFCKKYDMKMHMSRA------------H  285 (373)
Q Consensus       245 ~l~~H~~~~~-~~~~~-------------~~~~-------------C~~C~~~f~~~~~L~~H~~~~------------H  285 (373)
                      +...|+.... .....             ..+.             +..+...+........+. ..            -
T Consensus        83 a~~~hl~Sk~h~~~~~~~~r~~e~d~a~~~q~~~~~p~~l~~~~e~e~~~~E~~~~~d~~~e~~-~dd~~Edi~~d~~~e  161 (390)
T KOG2785|consen   83 AHENHLKSKKHVENLSNHQRSEEGDSAKISQLPSRRPSNLQNKGESELKWYEVDSDEDSSEEEE-EDDEEEDIEEDGDDE  161 (390)
T ss_pred             hHHHHHHHhhcchhhhhhhccccccchhhhhccccCccccccCCCcccchhhcccccccchhhc-cCcchhhhhhccchh
Confidence            8888875321 10000             1111             222222222211122221 00            0


Q ss_pred             cCCCCccCCCCcccccchhhhhhhhhhccCC-----------------------CcccCCCCC---CCccChhHHHHHHH
Q psy10075        286 YGLKPFKCSFCEYKCTTKFGLKSHVTRIHSN-----------------------QKYFCGSCN---FSCTSNTDLLEHVQ  339 (373)
Q Consensus       286 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~-----------------------~~~~C~~C~---~~f~~~~~l~~H~~  339 (373)
                      ....|-.|-.|+..+.+...-..||..+|+-                       .-+.|-.|+   +.|.+....+.||.
T Consensus       162 ~e~~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~  241 (390)
T KOG2785|consen  162 DELIPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMR  241 (390)
T ss_pred             cccCCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHh
Confidence            0112467899999999999999999888872                       137888998   99999999999987


Q ss_pred             hh
Q psy10075        340 TN  341 (373)
Q Consensus       340 ~~  341 (373)
                      ..
T Consensus       242 ~K  243 (390)
T KOG2785|consen  242 DK  243 (390)
T ss_pred             hc
Confidence            43


No 64 
>KOG4173|consensus
Probab=92.78  E-value=0.039  Score=43.58  Aligned_cols=81  Identities=23%  Similarity=0.487  Sum_probs=45.7

Q ss_pred             cceecCC--CcccccChHHHhhhhhccCCCCCCCCeecCCCCccccChhHHHHhhhhhc---------cCCCCccCCC--
Q psy10075        229 AEYHCTY--CDYICSSRTILKSHINKKHANDEDKPFTCEHCDSKFCKKYDMKMHMSRAH---------YGLKPFKCSF--  295 (373)
Q Consensus       229 ~~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~~~~~C~~C~~~f~~~~~L~~H~~~~H---------~~~~~~~C~~--  295 (373)
                      ..+.|+.  |...|.+......|.+.-|.+      .|..|.+.|.+...|..|+...|         .|...|+|-.  
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY~~~h~~------sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEg  151 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHYHTLHGN------SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEG  151 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhhhhcccc------hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHh
Confidence            3455554  555666666666665444433      46666666666666666664444         2344566654  


Q ss_pred             CcccccchhhhhhhhhhccC
Q psy10075        296 CEYKCTTKFGLKSHVTRIHS  315 (373)
Q Consensus       296 C~~~f~~~~~l~~H~~~~h~  315 (373)
                      |+..|.+..+-..|+...|.
T Consensus       152 Ct~KFkT~r~RkdH~I~~Hk  171 (253)
T KOG4173|consen  152 CTEKFKTSRDRKDHMIRMHK  171 (253)
T ss_pred             hhhhhhhhhhhhhHHHHhcc
Confidence            66666666666666654443


No 65 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=92.47  E-value=0.11  Score=28.78  Aligned_cols=23  Identities=22%  Similarity=0.645  Sum_probs=18.2

Q ss_pred             cccCCCCCCCccChhHHHHHHHh
Q psy10075        318 KYFCGSCNFSCTSNTDLLEHVQT  340 (373)
Q Consensus       318 ~~~C~~C~~~f~~~~~l~~H~~~  340 (373)
                      +|.|.+|+..|.+...+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            46788888888888888888664


No 66 
>KOG2893|consensus
Probab=91.60  E-value=0.046  Score=44.21  Aligned_cols=45  Identities=27%  Similarity=0.571  Sum_probs=20.8

Q ss_pred             cCccccccCCchHHHHHHhhhcCCCCCcccCCCCccccChHHHHHhhhcc
Q psy10075         85 CSLCDSTFSDNMDLKKHIQRKHTNDRPFSCNFCDYKSKTKYDITSHSLRK  134 (373)
Q Consensus        85 C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~~  134 (373)
                      |..|+..|.+..-|++|.+..     -|+|..|.+.+.+---|..|..++
T Consensus        13 cwycnrefddekiliqhqkak-----hfkchichkkl~sgpglsihcmqv   57 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKAK-----HFKCHICHKKLFSGPGLSIHCMQV   57 (341)
T ss_pred             eeecccccchhhhhhhhhhhc-----cceeeeehhhhccCCCceeehhhh
Confidence            555555555555555553222     255555555444443444443333


No 67 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=90.87  E-value=0.34  Score=30.00  Aligned_cols=11  Identities=18%  Similarity=0.833  Sum_probs=5.7

Q ss_pred             cceecCCCccc
Q psy10075        229 AEYHCTYCDYI  239 (373)
Q Consensus       229 ~~~~C~~C~~~  239 (373)
                      ..|.|+.||..
T Consensus        26 v~F~CPnCGe~   36 (61)
T COG2888          26 VKFPCPNCGEV   36 (61)
T ss_pred             eEeeCCCCCce
Confidence            34555555543


No 68 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=90.46  E-value=0.43  Score=29.68  Aligned_cols=11  Identities=18%  Similarity=0.809  Sum_probs=6.2

Q ss_pred             cceecCCCccc
Q psy10075        229 AEYHCTYCDYI  239 (373)
Q Consensus       229 ~~~~C~~C~~~  239 (373)
                      ..|.|+.||..
T Consensus        24 ~~F~CPnCG~~   34 (59)
T PRK14890         24 VKFLCPNCGEV   34 (59)
T ss_pred             CEeeCCCCCCe
Confidence            44666666654


No 69 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=90.28  E-value=0.35  Score=35.19  Aligned_cols=56  Identities=21%  Similarity=0.527  Sum_probs=45.2

Q ss_pred             CCCeecCCCCccccChhHHHHhhhhhccCCC-----------------------------------------CccC----
Q psy10075        259 DKPFTCEHCDSKFCKKYDMKMHMSRAHYGLK-----------------------------------------PFKC----  293 (373)
Q Consensus       259 ~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~~-----------------------------------------~~~C----  293 (373)
                      .+..+|..|+..... +++..|++..|....                                         -|.|    
T Consensus         9 ~~vlIC~~C~~av~~-~~v~~HL~~~H~~~~~~~~~~i~~~~~~~~~l~~~~~~~~~p~~~~~Pi~gLp~~~G~~C~~~~   87 (109)
T PF12013_consen    9 YRVLICRQCQYAVQP-SEVESHLRKRHHILKSQERQRIVEAIRQWPDLLPDPDDLQIPPDPSPPIPGLPVYDGYRCQCDP   87 (109)
T ss_pred             CCEEEeCCCCcccCc-hHHHHHHHHhcccccHHHHHHHHHHHHhhhhcccCccccCCCCCCCCcCCCCCCCCCeeeecCC
Confidence            566899999998866 889999974542110                                         1899    


Q ss_pred             CCCcccccchhhhhhhhhhccC
Q psy10075        294 SFCEYKCTTKFGLKSHVTRIHS  315 (373)
Q Consensus       294 ~~C~~~f~~~~~l~~H~~~~h~  315 (373)
                      ..|++.+.+...|..|++.+|+
T Consensus        88 ~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   88 PHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CCCCcEeccHHHHHHHHHHhcC
Confidence            9999999999999999988875


No 70 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=88.88  E-value=0.24  Score=45.99  Aligned_cols=60  Identities=23%  Similarity=0.333  Sum_probs=33.0

Q ss_pred             ceecCCCCccccChhhHhhccc--cCCCC--CccccC--cCcccccchHHHHHHhhhhhccCCcccc
Q psy10075         25 NFICILCNYHAENFENIYLHLP--SHFEQ--KLFSCD--LCEYQTNTKIYIRRHMLKIHLRQRNLEC   85 (373)
Q Consensus        25 ~~~C~~C~~~f~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~h~~~~~~~C   85 (373)
                      ++.|..|...|.....|.+|..  .|.++  +++.|+  .|++.|.....+..| ...|....++.+
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~  354 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRH-ILLHTSISPAKE  354 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCC-cccccCCCcccc
Confidence            4555566666666666666655  45555  555555  455555555555555 344444443333


No 71 
>KOG2893|consensus
Probab=88.86  E-value=0.14  Score=41.48  Aligned_cols=42  Identities=31%  Similarity=0.575  Sum_probs=19.0

Q ss_pred             cCCCCccccChhHHHHhhhhhccCCCCccCCCCcccccchhhhhhhh
Q psy10075        264 CEHCDSKFCKKYDMKMHMSRAHYGLKPFKCSFCEYKCTTKFGLKSHV  310 (373)
Q Consensus       264 C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~  310 (373)
                      |=.|++.|.....|..|++..|     |+|-+|.+..-+-..|..|-
T Consensus        13 cwycnrefddekiliqhqkakh-----fkchichkkl~sgpglsihc   54 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKAKH-----FKCHICHKKLFSGPGLSIHC   54 (341)
T ss_pred             eeecccccchhhhhhhhhhhcc-----ceeeeehhhhccCCCceeeh
Confidence            4444444444444444443333     44555544444444444443


No 72 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=88.78  E-value=0.15  Score=30.90  Aligned_cols=24  Identities=25%  Similarity=0.584  Sum_probs=10.3

Q ss_pred             ccCCCCCCCccChhHHHHHHHhhc
Q psy10075        319 YFCGSCNFSCTSNTDLLEHVQTNH  342 (373)
Q Consensus       319 ~~C~~C~~~f~~~~~l~~H~~~~H  342 (373)
                      ++|+.|+..|....+...|+...|
T Consensus        18 lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          18 LRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             eeCCchhHHHHHhHHHHHHhhHHh
Confidence            444444444444444444444433


No 73 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=88.30  E-value=0.3  Score=29.63  Aligned_cols=30  Identities=20%  Similarity=0.475  Sum_probs=21.0

Q ss_pred             CCCCccccCCCchhccCcHHHHHHHHHhcC
Q psy10075        195 TNEKPFKCTLCSYKAKRNFELKQHILRIHQ  224 (373)
Q Consensus       195 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~  224 (373)
                      .++..+.||-|+..|....+..+|....|.
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            456667777777777777777777766553


No 74 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=87.61  E-value=1.8  Score=31.27  Aligned_cols=47  Identities=15%  Similarity=0.318  Sum_probs=24.6

Q ss_pred             CCCCcccccchhhhhhhhhhccCCCcccCCCCCCCccChhHHHHHHHhh
Q psy10075        293 CSFCEYKCTTKFGLKSHVTRIHSNQKYFCGSCNFSCTSNTDLLEHVQTN  341 (373)
Q Consensus       293 C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~~  341 (373)
                      |--|...|........  .......+|+|+.|...|-..=++..|...|
T Consensus        58 C~~C~~~f~~~~~~~~--~~~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        58 CFGCQGPFPKPPVSPF--DELKDSHRYVCAVCKNVFCVDCDVFVHESLH  104 (112)
T ss_pred             ccCcCCCCCCcccccc--cccccccceeCCCCCCccccccchhhhhhcc
Confidence            6666666654321110  0011223477777777777666666665554


No 75 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=87.28  E-value=0.2  Score=41.39  Aligned_cols=22  Identities=27%  Similarity=0.433  Sum_probs=12.2

Q ss_pred             CCeecCCCCccccChhHHHHhh
Q psy10075        260 KPFTCEHCDSKFCKKYDMKMHM  281 (373)
Q Consensus       260 ~~~~C~~C~~~f~~~~~L~~H~  281 (373)
                      +.+.||+|+..|..........
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~   25 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKI   25 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCc
Confidence            3456666666666654443333


No 76 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=87.17  E-value=0.47  Score=26.12  Aligned_cols=9  Identities=22%  Similarity=0.748  Sum_probs=3.9

Q ss_pred             eecCCCCcc
Q psy10075        262 FTCEHCDSK  270 (373)
Q Consensus       262 ~~C~~C~~~  270 (373)
                      |+|.+||..
T Consensus         3 ~~C~~CG~i   11 (34)
T cd00729           3 WVCPVCGYI   11 (34)
T ss_pred             EECCCCCCE
Confidence            344444433


No 77 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=85.25  E-value=0.76  Score=28.53  Aligned_cols=14  Identities=21%  Similarity=0.389  Sum_probs=7.4

Q ss_pred             CccccCCCchhccC
Q psy10075        198 KPFKCTLCSYKAKR  211 (373)
Q Consensus       198 ~~~~C~~C~~~f~~  211 (373)
                      ..|.||.||.....
T Consensus        26 v~F~CPnCGe~~I~   39 (61)
T COG2888          26 VKFPCPNCGEVEIY   39 (61)
T ss_pred             eEeeCCCCCceeee
Confidence            34566666644433


No 78 
>PHA00626 hypothetical protein
Probab=85.25  E-value=0.41  Score=29.17  Aligned_cols=12  Identities=17%  Similarity=0.539  Sum_probs=5.7

Q ss_pred             CeecCCCCcccc
Q psy10075        261 PFTCEHCDSKFC  272 (373)
Q Consensus       261 ~~~C~~C~~~f~  272 (373)
                      .|.|+.||..|+
T Consensus        23 rYkCkdCGY~ft   34 (59)
T PHA00626         23 DYVCCDCGYNDS   34 (59)
T ss_pred             ceEcCCCCCeec
Confidence            344555554443


No 79 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=84.26  E-value=0.54  Score=43.64  Aligned_cols=150  Identities=21%  Similarity=0.328  Sum_probs=81.5

Q ss_pred             CceecccccccccchhHHHhhhhh-ccCCC--CccccC--CCchhccCcHHHHHHHHHhcCCCCccceec--CCCccccc
Q psy10075        169 TRFQCSFCDRRFYFKNECTKHYLE-HHTNE--KPFKCT--LCSYKAKRNFELKQHILRIHQDNIEAEYHC--TYCDYICS  241 (373)
Q Consensus       169 ~~~~C~~C~~~f~~~~~l~~H~~~-~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~h~~~~~~~~~C--~~C~~~f~  241 (373)
                      .++.|..|...|.....+..|... .|.++  .++.|+  .|++.|.+...+..|. ..|..  ..++.+  ..+...+.
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~-~~~~~--~~~~~~~~~~~~~~~~  364 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHI-LLHTS--ISPAKEKLLNSSSKFS  364 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCc-ccccC--CCccccccccCccccc
Confidence            356777777777777777777532 56666  777777  6777777777777775 45544  222222  22333333


Q ss_pred             ChHHHhhhhh--ccCCCCCCCCeecC--CCCccccChhHHHHhhhhhccCCC--CccCCCCcccccchhhhhhhhhhccC
Q psy10075        242 SRTILKSHIN--KKHANDEDKPFTCE--HCDSKFCKKYDMKMHMSRAHYGLK--PFKCSFCEYKCTTKFGLKSHVTRIHS  315 (373)
Q Consensus       242 ~~~~l~~H~~--~~~~~~~~~~~~C~--~C~~~f~~~~~L~~H~~~~H~~~~--~~~C~~C~~~f~~~~~l~~H~~~~h~  315 (373)
                      ....-..+..  ..........+.+.  .|...+.....+..|. ..|....  .+.+..|...+.....+..|.+.+..
T Consensus       365 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  443 (467)
T COG5048         365 PLLNNEPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHI-ITHLSFRPYNCKNPPCSKSFNRHYNLIPHKKIHTN  443 (467)
T ss_pred             cccCCCCccchhhccCccCCccccccccchhhhhcccccccccc-ccccccCCcCCCCCcchhhccCccccccccccccc
Confidence            2221100000  00011122333332  2555666666666666 5555444  45666777777777777777755555


Q ss_pred             CCcccCC
Q psy10075        316 NQKYFCG  322 (373)
Q Consensus       316 ~~~~~C~  322 (373)
                      ..++.|.
T Consensus       444 ~~~~~~~  450 (467)
T COG5048         444 HAPLLCS  450 (467)
T ss_pred             CCceeec
Confidence            5544443


No 80 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=83.78  E-value=0.93  Score=26.65  Aligned_cols=10  Identities=20%  Similarity=0.836  Sum_probs=4.3

Q ss_pred             eecCCCCccc
Q psy10075        262 FTCEHCDSKF  271 (373)
Q Consensus       262 ~~C~~C~~~f  271 (373)
                      |+|..||..|
T Consensus         3 Y~C~~Cg~~~   12 (44)
T smart00659        3 YICGECGREN   12 (44)
T ss_pred             EECCCCCCEe
Confidence            4444444443


No 81 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=83.77  E-value=0.44  Score=39.40  Aligned_cols=23  Identities=9%  Similarity=0.151  Sum_probs=17.0

Q ss_pred             CcceecCCCCccccChhhHhhcc
Q psy10075         23 SYNFICILCNYHAENFENIYLHL   45 (373)
Q Consensus        23 ~~~~~C~~C~~~f~~~~~l~~H~   45 (373)
                      ++.+.||+|+..|.+........
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~   25 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKI   25 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCc
Confidence            56789999999998876554433


No 82 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=83.24  E-value=0.81  Score=25.74  Aligned_cols=11  Identities=18%  Similarity=0.763  Sum_probs=5.7

Q ss_pred             Ccccccccccc
Q psy10075        141 PHKCTICESTY  151 (373)
Q Consensus       141 ~~~C~~C~~~f  151 (373)
                      ..+|+.|+..|
T Consensus        25 ~vrC~~C~~~f   35 (37)
T PF13719_consen   25 KVRCPKCGHVF   35 (37)
T ss_pred             EEECCCCCcEe
Confidence            45555555544


No 83 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=83.14  E-value=0.38  Score=37.17  Aligned_cols=16  Identities=19%  Similarity=0.260  Sum_probs=10.7

Q ss_pred             ccCCCCCCCccChhHH
Q psy10075        319 YFCGSCNFSCTSNTDL  334 (373)
Q Consensus       319 ~~C~~C~~~f~~~~~l  334 (373)
                      |+|+.||+.|.+...+
T Consensus        29 ~~c~~c~~~f~~~e~~   44 (154)
T PRK00464         29 RECLACGKRFTTFERV   44 (154)
T ss_pred             eeccccCCcceEeEec
Confidence            6777777777765543


No 84 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=82.81  E-value=0.71  Score=33.27  Aligned_cols=15  Identities=27%  Similarity=0.877  Sum_probs=7.3

Q ss_pred             CCeecCCCCccccCh
Q psy10075        260 KPFTCEHCDSKFCKK  274 (373)
Q Consensus       260 ~~~~C~~C~~~f~~~  274 (373)
                      .|.+|+.||..|.-.
T Consensus        25 ~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   25 DPIVCPKCGTEFPPE   39 (108)
T ss_pred             CCccCCCCCCccCcc
Confidence            344555555555433


No 85 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=82.76  E-value=0.79  Score=25.61  Aligned_cols=11  Identities=18%  Similarity=0.806  Sum_probs=5.7

Q ss_pred             Ccccccccccc
Q psy10075        141 PHKCTICESTY  151 (373)
Q Consensus       141 ~~~C~~C~~~f  151 (373)
                      ..+|+.|+.+|
T Consensus        25 ~v~C~~C~~~f   35 (36)
T PF13717_consen   25 KVRCSKCGHVF   35 (36)
T ss_pred             EEECCCCCCEe
Confidence            45555555544


No 86 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=81.91  E-value=1.1  Score=26.56  Aligned_cols=10  Identities=20%  Similarity=0.999  Sum_probs=5.3

Q ss_pred             eecCCCCccc
Q psy10075        262 FTCEHCDSKF  271 (373)
Q Consensus       262 ~~C~~C~~~f  271 (373)
                      |+|+.||..|
T Consensus         4 y~C~~CG~~~   13 (46)
T PRK00398          4 YKCARCGREV   13 (46)
T ss_pred             EECCCCCCEE
Confidence            5555555544


No 87 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=81.80  E-value=0.87  Score=25.70  Aligned_cols=10  Identities=20%  Similarity=0.786  Sum_probs=4.9

Q ss_pred             cccccccccc
Q psy10075        142 HKCTICESTY  151 (373)
Q Consensus       142 ~~C~~C~~~f  151 (373)
                      ..|+.|+..|
T Consensus        26 v~C~~C~~~~   35 (38)
T TIGR02098        26 VRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEE
Confidence            4455555444


No 88 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=80.56  E-value=2.8  Score=30.28  Aligned_cols=19  Identities=32%  Similarity=0.691  Sum_probs=10.2

Q ss_pred             CcccccccccccCHHHHHH
Q psy10075        141 PHKCTICESTYLTKVELKN  159 (373)
Q Consensus       141 ~~~C~~C~~~f~~~~~l~~  159 (373)
                      |..|+.|+....+...|.+
T Consensus        15 P~~CpiCgLtLVss~HLAR   33 (112)
T TIGR00622        15 PVECPICGLTLILSTHLAR   33 (112)
T ss_pred             CCcCCcCCCEEeccchHHH
Confidence            4556666555555544443


No 89 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=80.43  E-value=1.2  Score=34.72  Aligned_cols=24  Identities=29%  Similarity=0.704  Sum_probs=14.9

Q ss_pred             CeecCCCCccccChhHHHHhhhhhccCCCCccCCCCcc
Q psy10075        261 PFTCEHCDSKFCKKYDMKMHMSRAHYGLKPFKCSFCEY  298 (373)
Q Consensus       261 ~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~  298 (373)
                      .|+|++||..              +.++.|-+||+||.
T Consensus       134 ~~vC~vCGy~--------------~~ge~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYT--------------HEGEAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCc--------------ccCCCCCcCCCCCC
Confidence            5777777643              33456677777763


No 90 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=78.12  E-value=1.2  Score=25.61  Aligned_cols=30  Identities=23%  Similarity=0.420  Sum_probs=16.9

Q ss_pred             ceecCCCCccccChhhHhhccccCCCCCccccCcCcc
Q psy10075         25 NFICILCNYHAENFENIYLHLPSHFEQKLFSCDLCEY   61 (373)
Q Consensus        25 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~   61 (373)
                      .|.|+.||..|........       ...-.|+.|+.
T Consensus         5 ~y~C~~Cg~~fe~~~~~~~-------~~~~~CP~Cg~   34 (41)
T smart00834        5 EYRCEDCGHTFEVLQKISD-------DPLATCPECGG   34 (41)
T ss_pred             EEEcCCCCCEEEEEEecCC-------CCCCCCCCCCC
Confidence            3667777777765433311       34456777764


No 91 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=77.94  E-value=1.2  Score=27.26  Aligned_cols=29  Identities=21%  Similarity=0.473  Sum_probs=15.9

Q ss_pred             eecCCCCccccChhhHhhccccCCCCCccccCcCcc
Q psy10075         26 FICILCNYHAENFENIYLHLPSHFEQKLFSCDLCEY   61 (373)
Q Consensus        26 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~   61 (373)
                      |.|..|+..|.....+..       +.+-.|+.|+.
T Consensus         6 y~C~~Cg~~fe~~~~~~~-------~~~~~CP~Cg~   34 (52)
T TIGR02605         6 YRCTACGHRFEVLQKMSD-------DPLATCPECGG   34 (52)
T ss_pred             EEeCCCCCEeEEEEecCC-------CCCCCCCCCCC
Confidence            667777777765432211       23445777763


No 92 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=75.75  E-value=1.6  Score=25.36  Aligned_cols=29  Identities=21%  Similarity=0.440  Sum_probs=16.4

Q ss_pred             eecCCCCccccChhhHhhccccCCCCCccccCcCcc
Q psy10075         26 FICILCNYHAENFENIYLHLPSHFEQKLFSCDLCEY   61 (373)
Q Consensus        26 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~   61 (373)
                      |.|..||..|.....+..       ..+-.|+.|+.
T Consensus         6 y~C~~Cg~~fe~~~~~~~-------~~~~~CP~Cg~   34 (42)
T PF09723_consen    6 YRCEECGHEFEVLQSISE-------DDPVPCPECGS   34 (42)
T ss_pred             EEeCCCCCEEEEEEEcCC-------CCCCcCCCCCC
Confidence            667777777655533311       34456666664


No 93 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=75.47  E-value=2  Score=31.05  Aligned_cols=13  Identities=23%  Similarity=0.723  Sum_probs=6.7

Q ss_pred             CcccccccccccC
Q psy10075        141 PHKCTICESTYLT  153 (373)
Q Consensus       141 ~~~C~~C~~~f~~  153 (373)
                      |..||.||..|..
T Consensus        26 PivCP~CG~~~~~   38 (108)
T PF09538_consen   26 PIVCPKCGTEFPP   38 (108)
T ss_pred             CccCCCCCCccCc
Confidence            4455555555543


No 94 
>KOG2186|consensus
Probab=74.38  E-value=1.5  Score=36.27  Aligned_cols=45  Identities=20%  Similarity=0.424  Sum_probs=33.4

Q ss_pred             eecCCCCccccChhhHhhccccCCCCCccccCcCcccccchHHHHHHh
Q psy10075         26 FICILCNYHAENFENIYLHLPSHFEQKLFSCDLCEYQTNTKIYIRRHM   73 (373)
Q Consensus        26 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~   73 (373)
                      |.|.+||-+..-. .+..|+....+ .-|.|..|+..|.. ..+..|.
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~   48 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHT   48 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccC-CeeEEeeccccccc-chhhhhh
Confidence            6788888777654 56678877766 66888888888877 6667774


No 95 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=73.24  E-value=2.9  Score=32.23  Aligned_cols=18  Identities=17%  Similarity=0.316  Sum_probs=8.5

Q ss_pred             CcceecCCCCccccChhh
Q psy10075         23 SYNFICILCNYHAENFEN   40 (373)
Q Consensus        23 ~~~~~C~~C~~~f~~~~~   40 (373)
                      ..-|.|+.|+..|...++
T Consensus        97 ~~~Y~Cp~C~~~y~~~ea  114 (147)
T smart00531       97 NAYYKCPNCQSKYTFLEA  114 (147)
T ss_pred             CcEEECcCCCCEeeHHHH
Confidence            334555555555544433


No 96 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=72.53  E-value=3.6  Score=24.13  Aligned_cols=26  Identities=19%  Similarity=0.429  Sum_probs=13.2

Q ss_pred             CCCeecCCCCccccC----hhHHHHhhhhh
Q psy10075        259 DKPFTCEHCDSKFCK----KYDMKMHMSRA  284 (373)
Q Consensus       259 ~~~~~C~~C~~~f~~----~~~L~~H~~~~  284 (373)
                      .....|..|++.+..    .+.|..|++..
T Consensus        14 ~~~a~C~~C~~~~~~~~~~ts~l~~HL~~~   43 (45)
T PF02892_consen   14 KKKAKCKYCGKVIKYSSGGTSNLKRHLKKK   43 (45)
T ss_dssp             SS-EEETTTTEE-----SSTHHHHHHHHHT
T ss_pred             cCeEEeCCCCeEEeeCCCcHHHHHHhhhhh
Confidence            344567777776654    35666666433


No 97 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=72.42  E-value=2.8  Score=32.80  Aligned_cols=24  Identities=25%  Similarity=0.800  Sum_probs=18.9

Q ss_pred             ceecCCCcccccChHHHhhhhhccCCCCCCCCeecCCCCc
Q psy10075        230 EYHCTYCDYICSSRTILKSHINKKHANDEDKPFTCEHCDS  269 (373)
Q Consensus       230 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~C~~C~~  269 (373)
                      .|.|++||..+                .++.|-+||+||-
T Consensus       134 ~~vC~vCGy~~----------------~ge~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYTH----------------EGEAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCcc----------------cCCCCCcCCCCCC
Confidence            69999998753                3378889999984


No 98 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=71.53  E-value=2.7  Score=32.88  Aligned_cols=15  Identities=20%  Similarity=0.383  Sum_probs=6.5

Q ss_pred             eecCCCCccccChhH
Q psy10075        262 FTCEHCDSKFCKKYD  276 (373)
Q Consensus       262 ~~C~~C~~~f~~~~~  276 (373)
                      |.|+.|+..|+...+
T Consensus       110 Y~Cp~c~~r~tf~eA  124 (158)
T TIGR00373       110 FICPNMCVRFTFNEA  124 (158)
T ss_pred             EECCCCCcEeeHHHH
Confidence            444444444443333


No 99 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=71.19  E-value=3.9  Score=22.12  Aligned_cols=11  Identities=18%  Similarity=0.806  Sum_probs=5.3

Q ss_pred             eecCCCCcccc
Q psy10075        262 FTCEHCDSKFC  272 (373)
Q Consensus       262 ~~C~~C~~~f~  272 (373)
                      |.|..||..+.
T Consensus         1 Y~C~~Cg~~~~   11 (32)
T PF03604_consen    1 YICGECGAEVE   11 (32)
T ss_dssp             EBESSSSSSE-
T ss_pred             CCCCcCCCeeE
Confidence            45555555543


No 100
>KOG2186|consensus
Probab=71.17  E-value=1.7  Score=35.91  Aligned_cols=45  Identities=31%  Similarity=0.559  Sum_probs=23.4

Q ss_pred             eecCCCCccccChhHHHHhhhhhccCCCCccCCCCcccccchhhhhhhh
Q psy10075        262 FTCEHCDSKFCKKYDMKMHMSRAHYGLKPFKCSFCEYKCTTKFGLKSHV  310 (373)
Q Consensus       262 ~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~  310 (373)
                      |.|.+||.+.. ...+..|+.+.+.  .-|.|--|+..|.. .++..|.
T Consensus         4 FtCnvCgEsvK-Kp~vekH~srCrn--~~fSCIDC~k~F~~-~sYknH~   48 (276)
T KOG2186|consen    4 FTCNVCGESVK-KPQVEKHMSRCRN--AYFSCIDCGKTFER-VSYKNHT   48 (276)
T ss_pred             Eehhhhhhhcc-ccchHHHHHhccC--CeeEEeeccccccc-chhhhhh
Confidence            45555555553 2344556544333  34566666666644 5555555


No 101
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=71.12  E-value=4  Score=23.62  Aligned_cols=23  Identities=30%  Similarity=0.869  Sum_probs=16.6

Q ss_pred             ccCCCCCCCccChhHHHHHHHhh
Q psy10075        319 YFCGSCNFSCTSNTDLLEHVQTN  341 (373)
Q Consensus       319 ~~C~~C~~~f~~~~~l~~H~~~~  341 (373)
                      |+|-.|.+....++.|..||+-.
T Consensus        21 ykcfqcpftc~~kshl~nhmky~   43 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKYS   43 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHHH
Confidence            77777777777777777776643


No 102
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=71.02  E-value=0.54  Score=45.02  Aligned_cols=78  Identities=21%  Similarity=0.464  Sum_probs=49.7

Q ss_pred             eecCCCcccccChHHHhhhhhccCCCCCCCCe-ecCCCCccccChhHHHHhhhhhccCCCCc-cCCCCcccccchhhhhh
Q psy10075        231 YHCTYCDYICSSRTILKSHINKKHANDEDKPF-TCEHCDSKFCKKYDMKMHMSRAHYGLKPF-KCSFCEYKCTTKFGLKS  308 (373)
Q Consensus       231 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~-~C~~C~~~f~~~~~L~~H~~~~H~~~~~~-~C~~C~~~f~~~~~l~~  308 (373)
                      -.|+.|-+.+.+..+-+.+.          || .|+.||-+|+--..|=.=  +..+....| -|+.|.+.+.+..+-+-
T Consensus       102 a~C~~Cl~Ei~dp~~rrY~Y----------PF~~CT~CGPRfTIi~alPYD--R~nTsM~~F~lC~~C~~EY~dP~nRRf  169 (750)
T COG0068         102 ATCEDCLEEIFDPNSRRYLY----------PFINCTNCGPRFTIIEALPYD--RENTSMADFPLCPFCDKEYKDPLNRRF  169 (750)
T ss_pred             hhhHHHHHHhcCCCCcceec----------cccccCCCCcceeeeccCCCC--cccCccccCcCCHHHHHHhcCcccccc
Confidence            35666755554444333332          23 588888888765554332  344555544 48888888888877777


Q ss_pred             hhhhccCCCcccCCCCCC
Q psy10075        309 HVTRIHSNQKYFCGSCNF  326 (373)
Q Consensus       309 H~~~~h~~~~~~C~~C~~  326 (373)
                      |.      ++..|+.||-
T Consensus       170 HA------Qp~aCp~CGP  181 (750)
T COG0068         170 HA------QPIACPKCGP  181 (750)
T ss_pred             cc------ccccCcccCC
Confidence            76      5778999985


No 103
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=70.94  E-value=3.7  Score=31.71  Aligned_cols=12  Identities=25%  Similarity=0.703  Sum_probs=5.4

Q ss_pred             ceecCCCccccc
Q psy10075        230 EYHCTYCDYICS  241 (373)
Q Consensus       230 ~~~C~~C~~~f~  241 (373)
                      -|.|+.|+..|.
T Consensus        99 ~Y~Cp~C~~~y~  110 (147)
T smart00531       99 YYKCPNCQSKYT  110 (147)
T ss_pred             EEECcCCCCEee
Confidence            344444444444


No 104
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=70.55  E-value=2.4  Score=25.42  Aligned_cols=29  Identities=21%  Similarity=0.478  Sum_probs=18.7

Q ss_pred             CcceecCCCCccccChhhHhhccccCCCCCccccCcCcc
Q psy10075         23 SYNFICILCNYHAENFENIYLHLPSHFEQKLFSCDLCEY   61 (373)
Q Consensus        23 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~   61 (373)
                      ...|+|..|++.|....          ......|+.||.
T Consensus         4 ~~~Y~C~~Cg~~~~~~~----------~~~~irCp~Cg~   32 (49)
T COG1996           4 MMEYKCARCGREVELDQ----------ETRGIRCPYCGS   32 (49)
T ss_pred             eEEEEhhhcCCeeehhh----------ccCceeCCCCCc
Confidence            45688888888883222          234577888874


No 105
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=69.74  E-value=3.1  Score=28.26  Aligned_cols=15  Identities=27%  Similarity=0.773  Sum_probs=9.2

Q ss_pred             CCCeecCCCCccccC
Q psy10075        259 DKPFTCEHCDSKFCK  273 (373)
Q Consensus       259 ~~~~~C~~C~~~f~~  273 (373)
                      ...+.|..||..|..
T Consensus        51 ~GIW~C~kCg~~fAG   65 (89)
T COG1997          51 TGIWKCRKCGAKFAG   65 (89)
T ss_pred             cCeEEcCCCCCeecc
Confidence            345667777766654


No 106
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=69.68  E-value=3.2  Score=32.44  Aligned_cols=32  Identities=22%  Similarity=0.288  Sum_probs=18.5

Q ss_pred             CCcceecCCCCccccChhhHhhccccCCCCCccccCcCccc
Q psy10075         22 DSYNFICILCNYHAENFENIYLHLPSHFEQKLFSCDLCEYQ   62 (373)
Q Consensus        22 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~   62 (373)
                      +..-|.|+.|+..|+..+++.         ..|.|+.||..
T Consensus       106 ~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~  137 (158)
T TIGR00373       106 NNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAM  137 (158)
T ss_pred             CCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCE
Confidence            344466666666666666663         13666666643


No 107
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=69.39  E-value=3.1  Score=30.63  Aligned_cols=15  Identities=13%  Similarity=0.250  Sum_probs=7.5

Q ss_pred             CCeecCCCCccccCh
Q psy10075        260 KPFTCEHCDSKFCKK  274 (373)
Q Consensus       260 ~~~~C~~C~~~f~~~  274 (373)
                      .|..|+.||..|...
T Consensus        25 ~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        25 RPAVSPYTGEQFPPE   39 (129)
T ss_pred             CCccCCCcCCccCcc
Confidence            345555555555433


No 108
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=69.38  E-value=2.9  Score=33.37  Aligned_cols=12  Identities=33%  Similarity=0.916  Sum_probs=5.3

Q ss_pred             eecCCCCccccC
Q psy10075        262 FTCEHCDSKFCK  273 (373)
Q Consensus       262 ~~C~~C~~~f~~  273 (373)
                      |.|+.|+..|+.
T Consensus       118 Y~Cp~C~~rytf  129 (178)
T PRK06266        118 FFCPNCHIRFTF  129 (178)
T ss_pred             EECCCCCcEEeH
Confidence            444444444433


No 109
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=68.69  E-value=2.3  Score=26.79  Aligned_cols=44  Identities=16%  Similarity=0.270  Sum_probs=24.7

Q ss_pred             CCCcceecCC--CCccccChhhHhhccccCCCCCccccCc----Ccccccc
Q psy10075         21 DDSYNFICIL--CNYHAENFENIYLHLPSHFEQKLFSCDL----CEYQTNT   65 (373)
Q Consensus        21 ~~~~~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~----C~~~f~~   65 (373)
                      ....+..|+.  |...+.. ..|..|+...-...+..|..    |+..+..
T Consensus         5 C~~~~v~C~~~cc~~~i~r-~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~~   54 (60)
T PF02176_consen    5 CPFRPVPCPNGCCNEMIPR-KELDDHLENECPKRPVPCPYSPYGCKERVPR   54 (60)
T ss_dssp             STTSEEE-TT--S-BEEEC-CCHHHHHHTTSTTSEEE-SS----S--EEEH
T ss_pred             CCCCEeeCCCCCcccceeH-HHHHHHHHccCCCCcEECCCCCCCCCCccch
Confidence            3556777877  5454553 46778877555556777877    7765543


No 110
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=67.93  E-value=4.1  Score=33.93  Aligned_cols=41  Identities=17%  Similarity=0.400  Sum_probs=17.7

Q ss_pred             CCCccccCCCchhccCcHHHHHHHHHhcCCCCccceecCCCcc
Q psy10075        196 NEKPFKCTLCSYKAKRNFELKQHILRIHQDNIEAEYHCTYCDY  238 (373)
Q Consensus       196 ~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~C~~C~~  238 (373)
                      +.+.|.|.+|....-. ..--.|+.....-. ...|+|..|++
T Consensus       139 GGrif~CsfC~~flCE-DDQFEHQAsCQvLe-~E~~KC~SCNr  179 (314)
T PF06524_consen  139 GGRIFKCSFCDNFLCE-DDQFEHQASCQVLE-SETFKCQSCNR  179 (314)
T ss_pred             CCeEEEeecCCCeeec-cchhhhhhhhhhhh-ccccccccccc
Confidence            4556666666543222 22223332222111 34466666654


No 111
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=67.90  E-value=4.1  Score=24.31  Aligned_cols=8  Identities=25%  Similarity=0.945  Sum_probs=3.2

Q ss_pred             ccCCCCCC
Q psy10075        319 YFCGSCNF  326 (373)
Q Consensus       319 ~~C~~C~~  326 (373)
                      +.|++|+.
T Consensus        35 w~CP~C~a   42 (47)
T PF00301_consen   35 WVCPVCGA   42 (47)
T ss_dssp             -B-TTTSS
T ss_pred             CcCcCCCC
Confidence            55555553


No 112
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=67.44  E-value=1.9  Score=22.94  Aligned_cols=7  Identities=29%  Similarity=1.051  Sum_probs=3.3

Q ss_pred             ccCCCCC
Q psy10075        319 YFCGSCN  325 (373)
Q Consensus       319 ~~C~~C~  325 (373)
                      |.|+.|+
T Consensus        20 ~vCp~C~   26 (30)
T PF08274_consen   20 LVCPECG   26 (30)
T ss_dssp             EEETTTT
T ss_pred             EeCCccc
Confidence            4444444


No 113
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=67.18  E-value=2.8  Score=34.46  Aligned_cols=31  Identities=16%  Similarity=0.244  Sum_probs=22.6

Q ss_pred             CCCcccCCCCCCCccChhHHHHHHHhhcccc
Q psy10075        315 SNQKYFCGSCNFSCTSNTDLLEHVQTNHIIV  345 (373)
Q Consensus       315 ~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~  345 (373)
                      .+..|.|++|++.|.-..-+++||.+.|...
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nKH~e~  104 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNKHPEK  104 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH-HHH
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhcCHHH
Confidence            3445999999999999999999999988743


No 114
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=67.09  E-value=3.9  Score=20.87  Aligned_cols=18  Identities=22%  Similarity=0.517  Sum_probs=9.4

Q ss_pred             cCCCCcccccchhhhhhhh
Q psy10075        292 KCSFCEYKCTTKFGLKSHV  310 (373)
Q Consensus       292 ~C~~C~~~f~~~~~l~~H~  310 (373)
                      .||+|+..+ ....+..|+
T Consensus         3 ~CPiC~~~v-~~~~in~HL   20 (26)
T smart00734        3 QCPVCFREV-PENLINSHL   20 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHH
Confidence            355565555 444555554


No 115
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=66.91  E-value=4  Score=32.60  Aligned_cols=32  Identities=22%  Similarity=0.375  Sum_probs=18.2

Q ss_pred             CCcceecCCCCccccChhhHhhccccCCCCCccccCcCccc
Q psy10075         22 DSYNFICILCNYHAENFENIYLHLPSHFEQKLFSCDLCEYQ   62 (373)
Q Consensus        22 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~   62 (373)
                      +..-|.|+.|+..|+..+++.         ..|.|+.||..
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~  145 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEM  145 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCC
Confidence            344566666666666665552         24666666643


No 116
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=66.01  E-value=2.6  Score=27.79  Aligned_cols=39  Identities=13%  Similarity=0.351  Sum_probs=17.6

Q ss_pred             ccCCCCcccccchhhhhhhhhhccCCCcccCC--CCCCCccCh
Q psy10075        291 FKCSFCEYKCTTKFGLKSHVTRIHSNQKYFCG--SCNFSCTSN  331 (373)
Q Consensus       291 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~--~C~~~f~~~  331 (373)
                      +.|+.||.......+-...-  ...+..++|.  .||..|...
T Consensus         2 m~CP~Cg~~a~irtSr~~s~--~~~~~Y~qC~N~eCg~tF~t~   42 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYITD--TTKERYHQCQNVNCSATFITY   42 (72)
T ss_pred             ccCCCCCCccEEEEChhcCh--hhheeeeecCCCCCCCEEEEE
Confidence            45666665543222222221  1222336666  666666643


No 117
>COG2879 Uncharacterized small protein [Function unknown]
Probab=65.74  E-value=9  Score=24.19  Aligned_cols=30  Identities=13%  Similarity=0.224  Sum_probs=23.4

Q ss_pred             ccChhHHHHHHHhhcccccccccchhHHHH
Q psy10075        328 CTSNTDLLEHVQTNHIIVGESSSRDFIIHS  357 (373)
Q Consensus       328 f~~~~~l~~H~~~~H~~~~~~~~~~~~~~~  357 (373)
                      -++.++..+||+.+|+......++.|....
T Consensus        22 vpdYdnYVehmr~~hPd~p~mT~~EFfrec   51 (65)
T COG2879          22 VPDYDNYVEHMRKKHPDKPPMTYEEFFREC   51 (65)
T ss_pred             CCcHHHHHHHHHHhCcCCCcccHHHHHHHH
Confidence            467789999999999877666666776665


No 118
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=63.82  E-value=6.4  Score=23.78  Aligned_cols=25  Identities=24%  Similarity=0.670  Sum_probs=15.8

Q ss_pred             CeecCCCCccccCh-----hHHHHhhhhhc
Q psy10075        261 PFTCEHCDSKFCKK-----YDMKMHMSRAH  285 (373)
Q Consensus       261 ~~~C~~C~~~f~~~-----~~L~~H~~~~H  285 (373)
                      .-.|..|++.++..     +.|.+|+...|
T Consensus        18 ~a~C~~C~~~l~~~~~~gTs~L~rHl~~~h   47 (50)
T smart00614       18 RAKCKYCGKKLSRSSKGGTSNLRRHLRRKH   47 (50)
T ss_pred             EEEecCCCCEeeeCCCCCcHHHHHHHHhHC
Confidence            35677777777543     57777774344


No 119
>PF14353 CpXC:  CpXC protein
Probab=63.04  E-value=1.8  Score=32.46  Aligned_cols=21  Identities=29%  Similarity=0.537  Sum_probs=11.5

Q ss_pred             CccCCCCcccccchhhhhhhh
Q psy10075        290 PFKCSFCEYKCTTKFGLKSHV  310 (373)
Q Consensus       290 ~~~C~~C~~~f~~~~~l~~H~  310 (373)
                      .|.|+.||..|.-...+..|-
T Consensus        38 ~~~CP~Cg~~~~~~~p~lY~D   58 (128)
T PF14353_consen   38 SFTCPSCGHKFRLEYPLLYHD   58 (128)
T ss_pred             EEECCCCCCceecCCCEEEEc
Confidence            356666666665444444443


No 120
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=62.48  E-value=5.7  Score=32.66  Aligned_cols=29  Identities=17%  Similarity=0.393  Sum_probs=18.6

Q ss_pred             CCCCeecCCCCccccChhHHHHhhhhhcc
Q psy10075        258 EDKPFTCEHCDSKFCKKYDMKMHMSRAHY  286 (373)
Q Consensus       258 ~~~~~~C~~C~~~f~~~~~L~~H~~~~H~  286 (373)
                      .+..|.|+.|+|.|.-......|+...|.
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhcCH
Confidence            45557777777777777777777766664


No 121
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=61.96  E-value=6.8  Score=23.77  Aligned_cols=7  Identities=29%  Similarity=1.189  Sum_probs=4.0

Q ss_pred             ccCCCCC
Q psy10075        319 YFCGSCN  325 (373)
Q Consensus       319 ~~C~~C~  325 (373)
                      +.|++|+
T Consensus        35 w~CP~C~   41 (50)
T cd00730          35 WVCPVCG   41 (50)
T ss_pred             CCCCCCC
Confidence            5555555


No 122
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=60.84  E-value=3.8  Score=23.49  Aligned_cols=11  Identities=27%  Similarity=0.872  Sum_probs=7.4

Q ss_pred             ccCCCCCCCcc
Q psy10075        319 YFCGSCNFSCT  329 (373)
Q Consensus       319 ~~C~~C~~~f~  329 (373)
                      |.|..|+..|.
T Consensus        29 y~C~~C~~~w~   39 (40)
T smart00440       29 YVCTKCGHRWR   39 (40)
T ss_pred             EEeCCCCCEeC
Confidence            77777776553


No 123
>KOG1280|consensus
Probab=60.39  E-value=6.8  Score=34.23  Aligned_cols=36  Identities=25%  Similarity=0.583  Sum_probs=17.3

Q ss_pred             CccCCCCcccccchhhhhhhhhhccCCCc--ccCCCCC
Q psy10075        290 PFKCSFCEYKCTTKFGLKSHVTRIHSNQK--YFCGSCN  325 (373)
Q Consensus       290 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~--~~C~~C~  325 (373)
                      .|.|++|+..-.+...|..|+...|.+..  -.|++|+
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            35555555544445555555544444443  3444443


No 124
>KOG1280|consensus
Probab=59.34  E-value=11  Score=32.95  Aligned_cols=41  Identities=20%  Similarity=0.546  Sum_probs=31.0

Q ss_pred             CCCccccCCCchhccCcHHHHHHHHHhcCCCCccceecCCCc
Q psy10075        196 NEKPFKCTLCSYKAKRNFELKQHILRIHQDNIEAEYHCTYCD  237 (373)
Q Consensus       196 ~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~C~~C~  237 (373)
                      ....|.||+|+..-.+...+..|+...|.... ..-.|+.|+
T Consensus        76 ~~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~-~~~icp~c~  116 (381)
T KOG1280|consen   76 DPQSFTCPYCGIMGFTERQFGTHVLSQHPEAS-TSVICPLCA  116 (381)
T ss_pred             ccccccCCcccccccchhHHHHHhhhcCcccC-cceeeeccc
Confidence            44578899999888888889999888887643 445677765


No 125
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=57.46  E-value=7.2  Score=32.54  Aligned_cols=91  Identities=25%  Similarity=0.593  Sum_probs=52.3

Q ss_pred             ccCCCceecccccccccchhHHHhhhhhc-cCCCCccccCCCchhccCcHHHHHHHHHhcCCCCccceecCCCcccccCh
Q psy10075        165 HQGQTRFQCSFCDRRFYFKNECTKHYLEH-HTNEKPFKCTLCSYKAKRNFELKQHILRIHQDNIEAEYHCTYCDYICSSR  243 (373)
Q Consensus       165 h~~~~~~~C~~C~~~f~~~~~l~~H~~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~C~~C~~~f~~~  243 (373)
                      ..+.+.|+|.+|...+-.-..| .|+..- -.....|+|.-|++.                    ..|.|..|...|-+ 
T Consensus       137 ~hGGrif~CsfC~~flCEDDQF-EHQAsCQvLe~E~~KC~SCNrl--------------------Gq~sCLRCK~cfCd-  194 (314)
T PF06524_consen  137 DHGGRIFKCSFCDNFLCEDDQF-EHQASCQVLESETFKCQSCNRL--------------------GQYSCLRCKICFCD-  194 (314)
T ss_pred             cCCCeEEEeecCCCeeeccchh-hhhhhhhhhhcccccccccccc--------------------cchhhhheeeeehh-
Confidence            3467789999988765433333 343221 123456788877732                    34556666555543 


Q ss_pred             HHHhhhhhccCC-CCCCCCeecCCCCccccChhHHHHhh
Q psy10075        244 TILKSHINKKHA-NDEDKPFTCEHCDSKFCKKYDMKMHM  281 (373)
Q Consensus       244 ~~l~~H~~~~~~-~~~~~~~~C~~C~~~f~~~~~L~~H~  281 (373)
                          .|+++.-. -...+++.||.||...+....|..-.
T Consensus       195 ----dHvrrKg~ky~k~k~~PCPKCg~et~eTkdLSmSt  229 (314)
T PF06524_consen  195 ----DHVRRKGFKYEKGKPIPCPKCGYETQETKDLSMST  229 (314)
T ss_pred             ----hhhhhcccccccCCCCCCCCCCCcccccccceeee
Confidence                23322111 12246788888888888877777766


No 126
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=55.68  E-value=16  Score=31.43  Aligned_cols=83  Identities=18%  Similarity=0.297  Sum_probs=47.0

Q ss_pred             CCCeecCCCCccccChhHHHHhhhhhc-------------cCCCCccCCCCcccccchhhhhhhhhhccCCCcccCCCCC
Q psy10075        259 DKPFTCEHCDSKFCKKYDMKMHMSRAH-------------YGLKPFKCSFCEYKCTTKFGLKSHVTRIHSNQKYFCGSCN  325 (373)
Q Consensus       259 ~~~~~C~~C~~~f~~~~~L~~H~~~~H-------------~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~~C~  325 (373)
                      .-|..|+.|....-....|.+-.  +|             +..+.--|-.|.-.|.-...-..-  ......+|+|+.|.
T Consensus       320 sLPi~CP~Csl~LilsthLarSy--hhL~PLk~f~E~p~~~~~ks~~Cf~CQ~~fp~~~~~~~~--~~~ss~rY~Ce~CK  395 (421)
T COG5151         320 SLPISCPICSLQLILSTHLARSY--HHLYPLKPFVEKPEGTNPKSTHCFVCQGPFPKPPVSPFD--ESTSSGRYQCELCK  395 (421)
T ss_pred             cCCccCcchhHHHHHHHHHHHHH--HhhccCcccccccCCCCCCCccceeccCCCCCCCCCccc--ccccccceechhhh
Confidence            34667888876544333333221  12             111223477777777543311110  11223359999999


Q ss_pred             CCccChhHHHHHHHhhcccc
Q psy10075        326 FSCTSNTDLLEHVQTNHIIV  345 (373)
Q Consensus       326 ~~f~~~~~l~~H~~~~H~~~  345 (373)
                      ..|-..-+...|...|-.+.
T Consensus       396 ~~FC~dCdvfiHe~Lh~C~g  415 (421)
T COG5151         396 STFCSDCDVFIHETLHFCIG  415 (421)
T ss_pred             hhhhhhhHHHHHHHHhhCCC
Confidence            99999888888888775443


No 127
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=55.61  E-value=7.6  Score=23.63  Aligned_cols=26  Identities=23%  Similarity=0.409  Sum_probs=12.7

Q ss_pred             CcceecCCCCccccChhhHhhccccC
Q psy10075         23 SYNFICILCNYHAENFENIYLHLPSH   48 (373)
Q Consensus        23 ~~~~~C~~C~~~f~~~~~l~~H~~~h   48 (373)
                      ...|.|+.|+..|=-.-++..|..+|
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiHE~LH   44 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIHETLH   44 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTTTTS-
T ss_pred             CCeEECCCCCCccccCcChhhhcccc
Confidence            35677777777776666666665555


No 128
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=55.13  E-value=7.4  Score=19.88  Aligned_cols=8  Identities=25%  Similarity=1.099  Sum_probs=4.3

Q ss_pred             CCCCCCCc
Q psy10075        321 CGSCNFSC  328 (373)
Q Consensus       321 C~~C~~~f  328 (373)
                      |+.||+.|
T Consensus        17 Cp~CG~~F   24 (26)
T PF10571_consen   17 CPHCGYDF   24 (26)
T ss_pred             CCCCCCCC
Confidence            55555554


No 129
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=54.94  E-value=8  Score=27.10  Aligned_cols=14  Identities=29%  Similarity=0.781  Sum_probs=8.1

Q ss_pred             CeecCCCCccccCh
Q psy10075        261 PFTCEHCDSKFCKK  274 (373)
Q Consensus       261 ~~~C~~C~~~f~~~  274 (373)
                      |++|..||..|..-
T Consensus         2 pH~CtrCG~vf~~g   15 (112)
T COG3364           2 PHQCTRCGEVFDDG   15 (112)
T ss_pred             Cceecccccccccc
Confidence            34566666666553


No 130
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=53.93  E-value=12  Score=20.89  Aligned_cols=8  Identities=25%  Similarity=1.082  Sum_probs=3.4

Q ss_pred             cCCCCccc
Q psy10075        264 CEHCDSKF  271 (373)
Q Consensus       264 C~~C~~~f  271 (373)
                      |+.||..|
T Consensus         4 C~~Cg~~Y   11 (36)
T PF05191_consen    4 CPKCGRIY   11 (36)
T ss_dssp             ETTTTEEE
T ss_pred             cCCCCCcc
Confidence            44444443


No 131
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=53.82  E-value=3.1  Score=23.68  Aligned_cols=10  Identities=30%  Similarity=0.962  Sum_probs=6.9

Q ss_pred             ccCCCCCCCc
Q psy10075        319 YFCGSCNFSC  328 (373)
Q Consensus       319 ~~C~~C~~~f  328 (373)
                      |.|..|+..|
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            7777777654


No 132
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=51.86  E-value=8.6  Score=22.75  Aligned_cols=9  Identities=33%  Similarity=1.010  Sum_probs=4.4

Q ss_pred             cccCCCCCC
Q psy10075        318 KYFCGSCNF  326 (373)
Q Consensus       318 ~~~C~~C~~  326 (373)
                      .|+|..|++
T Consensus        37 ~~~C~~C~~   45 (46)
T PF12760_consen   37 RYRCKACRK   45 (46)
T ss_pred             eEECCCCCC
Confidence            355555543


No 133
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=51.44  E-value=7  Score=22.54  Aligned_cols=24  Identities=25%  Similarity=0.290  Sum_probs=14.7

Q ss_pred             ceecCCCCccc--cChhhHhhccccC
Q psy10075         25 NFICILCNYHA--ENFENIYLHLPSH   48 (373)
Q Consensus        25 ~~~C~~C~~~f--~~~~~l~~H~~~h   48 (373)
                      ...|+.||++|  ...++-..|.+-|
T Consensus        13 ~~~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   13 ATTCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             CcCCCCCCCEECCCCHHHHHHHHHHH
Confidence            45788888877  3344555555444


No 134
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=48.40  E-value=8.9  Score=26.50  Aligned_cols=33  Identities=18%  Similarity=0.564  Sum_probs=19.6

Q ss_pred             ccceecCCCcccccChHHHhhhhhccCCCCCCCCeecCCCCccccC
Q psy10075        228 EAEYHCTYCDYICSSRTILKSHINKKHANDEDKPFTCEHCDSKFCK  273 (373)
Q Consensus       228 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~C~~C~~~f~~  273 (373)
                      ...|.|+.|++.-.             ...+...+.|..|++.|..
T Consensus        34 ~a~y~CpfCgk~~v-------------kR~a~GIW~C~~C~~~~AG   66 (90)
T PTZ00255         34 HAKYFCPFCGKHAV-------------KRQAVGIWRCKGCKKTVAG   66 (90)
T ss_pred             hCCccCCCCCCCce-------------eeeeeEEEEcCCCCCEEeC
Confidence            35688888875311             1112345788888887765


No 135
>KOG2907|consensus
Probab=47.58  E-value=10  Score=27.23  Aligned_cols=10  Identities=40%  Similarity=1.221  Sum_probs=5.2

Q ss_pred             ccCCCCcccc
Q psy10075        291 FKCSFCEYKC  300 (373)
Q Consensus       291 ~~C~~C~~~f  300 (373)
                      |.|+.|++.|
T Consensus       103 YTC~kC~~k~  112 (116)
T KOG2907|consen  103 YTCPKCKYKF  112 (116)
T ss_pred             EEcCccceee
Confidence            4555555544


No 136
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=47.18  E-value=12  Score=22.77  Aligned_cols=10  Identities=30%  Similarity=1.016  Sum_probs=5.1

Q ss_pred             CccCCCCccc
Q psy10075        290 PFKCSFCEYK  299 (373)
Q Consensus       290 ~~~C~~C~~~  299 (373)
                      .+.|+.||+.
T Consensus        37 r~~C~~Cgyt   46 (50)
T PRK00432         37 RWHCGKCGYT   46 (50)
T ss_pred             cEECCCcCCE
Confidence            3455555543


No 137
>PF14369 zf-RING_3:  zinc-finger
Probab=47.10  E-value=12  Score=20.67  Aligned_cols=8  Identities=38%  Similarity=1.161  Sum_probs=4.0

Q ss_pred             cCcccccc
Q psy10075         85 CSLCDSTF   92 (373)
Q Consensus        85 C~~C~~~f   92 (373)
                      |+.|+..|
T Consensus        24 CP~C~~gF   31 (35)
T PF14369_consen   24 CPRCHGGF   31 (35)
T ss_pred             CcCCCCcE
Confidence            55555444


No 138
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=46.75  E-value=11  Score=26.83  Aligned_cols=27  Identities=4%  Similarity=-0.097  Sum_probs=16.3

Q ss_pred             ecCCCcccccChHHHhhhhhccCCCCCCCCeecCCCCcccc
Q psy10075        232 HCTYCDYICSSRTILKSHINKKHANDEDKPFTCEHCDSKFC  272 (373)
Q Consensus       232 ~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~C~~C~~~f~  272 (373)
                      .|+.||+.|...              +..|..|+.||++|.
T Consensus        11 idPetg~KFYDL--------------NrdPiVsPytG~s~P   37 (129)
T COG4530          11 IDPETGKKFYDL--------------NRDPIVSPYTGKSYP   37 (129)
T ss_pred             cCccccchhhcc--------------CCCccccCcccccch
Confidence            566666666441              145667777777773


No 139
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=46.35  E-value=13  Score=19.34  Aligned_cols=19  Identities=26%  Similarity=0.448  Sum_probs=11.0

Q ss_pred             eecCCCCccccChhhHhhcc
Q psy10075         26 FICILCNYHAENFENIYLHL   45 (373)
Q Consensus        26 ~~C~~C~~~f~~~~~l~~H~   45 (373)
                      |.|..|++.| .......|.
T Consensus         1 ~sCiDC~~~F-~~~~y~~Ht   19 (28)
T PF08790_consen    1 FSCIDCSKDF-DGDSYKSHT   19 (28)
T ss_dssp             EEETTTTEEE-EGGGTTT--
T ss_pred             CeeecCCCCc-CcCCcCCCC
Confidence            5677788888 334555553


No 140
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=46.08  E-value=13  Score=27.30  Aligned_cols=41  Identities=15%  Similarity=0.298  Sum_probs=23.6

Q ss_pred             hhhhhcccccceeecCCCCcceecCCCCccccChhhHhhccccCCCCCccccCcCcc
Q psy10075          5 DEILNHSRECAFVSRLDDSYNFICILCNYHAENFENIYLHLPSHFEQKLFSCDLCEY   61 (373)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~   61 (373)
                      +.++.++.|.-    ..-...+.|..|+..|.....            .+.|+.|+-
T Consensus        54 ~t~~ega~L~I----~~~p~~~~C~~Cg~~~~~~~~------------~~~CP~Cgs   94 (115)
T TIGR00100        54 GTVAEGAKLNI----EDEPVECECEDCSEEVSPEID------------LYRCPKCHG   94 (115)
T ss_pred             CCccCCCEEEE----EeeCcEEEcccCCCEEecCCc------------CccCcCCcC
Confidence            34445554443    223346788888877766432            356888873


No 141
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=45.69  E-value=11  Score=21.04  Aligned_cols=29  Identities=28%  Similarity=0.661  Sum_probs=15.2

Q ss_pred             cCCCCcccccchhhhhhhhhhccCCCcccCCCC
Q psy10075        292 KCSFCEYKCTTKFGLKSHVTRIHSNQKYFCGSC  324 (373)
Q Consensus       292 ~C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~~C  324 (373)
                      .|+.|+..    ..+..|=+...+.++|.|..|
T Consensus         7 ~CP~C~s~----~~v~k~G~~~~G~qryrC~~C   35 (36)
T PF03811_consen    7 HCPRCQST----EGVKKNGKSPSGHQRYRCKDC   35 (36)
T ss_pred             eCCCCCCC----CcceeCCCCCCCCEeEecCcC
Confidence            46666443    223444434444556777766


No 142
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=44.79  E-value=12  Score=27.33  Aligned_cols=41  Identities=12%  Similarity=0.153  Sum_probs=24.4

Q ss_pred             hhhhhcccccceeecCCCCcceecCCCCccccChhhHhhccccCCCCCccccCcCcc
Q psy10075          5 DEILNHSRECAFVSRLDDSYNFICILCNYHAENFENIYLHLPSHFEQKLFSCDLCEY   61 (373)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~   61 (373)
                      |+++.++.|....    -...+.|..|+..|....            ..+.|+.|+.
T Consensus        54 ~T~~egA~L~I~~----vp~~~~C~~Cg~~~~~~~------------~~~~CP~Cgs   94 (113)
T PRK12380         54 GTVAQGCDLHIVY----KPAQAWCWDCSQVVEIHQ------------HDAQCPHCHG   94 (113)
T ss_pred             CCccCCCEEEEEe----eCcEEEcccCCCEEecCC------------cCccCcCCCC
Confidence            3455555554422    334678888887776643            2346888873


No 143
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=44.58  E-value=13  Score=18.58  Aligned_cols=11  Identities=27%  Similarity=0.800  Sum_probs=8.9

Q ss_pred             CcceecCCCCc
Q psy10075         23 SYNFICILCNY   33 (373)
Q Consensus        23 ~~~~~C~~C~~   33 (373)
                      ..+|.|+.||.
T Consensus        14 ~v~f~CPnCG~   24 (24)
T PF07754_consen   14 AVPFPCPNCGF   24 (24)
T ss_pred             CceEeCCCCCC
Confidence            56799999984


No 144
>KOG3408|consensus
Probab=44.55  E-value=10  Score=27.60  Aligned_cols=26  Identities=19%  Similarity=0.354  Sum_probs=20.6

Q ss_pred             CCcceecCCCCccccChhhHhhcccc
Q psy10075         22 DSYNFICILCNYHAENFENIYLHLPS   47 (373)
Q Consensus        22 ~~~~~~C~~C~~~f~~~~~l~~H~~~   47 (373)
                      +.+.|-|-+|.+.|.+...|..|.+.
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhc
Confidence            56778888888888888888888654


No 145
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=44.47  E-value=10  Score=26.60  Aligned_cols=37  Identities=14%  Similarity=0.257  Sum_probs=18.7

Q ss_pred             CcceecCCCCccccChhhHhhccccCCCCCccccCcCcccc
Q psy10075         23 SYNFICILCNYHAENFENIYLHLPSHFEQKLFSCDLCEYQT   63 (373)
Q Consensus        23 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f   63 (373)
                      ++.|.|+.||..-.+...+    +.-.......|..||..|
T Consensus        20 ~k~FtCp~Cghe~vs~ctv----kk~~~~g~~~Cg~CGls~   56 (104)
T COG4888          20 PKTFTCPRCGHEKVSSCTV----KKTVNIGTAVCGNCGLSF   56 (104)
T ss_pred             CceEecCccCCeeeeEEEE----EecCceeEEEcccCcceE
Confidence            3456677777655443332    222223345566666554


No 146
>KOG2593|consensus
Probab=44.44  E-value=17  Score=32.95  Aligned_cols=36  Identities=11%  Similarity=0.301  Sum_probs=17.9

Q ss_pred             CCccccCcCcccccchHHHHHHhhhhhccCCccccCcccc
Q psy10075         51 QKLFSCDLCEYQTNTKIYIRRHMLKIHLRQRNLECSLCDS   90 (373)
Q Consensus        51 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~   90 (373)
                      ...|.|+.|.++|.....++.-    -.....|.|..|+.
T Consensus       126 ~~~Y~Cp~C~kkyt~Lea~~L~----~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  126 VAGYVCPNCQKKYTSLEALQLL----DNETGEFHCENCGG  161 (436)
T ss_pred             cccccCCccccchhhhHHHHhh----cccCceEEEecCCC
Confidence            3446666666666554444432    11234456666654


No 147
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=43.97  E-value=17  Score=27.50  Aligned_cols=16  Identities=13%  Similarity=0.065  Sum_probs=11.9

Q ss_pred             CcceecCCCCccccCh
Q psy10075         23 SYNFICILCNYHAENF   38 (373)
Q Consensus        23 ~~~~~C~~C~~~f~~~   38 (373)
                      ...+.|..||..|...
T Consensus        68 p~~~~C~~CG~~~~~~   83 (135)
T PRK03824         68 EAVLKCRNCGNEWSLK   83 (135)
T ss_pred             ceEEECCCCCCEEecc
Confidence            3568888998888654


No 148
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=43.92  E-value=5.4  Score=26.32  Aligned_cols=12  Identities=8%  Similarity=0.207  Sum_probs=5.9

Q ss_pred             ceecCCCccccc
Q psy10075        230 EYHCTYCDYICS  241 (373)
Q Consensus       230 ~~~C~~C~~~f~  241 (373)
                      .+.++-|++.|.
T Consensus        10 ~~~~~cC~~~y~   21 (71)
T PF05495_consen   10 AIRFPCCGKYYP   21 (71)
T ss_dssp             EEEETTTTEEES
T ss_pred             EEECCcccCeec
Confidence            344555555443


No 149
>KOG2593|consensus
Probab=43.60  E-value=11  Score=34.25  Aligned_cols=42  Identities=19%  Similarity=0.398  Sum_probs=31.0

Q ss_pred             ecCCCCcceecCCCCccccChhhHhhccccCCCCCccccCcCccc
Q psy10075         18 SRLDDSYNFICILCNYHAENFENIYLHLPSHFEQKLFSCDLCEYQ   62 (373)
Q Consensus        18 ~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~   62 (373)
                      +..+.-.-|.|+.|++.|...+++..   .-.....|.|..|+-.
T Consensus       121 ~d~t~~~~Y~Cp~C~kkyt~Lea~~L---~~~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  121 RDDTNVAGYVCPNCQKKYTSLEALQL---LDNETGEFHCENCGGE  162 (436)
T ss_pred             hhccccccccCCccccchhhhHHHHh---hcccCceEEEecCCCc
Confidence            34445567999999999999887743   3334567999999843


No 150
>KOG2272|consensus
Probab=43.45  E-value=17  Score=30.17  Aligned_cols=18  Identities=17%  Similarity=0.394  Sum_probs=11.7

Q ss_pred             CcccCCCCccccChHHHH
Q psy10075        111 PFSCNFCDYKSKTKYDIT  128 (373)
Q Consensus       111 ~~~C~~C~~~f~~~~~l~  128 (373)
                      -|.|+.|++.+.+...+.
T Consensus        99 CF~Cd~Cn~~Lad~gf~r  116 (332)
T KOG2272|consen   99 CFRCDLCNKHLADQGFYR  116 (332)
T ss_pred             cchhHHHHHHHhhhhhHh
Confidence            477888877766555443


No 151
>KOG2807|consensus
Probab=43.45  E-value=39  Score=29.50  Aligned_cols=25  Identities=24%  Similarity=0.506  Sum_probs=20.1

Q ss_pred             cccCCCCCCCccChhHHHHHHHhhc
Q psy10075        318 KYFCGSCNFSCTSNTDLLEHVQTNH  342 (373)
Q Consensus       318 ~~~C~~C~~~f~~~~~l~~H~~~~H  342 (373)
                      .|+|..|...|-..=+...|-..|-
T Consensus       345 ~y~C~~Ck~~FCldCDv~iHesLh~  369 (378)
T KOG2807|consen  345 RYRCESCKNVFCLDCDVFIHESLHN  369 (378)
T ss_pred             cEEchhccceeeccchHHHHhhhhc
Confidence            4899999999988888888876663


No 152
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=43.25  E-value=9.6  Score=26.37  Aligned_cols=33  Identities=27%  Similarity=0.695  Sum_probs=19.3

Q ss_pred             cceecCCCcccccChHHHhhhhhccCCCCCCCCeecCCCCccccCh
Q psy10075        229 AEYHCTYCDYICSSRTILKSHINKKHANDEDKPFTCEHCDSKFCKK  274 (373)
Q Consensus       229 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~C~~C~~~f~~~  274 (373)
                      ..|.|+.|++.-..             ..+...+.|..|++.|..-
T Consensus        34 a~y~CpfCgk~~vk-------------R~a~GIW~C~~C~~~~AGG   66 (91)
T TIGR00280        34 AKYVCPFCGKKTVK-------------RGSTGIWTCRKCGAKFAGG   66 (91)
T ss_pred             cCccCCCCCCCceE-------------EEeeEEEEcCCCCCEEeCC
Confidence            45788888753110             1123457788888877653


No 153
>KOG4124|consensus
Probab=42.04  E-value=7.6  Score=33.90  Aligned_cols=70  Identities=24%  Similarity=0.408  Sum_probs=39.6

Q ss_pred             CCCeecCC--CCccccChhHHHHhhhhhccCCCCccCCCCcccccchhhhhhhhhhccCCCcccCCCCCCCccChhHHHH
Q psy10075        259 DKPFTCEH--CDSKFCKKYDMKMHMSRAHYGLKPFKCSFCEYKCTTKFGLKSHVTRIHSNQKYFCGSCNFSCTSNTDLLE  336 (373)
Q Consensus       259 ~~~~~C~~--C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~~C~~~f~~~~~l~~  336 (373)
                      .++|.|++  |.+.+++...|..|-...|...-          -.-...=+-|....-.+++|+|++|.+.+.....|.-
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i----------~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~  416 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPI----------TTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKY  416 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccccCcCCCC----------CCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCc
Confidence            47788855  99999888888888644443221          0111122233333333455777777777666555544


Q ss_pred             HH
Q psy10075        337 HV  338 (373)
Q Consensus       337 H~  338 (373)
                      |.
T Consensus       417 ~~  418 (442)
T KOG4124|consen  417 HR  418 (442)
T ss_pred             ee
Confidence            43


No 154
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=41.82  E-value=14  Score=27.74  Aligned_cols=27  Identities=22%  Similarity=0.428  Sum_probs=16.8

Q ss_pred             CCcccCCCCCCCccChhHHHHHHHhhcccc
Q psy10075        316 NQKYFCGSCNFSCTSNTDLLEHVQTNHIIV  345 (373)
Q Consensus       316 ~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~  345 (373)
                      .....|-.||+.|..   |..|+++||++.
T Consensus        70 ~d~i~clecGk~~k~---LkrHL~~~~glt   96 (132)
T PF05443_consen   70 PDYIICLECGKKFKT---LKRHLRTHHGLT   96 (132)
T ss_dssp             SS-EE-TBT--EESB---HHHHHHHTT-S-
T ss_pred             cCeeEEccCCcccch---HHHHHHHccCCC
Confidence            344789999998886   589999998855


No 155
>KOG2807|consensus
Probab=41.71  E-value=49  Score=28.92  Aligned_cols=32  Identities=19%  Similarity=0.493  Sum_probs=22.5

Q ss_pred             ccceecCCCcccccChHHHhhhhhccCCCCCCCCeecCCCC
Q psy10075        228 EAEYHCTYCDYICSSRTILKSHINKKHANDEDKPFTCEHCD  268 (373)
Q Consensus       228 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~C~~C~  268 (373)
                      ...|.|+.|...|-..-+...|-         ....|+-|.
T Consensus       343 ~~~y~C~~Ck~~FCldCDv~iHe---------sLh~CpgCe  374 (378)
T KOG2807|consen  343 SGRYRCESCKNVFCLDCDVFIHE---------SLHNCPGCE  374 (378)
T ss_pred             CCcEEchhccceeeccchHHHHh---------hhhcCCCcC
Confidence            45688888888888777777773         334566664


No 156
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=41.44  E-value=14  Score=22.80  Aligned_cols=31  Identities=26%  Similarity=0.433  Sum_probs=17.4

Q ss_pred             ceecCCCCccccChhhHhhccccCCCCCccccCcCcccc
Q psy10075         25 NFICILCNYHAENFENIYLHLPSHFEQKLFSCDLCEYQT   63 (373)
Q Consensus        25 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f   63 (373)
                      .+.|+.|+..+.-....       .+ ....|+.||-.+
T Consensus         2 ~~~CP~CG~~iev~~~~-------~G-eiV~Cp~CGael   32 (54)
T TIGR01206         2 QFECPDCGAEIELENPE-------LG-ELVICDECGAEL   32 (54)
T ss_pred             ccCCCCCCCEEecCCCc-------cC-CEEeCCCCCCEE
Confidence            35788888766443221       12 245777777544


No 157
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=41.43  E-value=19  Score=25.41  Aligned_cols=26  Identities=12%  Similarity=0.043  Sum_probs=16.5

Q ss_pred             ccccceeecCCCCcceecCCCCccccC
Q psy10075         11 SRECAFVSRLDDSYNFICILCNYHAEN   37 (373)
Q Consensus        11 ~~~~~~~~~~~~~~~~~C~~C~~~f~~   37 (373)
                      ++...+++.+.+ ++..|++||..|.-
T Consensus        66 ~h~v~W~~l~~g-~~~rC~eCG~~fkL   91 (97)
T cd00924          66 SHDVIWMWLEKG-KPKRCPECGHVFKL   91 (97)
T ss_pred             CceEEEEEEeCC-CceeCCCCCcEEEE
Confidence            344456666655 57777777777743


No 158
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=41.29  E-value=8  Score=34.34  Aligned_cols=58  Identities=28%  Similarity=0.403  Sum_probs=24.5

Q ss_pred             CCeecCCCCccccChhHHH---Hhhhhhcc-CCCCccCCCCcccccchhhhhhhhhhccCCCcccCCCCCCC
Q psy10075        260 KPFTCEHCDSKFCKKYDMK---MHMSRAHY-GLKPFKCSFCEYKCTTKFGLKSHVTRIHSNQKYFCGSCNFS  327 (373)
Q Consensus       260 ~~~~C~~C~~~f~~~~~L~---~H~~~~H~-~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~~C~~~  327 (373)
                      +.+.|..|.+++......-   .|....|. ..+.|+|+.|+++..+...|-.          -.|..||-.
T Consensus       251 kav~C~~C~yt~~~~~~~C~~~~H~l~~~~a~KRFFkC~~C~~Rt~sl~r~P~----------~~C~~Cg~~  312 (344)
T PF09332_consen  251 KAVTCKQCKYTAFKPSDRCKEEGHPLKWHDAVKRFFKCKDCGNRTISLERLPK----------KHCSNCGSS  312 (344)
T ss_dssp             EEEEETTT--EESS--HHHHHTT--EEEEEEE-EEEE-T-TS-EEEESSSS------------S--TTT-S-
T ss_pred             EEEEcCCCCCcccCcchhHHhcCCceEEeeeeeeeEECCCCCCeeeecccCCC----------CCCCcCCcC
Confidence            4478888887665554443   23322232 3345889999888665433322          248888754


No 159
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=40.94  E-value=38  Score=29.86  Aligned_cols=21  Identities=14%  Similarity=0.398  Sum_probs=16.0

Q ss_pred             CcccccccccccCHHHHHHHH
Q psy10075        141 PHKCTICESTYLTKVELKNHI  161 (373)
Q Consensus       141 ~~~C~~C~~~f~~~~~l~~H~  161 (373)
                      .+-|+.|++.|.....+..|+
T Consensus       238 ~~YC~~C~r~f~~~~VFe~Hl  258 (470)
T COG5188         238 KVYCVKCGREFSRSKVFEYHL  258 (470)
T ss_pred             ceeeHhhhhHhhhhHHHHHHH
Confidence            356888888888877777776


No 160
>PRK04023 DNA polymerase II large subunit; Validated
Probab=40.45  E-value=34  Score=35.01  Aligned_cols=11  Identities=27%  Similarity=0.377  Sum_probs=7.0

Q ss_pred             ccCCCCCCCcc
Q psy10075        319 YFCGSCNFSCT  329 (373)
Q Consensus       319 ~~C~~C~~~f~  329 (373)
                      |.|+.|+..-.
T Consensus       664 y~CPKCG~El~  674 (1121)
T PRK04023        664 DECEKCGREPT  674 (1121)
T ss_pred             CcCCCCCCCCC
Confidence            56777775444


No 161
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=40.41  E-value=14  Score=18.13  Aligned_cols=9  Identities=33%  Similarity=0.696  Sum_probs=4.3

Q ss_pred             cCCCCcccc
Q psy10075         28 CILCNYHAE   36 (373)
Q Consensus        28 C~~C~~~f~   36 (373)
                      |+.||....
T Consensus         2 Cp~CG~~~~   10 (23)
T PF13240_consen    2 CPNCGAEIE   10 (23)
T ss_pred             CcccCCCCC
Confidence            445554443


No 162
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=39.80  E-value=21  Score=35.46  Aligned_cols=47  Identities=28%  Similarity=0.553  Sum_probs=29.2

Q ss_pred             ceecCCCCccccCh---hhHhhccccCCCCCccccCcCcccccchHHHHHHhhhhhccCCccccCccccc
Q psy10075         25 NFICILCNYHAENF---ENIYLHLPSHFEQKLFSCDLCEYQTNTKIYIRRHMLKIHLRQRNLECSLCDST   91 (373)
Q Consensus        25 ~~~C~~C~~~f~~~---~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~   91 (373)
                      .+.|..||..+.-.   ..|..|    ...+...|.+||.                ....|..|+.||..
T Consensus       435 ~l~C~~Cg~v~~Cp~Cd~~lt~H----~~~~~L~CH~Cg~----------------~~~~p~~Cp~Cgs~  484 (730)
T COG1198         435 LLLCRDCGYIAECPNCDSPLTLH----KATGQLRCHYCGY----------------QEPIPQSCPECGSE  484 (730)
T ss_pred             eeecccCCCcccCCCCCcceEEe----cCCCeeEeCCCCC----------------CCCCCCCCCCCCCC
Confidence            35688888777443   234344    3345678888882                24557788888764


No 163
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=39.70  E-value=8.9  Score=26.49  Aligned_cols=11  Identities=18%  Similarity=0.736  Sum_probs=5.2

Q ss_pred             ccccCcCcccc
Q psy10075         53 LFSCDLCEYQT   63 (373)
Q Consensus        53 ~~~C~~C~~~f   63 (373)
                      .+.|..|++.|
T Consensus        53 IW~C~~C~~~~   63 (90)
T PF01780_consen   53 IWKCKKCGKKF   63 (90)
T ss_dssp             EEEETTTTEEE
T ss_pred             EeecCCCCCEE
Confidence            34455555444


No 164
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=38.86  E-value=39  Score=35.55  Aligned_cols=29  Identities=21%  Similarity=0.466  Sum_probs=16.5

Q ss_pred             CccCCCCcccccchhhhhhhhhhccCCCcccCCCCCCCcc
Q psy10075        290 PFKCSFCEYKCTTKFGLKSHVTRIHSNQKYFCGSCNFSCT  329 (373)
Q Consensus       290 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~~C~~~f~  329 (373)
                      +|.|+.||.......          .+ ...|+.|+....
T Consensus       692 vy~CPsCGaev~~de----------s~-a~~CP~CGtplv  720 (1337)
T PRK14714        692 VYVCPDCGAEVPPDE----------SG-RVECPRCDVELT  720 (1337)
T ss_pred             ceeCccCCCccCCCc----------cc-cccCCCCCCccc
Confidence            567888887643211          11 345888885443


No 165
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=38.62  E-value=14  Score=27.05  Aligned_cols=27  Identities=30%  Similarity=0.342  Sum_probs=15.9

Q ss_pred             cceecCCCCccccChhhHhhccccCCCCCccccCcCccc
Q psy10075         24 YNFICILCNYHAENFENIYLHLPSHFEQKLFSCDLCEYQ   62 (373)
Q Consensus        24 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~   62 (373)
                      ..+.|..|+..|.-....            +.|+.|+..
T Consensus        69 ~~~~C~~Cg~~~~~~~~~------------~~CP~Cgs~   95 (113)
T PF01155_consen   69 ARARCRDCGHEFEPDEFD------------FSCPRCGSP   95 (113)
T ss_dssp             -EEEETTTS-EEECHHCC------------HH-SSSSSS
T ss_pred             CcEECCCCCCEEecCCCC------------CCCcCCcCC
Confidence            357788888888765321            458888743


No 166
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=38.45  E-value=11  Score=36.55  Aligned_cols=55  Identities=18%  Similarity=0.391  Sum_probs=25.9

Q ss_pred             cCCCCccccChhhHhhccccCCCCCcc-ccCcCcccccchHHHHHHhhhhhccCCccccCcccc
Q psy10075         28 CILCNYHAENFENIYLHLPSHFEQKLF-SCDLCEYQTNTKIYIRRHMLKIHLRQRNLECSLCDS   90 (373)
Q Consensus        28 C~~C~~~f~~~~~l~~H~~~h~~~~~~-~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~   90 (373)
                      |..||-.|+-.++|= -=+..+....| .|+.|.+.+....+-+=|       ..+.-|+.||-
T Consensus       126 CT~CGPRfTIi~alP-YDR~nTsM~~F~lC~~C~~EY~dP~nRRfH-------AQp~aCp~CGP  181 (750)
T COG0068         126 CTNCGPRFTIIEALP-YDRENTSMADFPLCPFCDKEYKDPLNRRFH-------AQPIACPKCGP  181 (750)
T ss_pred             cCCCCcceeeeccCC-CCcccCccccCcCCHHHHHHhcCccccccc-------cccccCcccCC
Confidence            666666665555441 11222223333 266666555554444444       22455666654


No 167
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=38.41  E-value=19  Score=24.69  Aligned_cols=14  Identities=14%  Similarity=0.558  Sum_probs=8.8

Q ss_pred             CccccCcCcccccc
Q psy10075         52 KLFSCDLCEYQTNT   65 (373)
Q Consensus        52 ~~~~C~~C~~~f~~   65 (373)
                      .|-.|..||..|.+
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            45567777766655


No 168
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=38.19  E-value=17  Score=21.86  Aligned_cols=14  Identities=14%  Similarity=0.278  Sum_probs=11.0

Q ss_pred             CcceecCCCCcccc
Q psy10075         23 SYNFICILCNYHAE   36 (373)
Q Consensus        23 ~~~~~C~~C~~~f~   36 (373)
                      ++++.|..||..|.
T Consensus         2 Dk~l~C~dCg~~Fv   15 (49)
T PF13451_consen    2 DKTLTCKDCGAEFV   15 (49)
T ss_pred             CeeEEcccCCCeEE
Confidence            56788888888773


No 169
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=37.90  E-value=12  Score=25.81  Aligned_cols=32  Identities=22%  Similarity=0.466  Sum_probs=19.0

Q ss_pred             cceecCCCcccccChHHHhhhhhccCCCCCCCCeecCCCCccccC
Q psy10075        229 AEYHCTYCDYICSSRTILKSHINKKHANDEDKPFTCEHCDSKFCK  273 (373)
Q Consensus       229 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~C~~C~~~f~~  273 (373)
                      ..|.|+.|++.-..             ..+...+.|..|++.|..
T Consensus        35 a~y~CpfCgk~~vk-------------R~a~GIW~C~~C~~~~AG   66 (90)
T PRK03976         35 AKHVCPVCGRPKVK-------------RVGTGIWECRKCGAKFAG   66 (90)
T ss_pred             cCccCCCCCCCceE-------------EEEEEEEEcCCCCCEEeC
Confidence            45788888653111             112345778888887765


No 170
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=37.32  E-value=33  Score=21.47  Aligned_cols=32  Identities=16%  Similarity=0.401  Sum_probs=14.0

Q ss_pred             CCCeecCCCCccccChhHHHHhhhhhccCCCCccCCC
Q psy10075        259 DKPFTCEHCDSKFCKKYDMKMHMSRAHYGLKPFKCSF  295 (373)
Q Consensus       259 ~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~  295 (373)
                      +.|++...|+.+|...+.+.. +    ......+|+.
T Consensus        22 ~~PV~s~~C~H~fek~aI~~~-i----~~~~~~~CPv   53 (57)
T PF11789_consen   22 EDPVKSKKCGHTFEKEAILQY-I----QRNGSKRCPV   53 (57)
T ss_dssp             SSEEEESSS--EEEHHHHHHH-C----TTTS-EE-SC
T ss_pred             hCCcCcCCCCCeecHHHHHHH-H----HhcCCCCCCC
Confidence            446666667766655443332 2    2234455655


No 171
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=37.03  E-value=20  Score=20.48  Aligned_cols=17  Identities=24%  Similarity=0.278  Sum_probs=9.7

Q ss_pred             ccCCCCCCCccChhHHH
Q psy10075        319 YFCGSCNFSCTSNTDLL  335 (373)
Q Consensus       319 ~~C~~C~~~f~~~~~l~  335 (373)
                      +.|+.|+=.|.....|.
T Consensus        20 d~C~~C~G~W~d~~el~   36 (41)
T PF13453_consen   20 DVCPSCGGIWFDAGELE   36 (41)
T ss_pred             EECCCCCeEEccHHHHH
Confidence            56666665555554443


No 172
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=36.66  E-value=11  Score=22.45  Aligned_cols=36  Identities=14%  Similarity=0.380  Sum_probs=17.1

Q ss_pred             CCCCcccccchhhhhhhhhhccCCCcccCCC--CCCCccC
Q psy10075        293 CSFCEYKCTTKFGLKSHVTRIHSNQKYFCGS--CNFSCTS  330 (373)
Q Consensus       293 C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~~--C~~~f~~  330 (373)
                      ||.||.......+-..+.  .-.+..|+|..  ||..|..
T Consensus         2 CP~Cg~~a~ir~S~~~s~--~~~~~Y~qC~N~~Cg~tfv~   39 (47)
T PF04606_consen    2 CPHCGSKARIRTSRQLSP--LTRELYCQCTNPECGHTFVA   39 (47)
T ss_pred             cCCCCCeeEEEEchhhCc--ceEEEEEEECCCcCCCEEEE
Confidence            666766544333222221  11112367776  7766653


No 173
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=36.61  E-value=24  Score=30.98  Aligned_cols=27  Identities=11%  Similarity=0.324  Sum_probs=19.2

Q ss_pred             ccCCCcccCCCCC-CCccChhHHHHHHH
Q psy10075        313 IHSNQKYFCGSCN-FSCTSNTDLLEHVQ  339 (373)
Q Consensus       313 ~h~~~~~~C~~C~-~~f~~~~~l~~H~~  339 (373)
                      |.-+..|.|.+|| +.+.-...+..|..
T Consensus       369 hgLd~ef~CEICgNyvy~GR~~FdrHF~  396 (470)
T COG5188         369 HGLDIEFECEICGNYVYYGRDRFDRHFE  396 (470)
T ss_pred             cCCCcceeeeecccccccchHHHHhhhh
Confidence            3334458899998 77777777777755


No 174
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=36.51  E-value=18  Score=27.22  Aligned_cols=15  Identities=40%  Similarity=0.778  Sum_probs=9.9

Q ss_pred             CCcccCCCCCCCccC
Q psy10075        316 NQKYFCGSCNFSCTS  330 (373)
Q Consensus       316 ~~~~~C~~C~~~f~~  330 (373)
                      .++|+|+.|++.|..
T Consensus        51 ~qRyrC~~C~~tf~~   65 (129)
T COG3677          51 HQRYKCKSCGSTFTV   65 (129)
T ss_pred             ccccccCCcCcceee
Confidence            345777777777764


No 175
>PRK04023 DNA polymerase II large subunit; Validated
Probab=36.46  E-value=32  Score=35.17  Aligned_cols=10  Identities=30%  Similarity=0.664  Sum_probs=5.1

Q ss_pred             eecCCCCccc
Q psy10075        262 FTCEHCDSKF  271 (373)
Q Consensus       262 ~~C~~C~~~f  271 (373)
                      +.|+.||..-
T Consensus       664 y~CPKCG~El  673 (1121)
T PRK04023        664 DECEKCGREP  673 (1121)
T ss_pred             CcCCCCCCCC
Confidence            4455555433


No 176
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=36.20  E-value=17  Score=27.77  Aligned_cols=18  Identities=17%  Similarity=0.060  Sum_probs=13.2

Q ss_pred             ccCCCCCCCccChhHHHH
Q psy10075        319 YFCGSCNFSCTSNTDLLE  336 (373)
Q Consensus       319 ~~C~~C~~~f~~~~~l~~  336 (373)
                      -.|..|++.|++...+..
T Consensus        29 ReC~~C~~RFTTyErve~   46 (147)
T TIGR00244        29 RECLECHERFTTFERAEL   46 (147)
T ss_pred             ccCCccCCccceeeeccc
Confidence            678888888887765443


No 177
>KOG3507|consensus
Probab=36.18  E-value=26  Score=21.84  Aligned_cols=11  Identities=18%  Similarity=0.733  Sum_probs=6.0

Q ss_pred             CCeecCCCCcc
Q psy10075        260 KPFTCEHCDSK  270 (373)
Q Consensus       260 ~~~~C~~C~~~  270 (373)
                      ..++|..||..
T Consensus        36 D~irCReCG~R   46 (62)
T KOG3507|consen   36 DVIRCRECGYR   46 (62)
T ss_pred             CcEehhhcchH
Confidence            34566666654


No 178
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=36.04  E-value=18  Score=20.94  Aligned_cols=9  Identities=22%  Similarity=0.814  Sum_probs=3.8

Q ss_pred             eecCCCCcc
Q psy10075        262 FTCEHCDSK  270 (373)
Q Consensus       262 ~~C~~C~~~  270 (373)
                      +.|+.||..
T Consensus        20 ~vC~~CG~V   28 (43)
T PF08271_consen   20 LVCPNCGLV   28 (43)
T ss_dssp             EEETTT-BB
T ss_pred             EECCCCCCE
Confidence            445555443


No 179
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=34.73  E-value=38  Score=20.38  Aligned_cols=11  Identities=27%  Similarity=0.776  Sum_probs=5.5

Q ss_pred             CeecCCCCccc
Q psy10075        261 PFTCEHCDSKF  271 (373)
Q Consensus       261 ~~~C~~C~~~f  271 (373)
                      .|.|+.||..+
T Consensus        20 ~~vC~~Cg~~~   30 (52)
T smart00661       20 RFVCRKCGYEE   30 (52)
T ss_pred             EEECCcCCCeE
Confidence            34555555444


No 180
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=34.51  E-value=19  Score=22.19  Aligned_cols=10  Identities=40%  Similarity=0.939  Sum_probs=5.6

Q ss_pred             ecCCCCcccc
Q psy10075        263 TCEHCDSKFC  272 (373)
Q Consensus       263 ~C~~C~~~f~  272 (373)
                      +|+.||+.|.
T Consensus         7 ~C~~Cg~~~~   16 (54)
T PF14446_consen    7 KCPVCGKKFK   16 (54)
T ss_pred             cChhhCCccc
Confidence            4556665554


No 181
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=34.02  E-value=5.1  Score=22.17  Aligned_cols=10  Identities=20%  Similarity=1.162  Sum_probs=4.0

Q ss_pred             eecCCCCccc
Q psy10075        262 FTCEHCDSKF  271 (373)
Q Consensus       262 ~~C~~C~~~f  271 (373)
                      ..|+.||-.+
T Consensus        22 isC~~CGPr~   31 (35)
T PF07503_consen   22 ISCTNCGPRY   31 (35)
T ss_dssp             --BTTCC-SC
T ss_pred             ccCCCCCCCE
Confidence            4566666544


No 182
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=33.65  E-value=46  Score=26.01  Aligned_cols=46  Identities=20%  Similarity=0.409  Sum_probs=22.2

Q ss_pred             eecCCCccccc--ChHHHhhhhhccCCCCCCCCeecCCCCccccChhH
Q psy10075        231 YHCTYCDYICS--SRTILKSHINKKHANDEDKPFTCEHCDSKFCKKYD  276 (373)
Q Consensus       231 ~~C~~C~~~f~--~~~~l~~H~~~~~~~~~~~~~~C~~C~~~f~~~~~  276 (373)
                      -.|+.||-...  +......-+-..+......-|.|+.||+.|-.-+.
T Consensus        98 ~RCp~CN~~L~~vs~eev~~~Vp~~~~~~~~~f~~C~~CgkiYW~GsH  145 (165)
T COG1656          98 SRCPECNGELEKVSREEVKEKVPEKVYRNYEEFYRCPKCGKIYWKGSH  145 (165)
T ss_pred             ccCcccCCEeccCcHHHHhhccchhhhhcccceeECCCCcccccCchH
Confidence            35777765433  33332222111111122445778888888755443


No 183
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=32.89  E-value=24  Score=25.86  Aligned_cols=42  Identities=10%  Similarity=0.237  Sum_probs=22.4

Q ss_pred             hhhhhcccccceeecCCCCcceecCCCCccccChhhHhhccccCCCCCccccCcCcc
Q psy10075          5 DEILNHSRECAFVSRLDDSYNFICILCNYHAENFENIYLHLPSHFEQKLFSCDLCEY   61 (373)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~   61 (373)
                      |.++.++.|.-    ..-...+.|..|+..|.....           ..+.|+.|+.
T Consensus        54 ~t~~egA~L~i----~~~p~~~~C~~Cg~~~~~~~~-----------~~~~CP~Cgs   95 (114)
T PRK03681         54 GTVAEGCKLHL----EEQEAECWCETCQQYVTLLTQ-----------RVRRCPQCHG   95 (114)
T ss_pred             CCccCCCEEEE----EeeCcEEEcccCCCeeecCCc-----------cCCcCcCcCC
Confidence            33444444443    223346778888876654321           1146888873


No 184
>PHA02998 RNA polymerase subunit; Provisional
Probab=32.46  E-value=23  Score=27.89  Aligned_cols=11  Identities=18%  Similarity=0.443  Sum_probs=5.7

Q ss_pred             ccCCCCCCCcc
Q psy10075        319 YFCGSCNFSCT  329 (373)
Q Consensus       319 ~~C~~C~~~f~  329 (373)
                      |.|..||..|.
T Consensus       172 YkC~~CG~~wk  182 (195)
T PHA02998        172 HACRDCKKHFK  182 (195)
T ss_pred             EEcCCCCCccC
Confidence            55555555443


No 185
>KOG3408|consensus
Probab=31.95  E-value=21  Score=26.09  Aligned_cols=22  Identities=27%  Similarity=0.413  Sum_probs=13.0

Q ss_pred             CCccCCCCcccccchhhhhhhh
Q psy10075        289 KPFKCSFCEYKCTTKFGLKSHV  310 (373)
Q Consensus       289 ~~~~C~~C~~~f~~~~~l~~H~  310 (373)
                      ..|.|-.|.+.|.+...|..|.
T Consensus        56 GqfyCi~CaRyFi~~~~l~~H~   77 (129)
T KOG3408|consen   56 GQFYCIECARYFIDAKALKTHF   77 (129)
T ss_pred             ceeehhhhhhhhcchHHHHHHH
Confidence            3455666666666666666655


No 186
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=31.69  E-value=28  Score=18.26  Aligned_cols=10  Identities=30%  Similarity=0.770  Sum_probs=3.5

Q ss_pred             CCeecCCCCc
Q psy10075        260 KPFTCEHCDS  269 (373)
Q Consensus       260 ~~~~C~~C~~  269 (373)
                      ..|.|..|+.
T Consensus        14 ~~Y~C~~Cdf   23 (30)
T PF07649_consen   14 WFYRCSECDF   23 (30)
T ss_dssp             -EEE-TTT--
T ss_pred             ceEECccCCC
Confidence            3456666654


No 187
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=31.56  E-value=45  Score=20.67  Aligned_cols=13  Identities=15%  Similarity=0.641  Sum_probs=9.5

Q ss_pred             cccCCCCCCCccC
Q psy10075        318 KYFCGSCNFSCTS  330 (373)
Q Consensus       318 ~~~C~~C~~~f~~  330 (373)
                      .|.|+.||..+.-
T Consensus        14 ~~~Cp~cGipthc   26 (55)
T PF13824_consen   14 NFECPDCGIPTHC   26 (55)
T ss_pred             CCcCCCCCCcCcc
Confidence            4888888877653


No 188
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=30.99  E-value=26  Score=32.61  Aligned_cols=25  Identities=20%  Similarity=0.555  Sum_probs=18.3

Q ss_pred             ccCCCCCCCccChhHHHHHHHhhcc
Q psy10075        319 YFCGSCNFSCTSNTDLLEHVQTNHI  343 (373)
Q Consensus       319 ~~C~~C~~~f~~~~~l~~H~~~~H~  343 (373)
                      ..|+.|.+.|.+...+..|+...|.
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~eH~   82 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQEHP   82 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHHhhh
Confidence            6777777777777777777776664


No 189
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=30.87  E-value=34  Score=31.87  Aligned_cols=28  Identities=14%  Similarity=0.268  Sum_probs=19.5

Q ss_pred             CcccccccccccCHHHHHHHHhhhccCC
Q psy10075        141 PHKCTICESTYLTKVELKNHILKIHQGQ  168 (373)
Q Consensus       141 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~  168 (373)
                      -+.|+.|.+.|.+...+..|+...|.+.
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            3567777777777777777776666543


No 190
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=30.78  E-value=38  Score=25.32  Aligned_cols=13  Identities=23%  Similarity=0.846  Sum_probs=7.1

Q ss_pred             cccCccccccCCc
Q psy10075         83 LECSLCDSTFSDN   95 (373)
Q Consensus        83 ~~C~~C~~~f~~~   95 (373)
                      -+||.|...|.+.
T Consensus       122 pvCPvCkTSFKss  134 (140)
T PF05290_consen  122 PVCPVCKTSFKSS  134 (140)
T ss_pred             CCCCccccccccc
Confidence            3466666555543


No 191
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=30.75  E-value=32  Score=24.61  Aligned_cols=13  Identities=23%  Similarity=0.720  Sum_probs=6.8

Q ss_pred             cccCCCCCCCccC
Q psy10075        318 KYFCGSCNFSCTS  330 (373)
Q Consensus       318 ~~~C~~C~~~f~~  330 (373)
                      .|.|+.|+..+..
T Consensus        19 ~~iCpeC~~EW~~   31 (109)
T TIGR00686        19 QLICPSCLYEWNE   31 (109)
T ss_pred             eeECccccccccc
Confidence            3555555555543


No 192
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=30.48  E-value=39  Score=20.76  Aligned_cols=15  Identities=13%  Similarity=0.656  Sum_probs=9.2

Q ss_pred             eecCCCCccccChhH
Q psy10075        262 FTCEHCDSKFCKKYD  276 (373)
Q Consensus       262 ~~C~~C~~~f~~~~~  276 (373)
                      ++|+.||..|.....
T Consensus        29 W~C~~Cgh~w~~~v~   43 (55)
T PF14311_consen   29 WKCPKCGHEWKASVN   43 (55)
T ss_pred             EECCCCCCeeEccHh
Confidence            567777766655443


No 193
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=30.29  E-value=30  Score=20.74  Aligned_cols=8  Identities=38%  Similarity=1.261  Sum_probs=3.7

Q ss_pred             ccCCCCcc
Q psy10075        291 FKCSFCEY  298 (373)
Q Consensus       291 ~~C~~C~~  298 (373)
                      +.|..||+
T Consensus        38 ~~CGkCgy   45 (51)
T COG1998          38 WACGKCGY   45 (51)
T ss_pred             eEeccccc
Confidence            44444444


No 194
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=30.23  E-value=33  Score=26.36  Aligned_cols=11  Identities=27%  Similarity=1.274  Sum_probs=5.5

Q ss_pred             CeecCCCCccc
Q psy10075        261 PFTCEHCDSKF  271 (373)
Q Consensus       261 ~~~C~~C~~~f  271 (373)
                      .|.|..|+..+
T Consensus       112 ~y~C~~C~~~~  122 (146)
T smart00731      112 PYRCTGCGQRY  122 (146)
T ss_pred             EEECCCCCCCC
Confidence            35555555443


No 195
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=29.69  E-value=7.4  Score=26.46  Aligned_cols=13  Identities=23%  Similarity=0.473  Sum_probs=7.4

Q ss_pred             ccCCCCCCCccCh
Q psy10075        319 YFCGSCNFSCTSN  331 (373)
Q Consensus       319 ~~C~~C~~~f~~~  331 (373)
                      ..|.+|+..|...
T Consensus        47 ~~C~~Cg~~~~~~   59 (81)
T PF05129_consen   47 LSCRVCGESFQTK   59 (81)
T ss_dssp             EEESSS--EEEEE
T ss_pred             EEecCCCCeEEEc
Confidence            6777777776644


No 196
>KOG1606|consensus
Probab=29.40  E-value=27  Score=28.33  Aligned_cols=30  Identities=17%  Similarity=0.232  Sum_probs=25.8

Q ss_pred             CchhhhhhhcccccceeecCCCCcceecCC
Q psy10075          1 MKQEDEILNHSRECAFVSRLDDSYNFICIL   30 (373)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~   30 (373)
                      |-++.+.|+.+++..|+.-|.-.-||.|.-
T Consensus       103 YiDESEvlt~AD~~hhI~KhnFkvPFvCG~  132 (296)
T KOG1606|consen  103 YIDESEVLTPADWDHHIEKHNFKVPFVCGC  132 (296)
T ss_pred             ccchhhhcccccccchhhhhcCcCceeecc
Confidence            457789999999999999999999998753


No 197
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=28.56  E-value=38  Score=31.01  Aligned_cols=14  Identities=21%  Similarity=0.672  Sum_probs=9.2

Q ss_pred             CccCCCCcccccch
Q psy10075        290 PFKCSFCEYKCTTK  303 (373)
Q Consensus       290 ~~~C~~C~~~f~~~  303 (373)
                      -|+|+.|++.+...
T Consensus       367 g~rC~kCg~~~~~~  380 (421)
T COG1571         367 GFRCKKCGTRARET  380 (421)
T ss_pred             CcccccccccCCcc
Confidence            57777777766543


No 198
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=28.48  E-value=22  Score=27.21  Aligned_cols=13  Identities=23%  Similarity=0.621  Sum_probs=6.1

Q ss_pred             ceecCCCCccccCh
Q psy10075         25 NFICILCNYHAENF   38 (373)
Q Consensus        25 ~~~C~~C~~~f~~~   38 (373)
                      +|.|. |+..+.++
T Consensus       117 ~Y~C~-C~q~~l~~  129 (156)
T COG3091         117 PYRCQ-CQQHYLRI  129 (156)
T ss_pred             eEEee-cCCccchh
Confidence            44455 55544443


No 199
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=28.43  E-value=47  Score=20.63  Aligned_cols=19  Identities=21%  Similarity=0.391  Sum_probs=14.0

Q ss_pred             ccCCCCcccccchhhhhhh
Q psy10075        291 FKCSFCEYKCTTKFGLKSH  309 (373)
Q Consensus       291 ~~C~~C~~~f~~~~~l~~H  309 (373)
                      +.|-+||..|.+...|..+
T Consensus        28 ~YC~~Cg~~Y~d~~dL~~~   46 (55)
T PF13821_consen   28 NYCFWCGTKYDDEEDLERN   46 (55)
T ss_pred             ceeeeeCCccCCHHHHHhC
Confidence            5678888888777777654


No 200
>COG1773 Rubredoxin [Energy production and conversion]
Probab=28.17  E-value=29  Score=21.52  Aligned_cols=13  Identities=15%  Similarity=0.552  Sum_probs=8.7

Q ss_pred             CeecCCCCccccC
Q psy10075        261 PFTCEHCDSKFCK  273 (373)
Q Consensus       261 ~~~C~~C~~~f~~  273 (373)
                      .|+|.+||..|.-
T Consensus         3 ~~~C~~CG~vYd~   15 (55)
T COG1773           3 RWRCSVCGYVYDP   15 (55)
T ss_pred             ceEecCCceEecc
Confidence            4677777777654


No 201
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=27.70  E-value=32  Score=26.35  Aligned_cols=16  Identities=19%  Similarity=0.166  Sum_probs=11.3

Q ss_pred             ccCCCCCCCccChhHH
Q psy10075        319 YFCGSCNFSCTSNTDL  334 (373)
Q Consensus       319 ~~C~~C~~~f~~~~~l  334 (373)
                      -.|+.|+..|++....
T Consensus        29 ReC~~C~~RFTTfE~~   44 (156)
T COG1327          29 RECLECGERFTTFERA   44 (156)
T ss_pred             hcccccccccchhhee
Confidence            5788888888776543


No 202
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=27.28  E-value=42  Score=32.03  Aligned_cols=34  Identities=21%  Similarity=0.463  Sum_probs=14.3

Q ss_pred             eecCCCCccccChhhHhhccccCCCCCccccCcCc
Q psy10075         26 FICILCNYHAENFENIYLHLPSHFEQKLFSCDLCE   60 (373)
Q Consensus        26 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~   60 (373)
                      +.|..||....-.. -...+..|.......|..||
T Consensus       214 ~~C~~Cg~~~~C~~-C~~~l~~h~~~~~l~Ch~Cg  247 (505)
T TIGR00595       214 LLCRSCGYILCCPN-CDVSLTYHKKEGKLRCHYCG  247 (505)
T ss_pred             eEhhhCcCccCCCC-CCCceEEecCCCeEEcCCCc
Confidence            34555555543321 11122233333445566665


No 203
>KOG1842|consensus
Probab=27.08  E-value=27  Score=31.89  Aligned_cols=30  Identities=17%  Similarity=0.299  Sum_probs=23.4

Q ss_pred             CCCeecCCCCccccChhHHHHhhhhhccCC
Q psy10075        259 DKPFTCEHCDSKFCKKYDMKMHMSRAHYGL  288 (373)
Q Consensus       259 ~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~  288 (373)
                      ...|.||+|...|.+...|..|.-..|..+
T Consensus        13 ~egflCPiC~~dl~~~~~L~~H~d~eH~~e   42 (505)
T KOG1842|consen   13 LEGFLCPICLLDLPNLSALNDHLDVEHFEE   42 (505)
T ss_pred             hhcccCchHhhhhhhHHHHHHHHhhhcccc
Confidence            456888888888888888888886667553


No 204
>PRK10220 hypothetical protein; Provisional
Probab=27.07  E-value=47  Score=23.85  Aligned_cols=12  Identities=25%  Similarity=0.838  Sum_probs=6.2

Q ss_pred             ccCCCCCCCccC
Q psy10075        319 YFCGSCNFSCTS  330 (373)
Q Consensus       319 ~~C~~C~~~f~~  330 (373)
                      |.|+.|+..|..
T Consensus        21 ~vCpeC~hEW~~   32 (111)
T PRK10220         21 YICPECAHEWND   32 (111)
T ss_pred             EECCcccCcCCc
Confidence            555555555543


No 205
>KOG4124|consensus
Probab=26.87  E-value=14  Score=32.29  Aligned_cols=24  Identities=29%  Similarity=0.527  Sum_probs=17.8

Q ss_pred             ccceecC--CCcccccChHHHhhhhh
Q psy10075        228 EAEYHCT--YCDYICSSRTILKSHIN  251 (373)
Q Consensus       228 ~~~~~C~--~C~~~f~~~~~l~~H~~  251 (373)
                      .++|.|.  .|.+.+.+...|..|..
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~  372 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKL  372 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccc
Confidence            3568885  48888888878877754


No 206
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=26.54  E-value=46  Score=27.84  Aligned_cols=16  Identities=31%  Similarity=0.721  Sum_probs=8.6

Q ss_pred             CCCceecccccccccc
Q psy10075        167 GQTRFQCSFCDRRFYF  182 (373)
Q Consensus       167 ~~~~~~C~~C~~~f~~  182 (373)
                      |.-.|.|+.|+..|+.
T Consensus       152 G~aef~C~~C~h~F~G  167 (278)
T PF15135_consen  152 GIAEFHCPKCRHNFRG  167 (278)
T ss_pred             ceeeeecccccccchh
Confidence            4445555555555553


No 207
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=26.04  E-value=31  Score=21.24  Aligned_cols=12  Identities=25%  Similarity=0.506  Sum_probs=7.1

Q ss_pred             CCeecCCCCccc
Q psy10075        260 KPFTCEHCDSKF  271 (373)
Q Consensus       260 ~~~~C~~C~~~f  271 (373)
                      .+..|++||...
T Consensus         3 ~Wi~CP~CgnKT   14 (55)
T PF14205_consen    3 EWILCPICGNKT   14 (55)
T ss_pred             eEEECCCCCCcc
Confidence            355677777543


No 208
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=25.92  E-value=7.9  Score=38.43  Aligned_cols=27  Identities=22%  Similarity=0.539  Sum_probs=13.7

Q ss_pred             CCCCcccccchhhhhhhhhhccCCCcccCCCCC
Q psy10075        293 CSFCEYKCTTKFGLKSHVTRIHSNQKYFCGSCN  325 (373)
Q Consensus       293 C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~~C~  325 (373)
                      |+.|.+.+.+..+-+.|.      ++..|+.||
T Consensus       121 C~~C~~ey~~p~~rr~h~------~~~~C~~Cg  147 (711)
T TIGR00143       121 CPDCAKEYKDPLDRRFHA------QPIACPRCG  147 (711)
T ss_pred             CHHHHHHhcCCccccCCC------CCccCCCCC
Confidence            555555555544444443      344566665


No 209
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=25.81  E-value=77  Score=20.43  Aligned_cols=10  Identities=30%  Similarity=1.062  Sum_probs=4.9

Q ss_pred             ccCCCCCCCc
Q psy10075        319 YFCGSCNFSC  328 (373)
Q Consensus       319 ~~C~~C~~~f  328 (373)
                      |.|+.||...
T Consensus        47 ~~C~~Cg~~~   56 (69)
T PF07282_consen   47 FTCPNCGFEM   56 (69)
T ss_pred             EEcCCCCCEE
Confidence            4455555443


No 210
>KOG4118|consensus
Probab=25.68  E-value=34  Score=21.82  Aligned_cols=27  Identities=15%  Similarity=0.279  Sum_probs=22.9

Q ss_pred             ccCCCCCCCccChhHHHHHHHhhcccc
Q psy10075        319 YFCGSCNFSCTSNTDLLEHVQTNHIIV  345 (373)
Q Consensus       319 ~~C~~C~~~f~~~~~l~~H~~~~H~~~  345 (373)
                      |+|.+|-...+.+..+..|..+.|++.
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~kHpk~   65 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFENKHPKE   65 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhhcCCCC
Confidence            889999988888888999988888644


No 211
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=25.62  E-value=40  Score=19.12  Aligned_cols=14  Identities=21%  Similarity=0.294  Sum_probs=11.3

Q ss_pred             ceecCCCCccccCh
Q psy10075         25 NFICILCNYHAENF   38 (373)
Q Consensus        25 ~~~C~~C~~~f~~~   38 (373)
                      ||.|..|+..|=..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            88999999988443


No 212
>KOG1842|consensus
Probab=24.93  E-value=54  Score=30.02  Aligned_cols=29  Identities=21%  Similarity=0.498  Sum_probs=21.5

Q ss_pred             ccCCCCCCCccChhHHHHHHHhhcccccc
Q psy10075        319 YFCGSCNFSCTSNTDLLEHVQTNHIIVGE  347 (373)
Q Consensus       319 ~~C~~C~~~f~~~~~l~~H~~~~H~~~~~  347 (373)
                      |.||+|..-|.+...|..|+-..|+.-..
T Consensus        16 flCPiC~~dl~~~~~L~~H~d~eH~~ed~   44 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLDVEHFEEDE   44 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHhhhccccch
Confidence            77888888888877888887777765443


No 213
>KOG3214|consensus
Probab=24.83  E-value=31  Score=24.14  Aligned_cols=40  Identities=23%  Similarity=0.497  Sum_probs=20.3

Q ss_pred             CCccCCCCcccccchhhhhhhhhhccCCCcccCCCCCCCccChh
Q psy10075        289 KPFKCSFCEYKCTTKFGLKSHVTRIHSNQKYFCGSCNFSCTSNT  332 (373)
Q Consensus       289 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~C~~C~~~f~~~~  332 (373)
                      ..|.|+.|.-.-+    ..--+...+......|.+|+.+|....
T Consensus        22 t~FnClfcnHek~----v~~~~Dk~~~iG~~sC~iC~esFqt~i   61 (109)
T KOG3214|consen   22 TQFNCLFCNHEKS----VSCTLDKKHNIGKASCRICEESFQTTI   61 (109)
T ss_pred             eeeccCccccccc----eeeeehhhcCcceeeeeehhhhhccch
Confidence            3466666644321    111122333344466788877777644


No 214
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=24.80  E-value=54  Score=25.21  Aligned_cols=15  Identities=13%  Similarity=0.470  Sum_probs=9.6

Q ss_pred             CeecCCCCccccChh
Q psy10075        261 PFTCEHCDSKFCKKY  275 (373)
Q Consensus       261 ~~~C~~C~~~f~~~~  275 (373)
                      -+.|+.||+.|-.-+
T Consensus       124 f~~C~~C~kiyW~Gs  138 (147)
T PF01927_consen  124 FWRCPGCGKIYWEGS  138 (147)
T ss_pred             EEECCCCCCEecccc
Confidence            457777777775443


No 215
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=24.58  E-value=13  Score=20.72  Aligned_cols=11  Identities=27%  Similarity=0.616  Sum_probs=6.5

Q ss_pred             hhhhHhhhccc
Q psy10075        361 NAMYHCQITLN  371 (373)
Q Consensus       361 ~~~~~C~~C~~  371 (373)
                      ...|+|..||+
T Consensus         4 ~~~YkC~~CGn   14 (36)
T PF06397_consen    4 GEFYKCEHCGN   14 (36)
T ss_dssp             TEEEE-TTT--
T ss_pred             ccEEEccCCCC
Confidence            36799999996


No 216
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=24.32  E-value=49  Score=24.35  Aligned_cols=17  Identities=12%  Similarity=0.206  Sum_probs=11.6

Q ss_pred             CCcceecCCCCccccCh
Q psy10075         22 DSYNFICILCNYHAENF   38 (373)
Q Consensus        22 ~~~~~~C~~C~~~f~~~   38 (373)
                      ....+.|..|+..|...
T Consensus        68 vp~~~~C~~Cg~~~~~~   84 (117)
T PRK00564         68 EKVELECKDCSHVFKPN   84 (117)
T ss_pred             cCCEEEhhhCCCccccC
Confidence            34467788888777654


No 217
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=24.14  E-value=37  Score=19.63  Aligned_cols=16  Identities=19%  Similarity=0.397  Sum_probs=11.5

Q ss_pred             eecCCCCccccChhHH
Q psy10075        262 FTCEHCDSKFCKKYDM  277 (373)
Q Consensus       262 ~~C~~C~~~f~~~~~L  277 (373)
                      -.|++|++.|+-....
T Consensus         9 K~C~~C~rpf~WRKKW   24 (42)
T PF10013_consen    9 KICPVCGRPFTWRKKW   24 (42)
T ss_pred             CcCcccCCcchHHHHH
Confidence            4689999988765443


No 218
>PRK04351 hypothetical protein; Provisional
Probab=24.03  E-value=46  Score=25.72  Aligned_cols=12  Identities=33%  Similarity=0.786  Sum_probs=6.3

Q ss_pred             CCccCCCCcccc
Q psy10075        289 KPFKCSFCEYKC  300 (373)
Q Consensus       289 ~~~~C~~C~~~f  300 (373)
                      ..|.|..|+-.+
T Consensus       131 ~~yrCg~C~g~L  142 (149)
T PRK04351        131 KRYRCGKCRGKL  142 (149)
T ss_pred             CcEEeCCCCcEe
Confidence            445566555444


No 219
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=23.21  E-value=46  Score=18.28  Aligned_cols=8  Identities=25%  Similarity=0.874  Sum_probs=4.1

Q ss_pred             eecCCCCc
Q psy10075        262 FTCEHCDS  269 (373)
Q Consensus       262 ~~C~~C~~  269 (373)
                      +.|+.||.
T Consensus        23 ~vC~~Cg~   30 (34)
T PF14803_consen   23 LVCPACGF   30 (34)
T ss_dssp             EEETTTTE
T ss_pred             eECCCCCC
Confidence            45555554


No 220
>KOG4167|consensus
Probab=23.16  E-value=14  Score=35.88  Aligned_cols=27  Identities=19%  Similarity=0.229  Sum_probs=20.0

Q ss_pred             CcceecCCCCccccChhhHhhccccCC
Q psy10075         23 SYNFICILCNYHAENFENIYLHLPSHF   49 (373)
Q Consensus        23 ~~~~~C~~C~~~f~~~~~l~~H~~~h~   49 (373)
                      ++-|-|.+|++.|..+.++..||+.|.
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            455778888888877777777777774


No 221
>PTZ00448 hypothetical protein; Provisional
Probab=23.16  E-value=57  Score=29.21  Aligned_cols=24  Identities=17%  Similarity=0.527  Sum_probs=20.8

Q ss_pred             cccCCCCCCCccChhHHHHHHHhh
Q psy10075        318 KYFCGSCNFSCTSNTDLLEHVQTN  341 (373)
Q Consensus       318 ~~~C~~C~~~f~~~~~l~~H~~~~  341 (373)
                      .|.|..|+..|.+....+.|+++-
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KSD  337 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRSE  337 (373)
T ss_pred             CccccccccccCCHHHHHHHhhhh
Confidence            488999999999889999998865


No 222
>PF14445 Prok-RING_2:  Prokaryotic RING finger family 2
Probab=23.03  E-value=16  Score=21.86  Aligned_cols=15  Identities=27%  Similarity=0.439  Sum_probs=9.6

Q ss_pred             cceecCCCCccccCh
Q psy10075         24 YNFICILCNYHAENF   38 (373)
Q Consensus        24 ~~~~C~~C~~~f~~~   38 (373)
                      ..|.|++|+-+|+-.
T Consensus         6 sry~CDLCn~~~p~~   20 (57)
T PF14445_consen    6 SRYSCDLCNSSHPIS   20 (57)
T ss_pred             hhHhHHhhcccCcHH
Confidence            456777777666543


No 223
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=22.98  E-value=72  Score=25.63  Aligned_cols=16  Identities=25%  Similarity=0.567  Sum_probs=10.0

Q ss_pred             CcceecCCCCccccCh
Q psy10075         23 SYNFICILCNYHAENF   38 (373)
Q Consensus        23 ~~~~~C~~C~~~f~~~   38 (373)
                      +-||.|.+|.+.|.+.
T Consensus       194 ~IPF~C~iCKkdy~sp  209 (259)
T COG5152         194 KIPFLCGICKKDYESP  209 (259)
T ss_pred             CCceeehhchhhccch
Confidence            4566677776666554


No 224
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=22.95  E-value=29  Score=24.53  Aligned_cols=26  Identities=15%  Similarity=0.128  Sum_probs=18.9

Q ss_pred             CCcceecCCCCccccChhhHhhcccc
Q psy10075         22 DSYNFICILCNYHAENFENIYLHLPS   47 (373)
Q Consensus        22 ~~~~~~C~~C~~~f~~~~~l~~H~~~   47 (373)
                      +.+.+-|-+|.+.|.+...|..|.+.
T Consensus        52 GlGqhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          52 GLGQHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             CCceeeeehhHHHHHHHHHHHHHhcc
Confidence            55667788888888877777777653


No 225
>PF04328 DUF466:  Protein of unknown function (DUF466);  InterPro: IPR007423 This is a small bacterial protein of unknown function.
Probab=22.51  E-value=1.1e+02  Score=19.78  Aligned_cols=30  Identities=20%  Similarity=0.241  Sum_probs=21.5

Q ss_pred             cChhHHHHHHHhhcccccccccchhHHHHH
Q psy10075        329 TSNTDLLEHVQTNHIIVGESSSRDFIIHSF  358 (373)
Q Consensus       329 ~~~~~l~~H~~~~H~~~~~~~~~~~~~~~~  358 (373)
                      +......+|++.+|+.....+.+.|...+.
T Consensus        23 ~~Ye~Yv~H~~~~HP~~p~ms~~eF~r~r~   52 (65)
T PF04328_consen   23 PDYERYVEHMRRHHPDEPPMSEREFFRERQ   52 (65)
T ss_pred             HHHHHHHHHHHHHCcCCCCCCHHHHHHHHH
Confidence            345678889999998776666667766653


No 226
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=22.10  E-value=45  Score=19.32  Aligned_cols=14  Identities=21%  Similarity=0.306  Sum_probs=9.2

Q ss_pred             cceecCCCCccccC
Q psy10075         24 YNFICILCNYHAEN   37 (373)
Q Consensus        24 ~~~~C~~C~~~f~~   37 (373)
                      -|+.|+.|+..|=.
T Consensus        12 ~~~~C~~C~~~FC~   25 (43)
T PF01428_consen   12 LPFKCKHCGKSFCL   25 (43)
T ss_dssp             SHEE-TTTS-EE-T
T ss_pred             CCeECCCCCcccCc
Confidence            58999999999843


No 227
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=21.97  E-value=54  Score=24.41  Aligned_cols=15  Identities=20%  Similarity=0.428  Sum_probs=8.8

Q ss_pred             CcceecCCCCccccCh
Q psy10075         23 SYNFICILCNYHAENF   38 (373)
Q Consensus        23 ~~~~~C~~C~~~f~~~   38 (373)
                      ...+.| .|+..|...
T Consensus        68 p~~~~C-~Cg~~~~~~   82 (124)
T PRK00762         68 PVEIEC-ECGYEGVVD   82 (124)
T ss_pred             CeeEEe-eCcCccccc
Confidence            335667 777666543


No 228
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=21.93  E-value=39  Score=19.52  Aligned_cols=12  Identities=17%  Similarity=0.476  Sum_probs=7.8

Q ss_pred             ccCCCCCCCccC
Q psy10075        319 YFCGSCNFSCTS  330 (373)
Q Consensus       319 ~~C~~C~~~f~~  330 (373)
                      +.|+.||..+.+
T Consensus        33 ~~C~~CGE~~~~   44 (46)
T TIGR03831        33 LVCPQCGEEYLD   44 (46)
T ss_pred             cccccCCCEeeC
Confidence            667777766543


No 229
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=21.84  E-value=33  Score=21.31  Aligned_cols=9  Identities=33%  Similarity=1.143  Sum_probs=4.2

Q ss_pred             ecccccccc
Q psy10075        172 QCSFCDRRF  180 (373)
Q Consensus       172 ~C~~C~~~f  180 (373)
                      +|.+|++.+
T Consensus         4 kC~lCdk~~   12 (56)
T PF09963_consen    4 KCILCDKKE   12 (56)
T ss_pred             EEEecCCEE
Confidence            344555443


No 230
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=21.18  E-value=67  Score=17.52  Aligned_cols=19  Identities=16%  Similarity=0.433  Sum_probs=9.7

Q ss_pred             ccCCCCcccccchhhhhhhh
Q psy10075        291 FKCSFCEYKCTTKFGLKSHV  310 (373)
Q Consensus       291 ~~C~~C~~~f~~~~~l~~H~  310 (373)
                      +.|+.|++.. ..+-+..|+
T Consensus         5 ~~C~nC~R~v-~a~RfA~HL   23 (33)
T PF08209_consen    5 VECPNCGRPV-AASRFAPHL   23 (33)
T ss_dssp             EE-TTTSSEE-EGGGHHHHH
T ss_pred             EECCCCcCCc-chhhhHHHH
Confidence            4566666654 344555555


No 231
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=21.07  E-value=36  Score=22.04  Aligned_cols=9  Identities=44%  Similarity=1.099  Sum_probs=2.9

Q ss_pred             ecCCCCccc
Q psy10075        263 TCEHCDSKF  271 (373)
Q Consensus       263 ~C~~C~~~f  271 (373)
                      .|..|++.|
T Consensus        11 ~C~~C~~~F   19 (69)
T PF01363_consen   11 NCMICGKKF   19 (69)
T ss_dssp             B-TTT--B-
T ss_pred             cCcCcCCcC
Confidence            466666666


No 232
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=21.03  E-value=54  Score=17.75  Aligned_cols=10  Identities=30%  Similarity=0.803  Sum_probs=5.2

Q ss_pred             cccCcCcccc
Q psy10075         54 FSCDLCEYQT   63 (373)
Q Consensus        54 ~~C~~C~~~f   63 (373)
                      |.|..|+..+
T Consensus        28 f~C~~C~~~L   37 (39)
T smart00132       28 FKCSKCGKPL   37 (39)
T ss_pred             CCCcccCCcC
Confidence            5555555443


No 233
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=20.90  E-value=88  Score=17.96  Aligned_cols=18  Identities=17%  Similarity=0.337  Sum_probs=10.6

Q ss_pred             ecCCCCcceecCCCCccc
Q psy10075         18 SRLDDSYNFICILCNYHA   35 (373)
Q Consensus        18 ~~~~~~~~~~C~~C~~~f   35 (373)
                      .+..+.++..|+-|+..|
T Consensus        22 ~l~~~~~~~~CpYCg~~y   39 (40)
T PF10276_consen   22 NLDDEPGPVVCPYCGTRY   39 (40)
T ss_dssp             E-TTTTCEEEETTTTEEE
T ss_pred             ecCCCCCeEECCCCCCEE
Confidence            333333567788887766


No 234
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=20.88  E-value=49  Score=21.46  Aligned_cols=18  Identities=17%  Similarity=0.104  Sum_probs=14.7

Q ss_pred             cCCCCcceecCCCCcccc
Q psy10075         19 RLDDSYNFICILCNYHAE   36 (373)
Q Consensus        19 ~~~~~~~~~C~~C~~~f~   36 (373)
                      .+..++.+.|+.|+..|+
T Consensus        47 ~~i~eg~L~Cp~c~r~YP   64 (68)
T PF03966_consen   47 VEIVEGELICPECGREYP   64 (68)
T ss_dssp             EETTTTEEEETTTTEEEE
T ss_pred             ccccCCEEEcCCCCCEEe
Confidence            456778999999999885


No 235
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=20.84  E-value=44  Score=24.96  Aligned_cols=21  Identities=38%  Similarity=0.751  Sum_probs=10.7

Q ss_pred             ecCCCCccccChhHHHHhhhhhccC
Q psy10075        263 TCEHCDSKFCKKYDMKMHMSRAHYG  287 (373)
Q Consensus       263 ~C~~C~~~f~~~~~L~~H~~~~H~~  287 (373)
                      +|-.+|+.|+   .|.+|+ ..|.+
T Consensus        78 icLEDGkkfK---SLKRHL-~t~~g   98 (148)
T COG4957          78 ICLEDGKKFK---SLKRHL-TTHYG   98 (148)
T ss_pred             EEeccCcchH---HHHHHH-hcccC
Confidence            4555565553   355555 44433


No 236
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=20.53  E-value=58  Score=19.96  Aligned_cols=9  Identities=33%  Similarity=0.951  Sum_probs=4.1

Q ss_pred             cCCCCcccc
Q psy10075        264 CEHCDSKFC  272 (373)
Q Consensus       264 C~~C~~~f~  272 (373)
                      |..|++.|.
T Consensus         5 C~~C~~~F~   13 (57)
T cd00065           5 CMGCGKPFT   13 (57)
T ss_pred             CcccCcccc
Confidence            444444443


No 237
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=20.36  E-value=21  Score=22.16  Aligned_cols=9  Identities=33%  Similarity=1.003  Sum_probs=2.0

Q ss_pred             ccCCCCCCC
Q psy10075        319 YFCGSCNFS  327 (373)
Q Consensus       319 ~~C~~C~~~  327 (373)
                      |.|++||..
T Consensus        34 y~Cp~CgAt   42 (55)
T PF05741_consen   34 YVCPICGAT   42 (55)
T ss_dssp             ---TTT---
T ss_pred             CcCCCCcCc
Confidence            566666643


No 238
>KOG0717|consensus
Probab=20.09  E-value=53  Score=30.36  Aligned_cols=19  Identities=26%  Similarity=0.627  Sum_probs=0.0

Q ss_pred             eecCCCCccccChhHHHHh
Q psy10075        262 FTCEHCDSKFCKKYDMKMH  280 (373)
Q Consensus       262 ~~C~~C~~~f~~~~~L~~H  280 (373)
                      +-|.+|+++|.+...|..|
T Consensus       293 lyC~vCnKsFKseKq~kNH  311 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNH  311 (508)
T ss_pred             eEEeeccccccchHHHHhh


Done!