Query         psy10080
Match_columns 101
No_of_seqs    110 out of 2280
Neff          10.7
Searched_HMMs 46136
Date          Fri Aug 16 17:26:44 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10080.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10080hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.6 3.3E-16 7.2E-21   94.8   4.0   60   41-101   186-245 (279)
  2 KOG2462|consensus               99.6 3.4E-16 7.3E-21   94.8   2.6   64   28-92    201-264 (279)
  3 KOG3623|consensus               99.4 1.4E-14 3.1E-19   97.3  -0.3   60   41-101   893-952 (1007)
  4 KOG3623|consensus               99.4 1.6E-13 3.4E-18   92.4   4.2   65   28-93    908-972 (1007)
  5 KOG3576|consensus               99.2   6E-13 1.3E-17   78.0  -1.0   65   31-96    134-198 (267)
  6 KOG3576|consensus               99.1 5.3E-11 1.2E-15   69.9   1.3   69   32-101   107-175 (267)
  7 KOG1074|consensus               99.0 3.2E-11   7E-16   82.4   0.3   58   41-99    352-409 (958)
  8 PHA02768 hypothetical protein;  99.0   1E-10 2.3E-15   55.2   1.3   44   42-88      5-48  (55)
  9 PHA00733 hypothetical protein   99.0 1.2E-09 2.6E-14   60.8   4.7   56   38-96     69-124 (128)
 10 KOG1074|consensus               98.9 5.1E-10 1.1E-14   76.8   1.2   53   42-95    605-657 (958)
 11 PF13465 zf-H2C2_2:  Zinc-finge  98.7 1.5E-08 3.3E-13   41.1   2.4   26   57-83      1-26  (26)
 12 PHA00616 hypothetical protein   98.7 1.6E-08 3.4E-13   45.7   1.9   34   42-76      1-34  (44)
 13 PHA00616 hypothetical protein   98.6 2.8E-08   6E-13   44.9   2.0   30   71-100     1-30  (44)
 14 PHA00732 hypothetical protein   98.5 4.9E-08 1.1E-12   49.9   2.0   45   42-93      1-46  (79)
 15 KOG3993|consensus               98.4 1.8E-07 3.9E-12   60.5   2.2   56   42-97    295-382 (500)
 16 PF05605 zf-Di19:  Drought indu  98.4 7.8E-07 1.7E-11   42.3   3.9   52   42-96      2-54  (54)
 17 KOG3608|consensus               98.4 3.6E-07 7.8E-12   58.1   3.2   57   41-100   236-293 (467)
 18 PHA02768 hypothetical protein;  98.3 4.6E-07 9.9E-12   42.9   2.3   25   71-95      5-29  (55)
 19 KOG3608|consensus               98.3 1.4E-06 2.9E-11   55.6   4.1   53   42-95    263-316 (467)
 20 PF00096 zf-C2H2:  Zinc finger,  98.2 1.8E-06   4E-11   33.7   2.4   22   72-93      1-22  (23)
 21 PHA00733 hypothetical protein   98.1 2.5E-06 5.4E-11   47.6   2.7   56   40-96     38-98  (128)
 22 PF00096 zf-C2H2:  Zinc finger,  98.1 2.4E-06 5.1E-11   33.4   1.6   23   43-65      1-23  (23)
 23 PF13465 zf-H2C2_2:  Zinc-finge  98.0 4.5E-07 9.7E-12   36.7  -0.9   23   32-54      4-26  (26)
 24 PF09237 GAGA:  GAGA factor;  I  98.0   6E-06 1.3E-10   38.2   2.6   35   65-99     18-52  (54)
 25 PF13912 zf-C2H2_6:  C2H2-type   97.9 6.2E-06 1.3E-10   33.5   1.6   24   72-95      2-25  (27)
 26 PF13894 zf-C2H2_4:  C2H2-type   97.9 1.5E-05 3.3E-10   31.0   2.6   23   72-94      1-23  (24)
 27 PF13912 zf-C2H2_6:  C2H2-type   97.9 7.2E-06 1.6E-10   33.3   1.4   26   42-67      1-26  (27)
 28 PLN03086 PRLI-interacting fact  97.8 2.5E-05 5.4E-10   53.0   3.8   51   42-98    453-503 (567)
 29 COG5189 SFP1 Putative transcri  97.6 2.5E-05 5.5E-10   49.3   1.5   53   40-92    347-419 (423)
 30 PF13894 zf-C2H2_4:  C2H2-type   97.6 6.7E-05 1.5E-09   29.1   1.8   23   43-65      1-23  (24)
 31 PLN03086 PRLI-interacting fact  97.6 0.00011 2.3E-09   50.1   3.7   55   41-99    477-541 (567)
 32 smart00355 ZnF_C2H2 zinc finge  97.5 0.00013 2.9E-09   28.6   2.4   22   73-94      2-23  (26)
 33 PF12756 zf-C2H2_2:  C2H2 type   97.3 0.00032 6.9E-09   36.9   2.8   24   71-94     50-73  (100)
 34 smart00355 ZnF_C2H2 zinc finge  97.3 0.00031 6.7E-09   27.5   2.0   24   43-66      1-24  (26)
 35 PF09237 GAGA:  GAGA factor;  I  97.2 0.00068 1.5E-08   31.5   3.1   35   36-71     18-52  (54)
 36 PRK04860 hypothetical protein;  97.0 0.00049 1.1E-08   39.8   1.9   39   41-84    118-156 (160)
 37 PF13909 zf-H2C2_5:  C2H2-type   97.0 0.00095 2.1E-08   26.1   2.2   23   72-95      1-23  (24)
 38 PHA00732 hypothetical protein   97.0 0.00084 1.8E-08   34.4   2.4   26   71-96      1-27  (79)
 39 PF12874 zf-met:  Zinc-finger o  96.9 0.00077 1.7E-08   26.5   1.7   22   72-93      1-22  (25)
 40 PF12874 zf-met:  Zinc-finger o  96.8  0.0011 2.4E-08   26.1   1.5   23   43-65      1-23  (25)
 41 KOG3993|consensus               96.4 0.00085 1.8E-08   44.1  -0.1   53   42-95    267-319 (500)
 42 PF12171 zf-C2H2_jaz:  Zinc-fin  95.9  0.0042 9.2E-08   24.9   1.0   21   43-63      2-22  (27)
 43 PF13913 zf-C2HC_2:  zinc-finge  95.7   0.012 2.7E-07   23.3   1.9   20   73-93      4-23  (25)
 44 smart00451 ZnF_U1 U1-like zinc  94.6   0.034 7.3E-07   23.5   1.8   22   71-92      3-24  (35)
 45 COG5048 FOG: Zn-finger [Genera  94.2  0.0082 1.8E-07   39.1  -1.0   58   41-99    288-351 (467)
 46 KOG2186|consensus               94.0   0.026 5.7E-07   35.0   1.0   49   43-95      4-52  (276)
 47 PRK04860 hypothetical protein;  92.9   0.079 1.7E-06   30.8   1.8   26   71-100   119-144 (160)
 48 KOG1146|consensus               92.1     0.2 4.4E-06   37.9   3.3   57   36-92    459-539 (1406)
 49 KOG2893|consensus               92.1   0.042 9.2E-07   33.9  -0.0   42   44-90     12-53  (341)
 50 PF09845 DUF2072:  Zn-ribbon co  91.8     0.1 2.2E-06   29.2   1.2   15   42-56      1-15  (131)
 51 PF12756 zf-C2H2_2:  C2H2 type   91.8    0.15 3.2E-06   26.5   1.9   24   42-65     50-73  (100)
 52 COG1592 Rubrerythrin [Energy p  90.8    0.12 2.5E-06   30.3   0.9   23   42-78    134-156 (166)
 53 COG4049 Uncharacterized protei  90.7    0.22 4.7E-06   23.7   1.6   30   34-63      9-38  (65)
 54 cd00350 rubredoxin_like Rubred  90.1    0.14 3.1E-06   21.5   0.7   24   43-79      2-25  (33)
 55 PF09986 DUF2225:  Uncharacteri  89.5   0.073 1.6E-06   32.4  -0.7   43   41-84      4-61  (214)
 56 cd00729 rubredoxin_SM Rubredox  89.5    0.15 3.2E-06   21.7   0.5   25   42-79      2-26  (34)
 57 TIGR02098 MJ0042_CXXC MJ0042 f  88.7    0.27 5.8E-06   21.2   1.0   34   43-82      3-36  (38)
 58 PF09538 FYDLN_acid:  Protein o  88.6    0.24 5.2E-06   27.0   1.0   30   43-84     10-39  (108)
 59 COG5189 SFP1 Putative transcri  87.7    0.13 2.9E-06   33.1  -0.4   24   40-63    396-419 (423)
 60 PF13719 zinc_ribbon_5:  zinc-r  87.6    0.41   9E-06   20.7   1.3   34   43-82      3-36  (37)
 61 COG3357 Predicted transcriptio  86.5     0.3 6.5E-06   25.6   0.6   27   41-78     57-83  (97)
 62 COG1997 RPL43A Ribosomal prote  85.6    0.31 6.8E-06   25.3   0.4   31   41-82     34-64  (89)
 63 PRK00398 rpoP DNA-directed RNA  85.1    0.33 7.2E-06   22.0   0.3   29   42-81      3-31  (46)
 64 PF04959 ARS2:  Arsenite-resist  85.1    0.46   1E-05   29.0   1.0   27   71-97     77-103 (214)
 65 KOG2785|consensus               84.7       3 6.4E-05   27.8   4.5   53   41-93    165-242 (390)
 66 PF10571 UPF0547:  Uncharacteri  84.6    0.61 1.3E-05   18.6   0.9   10   73-82     16-25  (26)
 67 PF09963 DUF2197:  Uncharacteri  83.4    0.91   2E-05   21.7   1.4   52   44-99      4-55  (56)
 68 PRK14890 putative Zn-ribbon RN  83.3       1 2.2E-05   21.7   1.5   32   42-79     25-56  (59)
 69 COG3364 Zn-ribbon containing p  82.9    0.69 1.5E-05   24.8   1.0   15   42-56      2-16  (112)
 70 PF05443 ROS_MUCR:  ROS/MUCR tr  82.8    0.86 1.9E-05   25.8   1.4   24   71-97     72-95  (132)
 71 smart00614 ZnF_BED BED zinc fi  82.5     1.4 3.1E-05   20.2   1.9    8   85-92     37-44  (50)
 72 TIGR02300 FYDLN_acid conserved  81.6    0.82 1.8E-05   25.6   1.0   30   43-84     10-39  (129)
 73 PF13717 zinc_ribbon_4:  zinc-r  81.5     1.2 2.5E-05   19.2   1.3   33   43-81      3-35  (36)
 74 PF12013 DUF3505:  Protein of u  80.9       2 4.3E-05   23.2   2.3   25   72-96     81-109 (109)
 75 COG2888 Predicted Zn-ribbon RN  80.9    0.83 1.8E-05   22.0   0.7   31   42-78     27-57  (61)
 76 smart00531 TFIIE Transcription  80.6       1 2.2E-05   25.8   1.2   38   40-82     97-134 (147)
 77 PRK00464 nrdR transcriptional   80.0    0.31 6.8E-06   28.2  -1.0   12   43-54     29-40  (154)
 78 PHA00626 hypothetical protein   79.5    0.67 1.4E-05   22.1   0.2   12   71-82     23-34  (59)
 79 PRK06266 transcription initiat  77.8     1.2 2.7E-05   26.4   1.0   32   41-82    116-147 (178)
 80 TIGR00373 conserved hypothetic  77.4     1.2 2.6E-05   25.9   0.8   32   40-81    107-138 (158)
 81 smart00659 RPOLCX RNA polymera  77.4     1.3 2.8E-05   20.0   0.8   26   43-80      3-28  (44)
 82 smart00734 ZnF_Rad18 Rad18-lik  77.0     3.2 6.8E-05   16.4   1.8   19   73-92      3-21  (26)
 83 COG1996 RPC10 DNA-directed RNA  75.2     1.5 3.2E-05   20.4   0.6   29   41-80      5-33  (49)
 84 KOG4167|consensus               73.9    0.88 1.9E-05   32.7  -0.3   25   71-95    792-816 (907)
 85 PF02892 zf-BED:  BED zinc fing  73.1     5.3 0.00011   17.6   2.3   20   72-91     17-40  (45)
 86 PF03604 DNA_RNApol_7kD:  DNA d  72.7     1.9 4.1E-05   18.1   0.6   10   71-80     17-26  (32)
 87 PF14353 CpXC:  CpXC protein     72.5     2.4 5.3E-05   23.5   1.3   11   71-81     38-48  (128)
 88 PF08790 zf-LYAR:  LYAR-type C2  71.9    0.91   2E-05   18.5  -0.4    8   74-81      3-10  (28)
 89 KOG1146|consensus               70.9     3.2   7E-05   32.0   1.8   57   40-97   1282-1354(1406)
 90 PRK09678 DNA-binding transcrip  67.6     1.6 3.6E-05   21.9  -0.1   11   71-81     27-39  (72)
 91 KOG3408|consensus               66.8     3.9 8.5E-05   22.8   1.2   21   72-92     58-78  (129)
 92 COG4896 Uncharacterized protei  64.8     6.8 0.00015   19.1   1.7    9   70-78     30-38  (68)
 93 PF13451 zf-trcl:  Probable zin  63.9     4.2   9E-05   18.9   0.9   16   41-56      3-18  (49)
 94 PF13878 zf-C2H2_3:  zinc-finge  62.0      13 0.00028   16.4   2.3    9   44-52     15-23  (41)
 95 PF07754 DUF1610:  Domain of un  61.9     3.3 7.1E-05   16.2   0.3   10   41-50     15-24  (24)
 96 KOG4167|consensus               61.6     2.6 5.7E-05   30.5  -0.0   26   42-67    792-817 (907)
 97 PF01780 Ribosomal_L37ae:  Ribo  61.0     2.2 4.8E-05   22.4  -0.3   30   41-81     34-63  (90)
 98 PRK03824 hypA hydrogenase nick  60.9     2.6 5.7E-05   23.8  -0.1   16   40-55     68-83  (135)
 99 COG4957 Predicted transcriptio  60.8       8 0.00017   22.0   1.8   23   72-97     77-99  (148)
100 smart00834 CxxC_CXXC_SSSS Puta  60.5     3.2   7E-05   17.8   0.2   31   42-80      5-35  (41)
101 PTZ00255 60S ribosomal protein  57.9     3.7 8.1E-05   21.6   0.2   31   41-82     35-65  (90)
102 COG4530 Uncharacterized protei  56.5     5.3 0.00011   21.9   0.6   11   71-81     26-36  (129)
103 PF02146 SIR2:  Sir2 family;  I  56.3     5.1 0.00011   23.5   0.6   49   27-80     90-138 (178)
104 TIGR00280 L37a ribosomal prote  56.1     3.6 7.8E-05   21.7  -0.1   31   41-82     34-64  (91)
105 PF07975 C1_4:  TFIIH C1-like d  55.7     3.4 7.3E-05   19.3  -0.2   27   40-66     19-45  (51)
106 COG5048 FOG: Zn-finger [Genera  55.1     8.2 0.00018   25.2   1.5   57   39-96     30-88  (467)
107 PLN02294 cytochrome c oxidase   54.9     9.6 0.00021   22.6   1.5   11   71-81    141-151 (174)
108 PF09723 Zn-ribbon_8:  Zinc rib  54.7     4.4 9.5E-05   17.9   0.1   30   42-79      5-34  (42)
109 KOG2593|consensus               54.2     8.9 0.00019   26.1   1.5   36   40-79    126-161 (436)
110 KOG4173|consensus               53.7     7.9 0.00017   23.8   1.1   47   44-91    108-166 (253)
111 PF10013 DUF2256:  Uncharacteri  52.1      10 0.00022   17.0   1.1   17   72-88      9-25  (42)
112 PF05191 ADK_lid:  Adenylate ki  52.1     3.8 8.3E-05   17.6  -0.3   31   43-82      2-32  (36)
113 COG4306 Uncharacterized protei  52.1     2.5 5.4E-05   23.7  -1.1   15   70-84     67-81  (160)
114 COG1571 Predicted DNA-binding   51.7     7.9 0.00017   26.3   0.9   29   44-84    352-380 (421)
115 cd00924 Cyt_c_Oxidase_Vb Cytoc  51.4     5.9 0.00013   21.2   0.3   17   37-54     75-91  (97)
116 PRK03976 rpl37ae 50S ribosomal  50.8     4.7  0.0001   21.2  -0.1   31   41-82     35-65  (90)
117 smart00154 ZnF_AN1 AN1-like Zi  50.3       7 0.00015   17.0   0.4   14   42-55     12-25  (39)
118 PRK12380 hydrogenase nickel in  50.3     7.5 0.00016   21.3   0.6   27   40-79     68-94  (113)
119 KOG0717|consensus               50.0      11 0.00024   26.0   1.5   21   72-92    293-313 (508)
120 PF04423 Rad50_zn_hook:  Rad50   49.8     6.6 0.00014   18.3   0.3   12   73-84     22-33  (54)
121 TIGR00100 hypA hydrogenase nic  49.6     8.1 0.00018   21.2   0.7   27   41-80     69-95  (115)
122 PRK03681 hypA hydrogenase nick  49.2     7.2 0.00016   21.4   0.4   29   40-80     68-96  (114)
123 PF13453 zf-TFIIB:  Transcripti  48.6      12 0.00025   16.3   1.0   19   71-89     19-37  (41)
124 PF06397 Desulfoferrod_N:  Desu  48.4     6.4 0.00014   17.0   0.1   13   41-53      5-17  (36)
125 KOG2071|consensus               48.4      12 0.00027   26.5   1.5   28   40-67    416-443 (579)
126 TIGR02605 CxxC_CxxC_SSSS putat  48.2     6.5 0.00014   18.0   0.1   30   42-79      5-34  (52)
127 PF15269 zf-C2H2_7:  Zinc-finge  45.6      22 0.00048   16.2   1.6   21   72-92     21-41  (54)
128 PF01155 HypA:  Hydrogenase exp  45.1     6.6 0.00014   21.5  -0.1   26   42-80     70-95  (113)
129 PF04780 DUF629:  Protein of un  44.6      20 0.00043   24.9   2.0   29   69-97     55-84  (466)
130 PF08274 PhnA_Zn_Ribbon:  PhnA   44.3      13 0.00029   15.3   0.8   10   70-79     18-27  (30)
131 COG2331 Uncharacterized protei  44.2     6.4 0.00014   20.0  -0.2   32   42-81     12-43  (82)
132 PRK14138 NAD-dependent deacety  44.0      30 0.00066   21.6   2.6   43   32-79    109-151 (244)
133 PRK00564 hypA hydrogenase nick  43.8     9.3  0.0002   21.1   0.3   15   40-54     69-83  (117)
134 COG0846 SIR2 NAD-dependent pro  41.8      17 0.00038   22.9   1.3   43   32-79    112-154 (250)
135 PF01428 zf-AN1:  AN1-like Zinc  41.6     7.8 0.00017   17.1  -0.2   15   41-55     12-26  (43)
136 TIGR00622 ssl1 transcription f  40.6      12 0.00027   20.5   0.5   25   71-95     81-105 (112)
137 COG5112 UFD2 U1-like Zn-finger  39.4      11 0.00025   20.5   0.2   21   72-92     56-76  (126)
138 PRK12496 hypothetical protein;  39.4      18 0.00039   21.2   1.1   28   41-81    126-153 (164)
139 KOG2482|consensus               39.4      23  0.0005   23.6   1.6   53   41-93    143-217 (423)
140 PF14369 zf-RING_3:  zinc-finge  39.0      14  0.0003   15.7   0.4   10   73-82     23-32  (35)
141 PRK14873 primosome assembly pr  39.0      20 0.00044   26.0   1.4   10   71-80    422-431 (665)
142 TIGR00416 sms DNA repair prote  38.7      18 0.00039   24.8   1.1    9   41-49     20-28  (454)
143 PRK11823 DNA repair protein Ra  38.5      21 0.00045   24.5   1.4    8   42-49     21-28  (446)
144 PRK05978 hypothetical protein;  38.3      17 0.00037   21.1   0.8   33   42-84     33-65  (148)
145 PF07503 zf-HYPF:  HypF finger;  38.1       9  0.0002   16.3  -0.2   10   72-81     22-31  (35)
146 COG5216 Uncharacterized conser  37.1      19  0.0004   17.4   0.7   30   42-78     22-51  (67)
147 COG4888 Uncharacterized Zn rib  36.4     3.7 8.1E-05   22.0  -1.8   14   40-53     20-33  (104)
148 KOG0782|consensus               35.2     5.7 0.00012   28.3  -1.6   38   41-84    252-289 (1004)
149 COG3091 SprT Zn-dependent meta  35.1      18 0.00038   21.1   0.6   37   39-81    114-150 (156)
150 COG4338 Uncharacterized protei  34.8      17 0.00037   16.8   0.4   15   73-87     14-28  (54)
151 PF10083 DUF2321:  Uncharacteri  34.4      20 0.00043   21.0   0.7   19   40-58     66-84  (158)
152 cd01407 SIR2-fam SIR2 family o  34.1      45 0.00098   20.3   2.3   44   31-79     98-141 (218)
153 COG1773 Rubredoxin [Energy pro  33.9      15 0.00032   17.5   0.1   14   42-55      3-16  (55)
154 PTZ00409 Sir2 (Silent Informat  33.8      60  0.0013   20.8   2.8   24   32-55    127-150 (271)
155 COG1198 PriA Primosomal protei  33.6      26 0.00056   25.8   1.3   12   69-80    473-484 (730)
156 PRK00432 30S ribosomal protein  33.3      27 0.00059   16.1   1.0   11   71-81     37-47  (50)
157 TIGR00515 accD acetyl-CoA carb  33.1      24 0.00052   22.8   1.0   12   71-82     45-56  (285)
158 KOG2923|consensus               33.0      32 0.00068   17.0   1.2   30   42-78     22-51  (67)
159 PF01215 COX5B:  Cytochrome c o  32.9      12 0.00026   21.4  -0.3   18   37-55    108-125 (136)
160 COG4855 Uncharacterized protei  32.6      20 0.00043   17.8   0.4   28   73-100    25-52  (76)
161 cd01413 SIR2_Af2 SIR2_Af2: Arc  32.6      46 0.00099   20.4   2.1   25   32-56    103-127 (222)
162 PLN03238 probable histone acet  31.9      68  0.0015   20.9   2.8   23   70-92     47-69  (290)
163 PF07282 OrfB_Zn_ribbon:  Putat  31.7      42 0.00092   16.2   1.6   15   69-83     44-58  (69)
164 PF01363 FYVE:  FYVE zinc finge  31.6      27 0.00059   16.8   0.9   10   44-53     11-20  (69)
165 cd01121 Sms Sms (bacterial rad  31.6      31 0.00066   23.1   1.3   12   39-50     11-22  (372)
166 TIGR00686 phnA alkylphosphonat  31.2      24 0.00053   19.3   0.7    8   72-79     20-27  (109)
167 CHL00174 accD acetyl-CoA carbo  31.1      27  0.0006   22.7   1.0   30   43-82     39-68  (296)
168 PF04606 Ogr_Delta:  Ogr/Delta-  30.6     9.2  0.0002   17.3  -0.9   13   70-82     24-38  (47)
169 KOG2231|consensus               30.4      64  0.0014   23.7   2.7   20   44-63    184-203 (669)
170 PF02176 zf-TRAF:  TRAF-type zi  30.2      21 0.00046   16.6   0.3   39   42-82      9-53  (60)
171 PF02591 DUF164:  Putative zinc  30.0      50  0.0011   15.3   1.6   31   44-79     24-54  (56)
172 KOG1842|consensus               29.8      36 0.00078   23.6   1.4   20   72-91     16-35  (505)
173 COG1656 Uncharacterized conser  29.6      56  0.0012   19.4   2.0   22   71-92    130-151 (165)
174 PTZ00043 cytochrome c oxidase   29.4      21 0.00046   22.3   0.3   15   41-55    180-194 (268)
175 KOG2807|consensus               28.9      83  0.0018   21.0   2.8   54   41-94    289-368 (378)
176 COG5151 SSL1 RNA polymerase II  28.8      21 0.00045   23.5   0.2   24   71-94    388-411 (421)
177 PRK00762 hypA hydrogenase nick  28.8      24 0.00051   19.7   0.4   33   40-79     68-100 (124)
178 PF07295 DUF1451:  Protein of u  28.7      16 0.00035   21.1  -0.3   10   42-51    112-121 (146)
179 cd00974 DSRD Desulforedoxin (D  28.5      22 0.00047   14.7   0.2   12   42-53      4-15  (34)
180 TIGR00319 desulf_FeS4 desulfof  28.2      22 0.00048   14.7   0.2   13   41-53      6-18  (34)
181 KOG3362|consensus               28.0      22 0.00048   20.5   0.2   19   72-90    130-148 (156)
182 PTZ00408 NAD-dependent deacety  27.7      56  0.0012   20.5   1.9   25   31-55    106-130 (242)
183 PRK10220 hypothetical protein;  27.1      38 0.00082   18.6   1.0    8   72-79     21-28  (111)
184 PRK05654 acetyl-CoA carboxylas  27.1      33 0.00072   22.2   0.9   11   72-82     47-57  (292)
185 PF10263 SprT-like:  SprT-like   26.9      19 0.00041   20.5  -0.2   32   41-81    122-153 (157)
186 PRK04351 hypothetical protein;  26.3      31 0.00068   19.9   0.6   33   41-82    111-143 (149)
187 COG3677 Transposase and inacti  25.7      28  0.0006   19.6   0.3   17   40-56     51-67  (129)
188 PF14803 Nudix_N_2:  Nudix N-te  25.5      15 0.00033   15.5  -0.6    9   71-79     22-30  (34)
189 cd01410 SIRT7 SIRT7: Eukaryoti  25.4   1E+02  0.0022   18.8   2.7   43   33-79     86-128 (206)
190 PF09947 DUF2180:  Uncharacteri  25.0      23  0.0005   17.7  -0.1    7   44-50     18-24  (68)
191 cd00730 rubredoxin Rubredoxin;  24.9      28  0.0006   16.1   0.2   12   43-54      2-13  (50)
192 PF14787 zf-CCHC_5:  GAG-polypr  24.8      24 0.00052   15.2  -0.0   14   44-57      4-17  (36)
193 PF12907 zf-met2:  Zinc-binding  24.8      54  0.0012   14.5   1.1   18   44-61      3-23  (40)
194 PLN02748 tRNA dimethylallyltra  24.7      61  0.0013   22.6   1.8   23   70-92    417-440 (468)
195 PF01927 Mut7-C:  Mut7-C RNAse   24.5      62  0.0013   18.5   1.6   47   43-89     92-142 (147)
196 PRK00481 NAD-dependent deacety  24.5      61  0.0013   20.1   1.7   25   32-56    112-136 (242)
197 PTZ00448 hypothetical protein;  24.4      66  0.0014   21.7   1.9   22   71-92    314-335 (373)
198 TIGR00595 priA primosomal prot  23.8      56  0.0012   22.9   1.6    9   71-79    253-261 (505)
199 COG1579 Zn-ribbon protein, pos  23.4      56  0.0012   20.6   1.4   35   42-81    197-231 (239)
200 TIGR00627 tfb4 transcription f  23.1      53  0.0011   21.2   1.2   11   42-52    255-265 (279)
201 PLN00104 MYST -like histone ac  23.0      81  0.0018   22.0   2.1   26   69-94    196-221 (450)
202 PRK14892 putative transcriptio  23.0      27 0.00059   18.8  -0.0   34   41-82     20-53  (99)
203 COG1645 Uncharacterized Zn-fin  22.9      33 0.00071   19.5   0.3    8   73-80     46-53  (131)
204 KOG3014|consensus               22.9      85  0.0019   20.0   2.0   23   73-95     39-63  (257)
205 KOG2636|consensus               22.7      62  0.0013   22.5   1.5   30   32-61    391-421 (497)
206 PF00301 Rubredoxin:  Rubredoxi  22.6      42 0.00092   15.3   0.6   10   72-81      2-11  (47)
207 COG1439 Predicted nucleic acid  22.5      40 0.00088   20.2   0.6   13   41-53    138-150 (177)
208 smart00731 SprT SprT homologue  22.4      41  0.0009   19.1   0.6   33   41-81    111-143 (146)
209 COG2051 RPS27A Ribosomal prote  22.3      29 0.00063   17.2  -0.0   12   71-82     38-49  (67)
210 cd01408 SIRT1 SIRT1: Eukaryoti  21.9   1E+02  0.0023   19.1   2.3   22   33-54    107-128 (235)
211 KOG2684|consensus               21.7 1.1E+02  0.0024   21.1   2.5   42   33-79    194-235 (412)
212 PTZ00064 histone acetyltransfe  21.6   1E+02  0.0022   22.0   2.4   25   70-94    279-303 (552)
213 PF05290 Baculo_IE-1:  Baculovi  21.4      54  0.0012   18.8   0.9   13   73-85    123-135 (140)
214 PRK06260 threonine synthase; V  21.3      50  0.0011   22.2   0.9    9   42-50     19-27  (397)
215 COG0068 HypF Hydrogenase matur  21.2      32  0.0007   25.3   0.0   28   45-79    154-181 (750)
216 PRK06450 threonine synthase; V  20.7      54  0.0012   21.6   1.0   10   43-52      4-13  (338)
217 KOG1280|consensus               20.7      93   0.002   21.0   2.0   37   41-78     78-116 (381)
218 PF04438 zf-HIT:  HIT zinc fing  20.5      51  0.0011   13.4   0.6   11   40-50     11-21  (30)
219 KOG1994|consensus               20.5      52  0.0011   20.7   0.8   22   41-62    238-259 (268)
220 COG5188 PRP9 Splicing factor 3  20.3      52  0.0011   22.2   0.8   23   41-63    237-259 (470)
221 KOG3507|consensus               20.2      51  0.0011   16.0   0.6   12   70-81     36-47  (62)
222 PLN02925 4-hydroxy-3-methylbut  20.1 1.1E+02  0.0024   22.7   2.4   26   72-97    635-660 (733)
223 PRK00420 hypothetical protein;  20.1      62  0.0014   17.9   1.0   10   72-81     41-50  (112)
224 PF10537 WAC_Acf1_DNA_bd:  ATP-  20.1 1.7E+02  0.0036   15.8   2.7   36   42-79      3-38  (102)
225 cd01412 SIRT5_Af1_CobB SIRT5_A  20.0      87  0.0019   19.1   1.7   25   31-55     98-122 (224)

No 1  
>KOG2462|consensus
Probab=99.63  E-value=3.3e-16  Score=94.79  Aligned_cols=60  Identities=22%  Similarity=0.453  Sum_probs=43.1

Q ss_pred             cccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccCChHHHHHHHHHhcCCCCCC
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCKHKTDIMHHMRLKHKEFKIE  101 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~e~~~~  101 (101)
                      -|++|.+|||.|..+=.|..|+|+|+| ++||.|..|+++|...++|+.|+++|.+-|+|+
T Consensus       186 l~c~C~iCGKaFSRPWLLQGHiRTHTG-EKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~q  245 (279)
T KOG2462|consen  186 LPCECGICGKAFSRPWLLQGHIRTHTG-EKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQ  245 (279)
T ss_pred             CCcccccccccccchHHhhcccccccC-CCCccCCcccchhcchHHHHHHHHhhcCCcccc
Confidence            367777777777777777777777777 667777777777777777777777777666653


No 2  
>KOG2462|consensus
Probab=99.61  E-value=3.4e-16  Score=94.75  Aligned_cols=64  Identities=20%  Similarity=0.410  Sum_probs=59.3

Q ss_pred             ccccceecccCCCcccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccCChHHHHHHHH
Q psy10080         28 MLVPYNVDKEGKKTTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCKHKTDIMHHMR   92 (101)
Q Consensus        28 ~~~~~~~~~~~~~~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~   92 (101)
                      =++.-+.++|+|+|||.|..|++.|..+++|..|+.+|.+ .+.|.|..|+++|...+.|.+|..
T Consensus       201 WLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~-~K~~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  201 WLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSD-VKKHQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             HHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcC-CccccCcchhhHHHHHHHHHHhhh
Confidence            3455778899999999999999999999999999999999 889999999999999999999975


No 3  
>KOG3623|consensus
Probab=99.43  E-value=1.4e-14  Score=97.31  Aligned_cols=60  Identities=28%  Similarity=0.544  Sum_probs=45.3

Q ss_pred             cccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccCChHHHHHHHHHhcCCCCCC
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCKHKTDIMHHMRLKHKEFKIE  101 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~e~~~~  101 (101)
                      -.|.|..|.|+|...+.|.+|.--|+| .+||.|..|.++|.++..|..|.|+|.|||||.
T Consensus       893 gmyaCDqCDK~FqKqSSLaRHKYEHsG-qRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQ  952 (1007)
T KOG3623|consen  893 GMYACDQCDKAFQKQSSLARHKYEHSG-QRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQ  952 (1007)
T ss_pred             ccchHHHHHHHHHhhHHHHHhhhhhcC-CCCcccchhhHhhhhhhhhhhhhhhccCCCcch
Confidence            367777777777777777777777777 777777777777777777777777777777763


No 4  
>KOG3623|consensus
Probab=99.42  E-value=1.6e-13  Score=92.43  Aligned_cols=65  Identities=22%  Similarity=0.424  Sum_probs=59.9

Q ss_pred             ccccceecccCCCcccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccCChHHHHHHHHH
Q psy10080         28 MLVPYNVDKEGKKTTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCKHKTDIMHHMRL   93 (101)
Q Consensus        28 ~~~~~~~~~~~~~~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~   93 (101)
                      +++..++=+|.|++||+|.+|.|.|..+-.|..|.|.|+| ++||.|+.|++.|++..+..+||..
T Consensus       908 SSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSG-EKPfQCdKClKRFSHSGSYSQHMNH  972 (1007)
T KOG3623|consen  908 SSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSG-EKPFQCDKCLKRFSHSGSYSQHMNH  972 (1007)
T ss_pred             HHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccC-CCcchhhhhhhhcccccchHhhhcc
Confidence            5555677789999999999999999999999999999999 8899999999999999999999874


No 5  
>KOG3576|consensus
Probab=99.24  E-value=6e-13  Score=78.00  Aligned_cols=65  Identities=18%  Similarity=0.413  Sum_probs=52.0

Q ss_pred             cceecccCCCcccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccCChHHHHHHHHHhcC
Q psy10080         31 PYNVDKEGKKTTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCKHKTDIMHHMRLKHK   96 (101)
Q Consensus        31 ~~~~~~~~~~~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~   96 (101)
                      ..+++.|..-+.+.|..||+.|...-.|.+|.++|+| .+||.|..|+++|.+..+|..|.+.-+|
T Consensus       134 nrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtg-vrpykc~~c~kaftqrcsleshl~kvhg  198 (267)
T KOG3576|consen  134 NRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTG-VRPYKCSLCEKAFTQRCSLESHLKKVHG  198 (267)
T ss_pred             HHHhhhccHHHHHHHhhccCcccchhhhhhhhccccC-ccccchhhhhHHHHhhccHHHHHHHHcC
Confidence            3444455556678888899999988889999999999 8889999999999999999888765443


No 6  
>KOG3576|consensus
Probab=99.05  E-value=5.3e-11  Score=69.94  Aligned_cols=69  Identities=19%  Similarity=0.455  Sum_probs=60.8

Q ss_pred             ceecccCCCcccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccCChHHHHHHHHHhcCCCCCC
Q psy10080         32 YNVDKEGKKTTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCKHKTDIMHHMRLKHKEFKIE  101 (101)
Q Consensus        32 ~~~~~~~~~~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~e~~~~  101 (101)
                      .....+.+..-|.|..|++.|....-|.+|+.-|+. .+.+.|..||+.|...-.|.+|.|+|+|-+||+
T Consensus       107 ~t~gsssd~d~ftCrvCgK~F~lQRmlnrh~kch~~-vkr~lct~cgkgfndtfdlkrh~rthtgvrpyk  175 (267)
T KOG3576|consen  107 STIGSSSDQDSFTCRVCGKKFGLQRMLNRHLKCHSD-VKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYK  175 (267)
T ss_pred             ccccCCCCCCeeeeehhhhhhhHHHHHHHHhhhccH-HHHHHHhhccCcccchhhhhhhhccccCccccc
Confidence            333444455689999999999999999999999998 878899999999999999999999999999885


No 7  
>KOG1074|consensus
Probab=99.05  E-value=3.2e-11  Score=82.43  Aligned_cols=58  Identities=22%  Similarity=0.501  Sum_probs=54.0

Q ss_pred             cccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccCChHHHHHHHHHhcCCCC
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCKHKTDIMHHMRLKHKEFK   99 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~e~~   99 (101)
                      .+++|..|.+.|...+.|..|.|.|+| ++||+|++||..|+.+.+|..|...|...+|
T Consensus       352 ~khkCr~CakvfgS~SaLqiHlRSHTG-ERPfqCnvCG~~FSTkGNLKvH~~rH~e~~p  409 (958)
T KOG1074|consen  352 FKHKCRFCAKVFGSDSALQIHLRSHTG-ERPFQCNVCGNRFSTKGNLKVHFQRHREKYP  409 (958)
T ss_pred             ccchhhhhHhhcCchhhhhhhhhccCC-CCCeeecccccccccccceeeeeeeccccCC
Confidence            468899999999999999999999999 8899999999999999999999888877765


No 8  
>PHA02768 hypothetical protein; Provisional
Probab=99.02  E-value=1e-10  Score=55.20  Aligned_cols=44  Identities=20%  Similarity=0.471  Sum_probs=39.1

Q ss_pred             ccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccCChHHHH
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCKHKTDIM   88 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~   88 (101)
                      -|.|+.||+.|...++|..|++.|..   ++.|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~k---~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHNT---NLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcCC---cccCCcccceecccceeE
Confidence            47999999999999999999999983   688999999998777664


No 9  
>PHA00733 hypothetical protein
Probab=98.98  E-value=1.2e-09  Score=60.76  Aligned_cols=56  Identities=21%  Similarity=0.538  Sum_probs=48.9

Q ss_pred             CCCcccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccCChHHHHHHHHHhcC
Q psy10080         38 GKKTTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCKHKTDIMHHMRLKHK   96 (101)
Q Consensus        38 ~~~~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~   96 (101)
                      .+.+||.|..|++.|.....|..|++.+..   ++.|..|++.|....+|..|+...++
T Consensus        69 ~~~kPy~C~~Cgk~Fss~s~L~~H~r~h~~---~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         69 KAVSPYVCPLCLMPFSSSVSLKQHIRYTEH---SKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCCCCccCCCCCCcCCCHHHHHHHHhcCCc---CccCCCCCCccCCHHHHHHHHHHhcC
Confidence            346799999999999999999999987633   68999999999999999999886654


No 10 
>KOG1074|consensus
Probab=98.89  E-value=5.1e-10  Score=76.77  Aligned_cols=53  Identities=23%  Similarity=0.473  Sum_probs=27.4

Q ss_pred             ccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccCChHHHHHHHHHhc
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCKHKTDIMHHMRLKH   95 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~   95 (101)
                      |.+|-.|.+.+..++.|..|.+.|+| ++||+|.+||++|..+.+|+.|+.+|.
T Consensus       605 PNqCiiC~rVlSC~saLqmHyrtHtG-ERPFkCKiCgRAFtTkGNLkaH~~vHk  657 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYRTHTG-ERPFKCKICGRAFTTKGNLKAHMSVHK  657 (958)
T ss_pred             ccceeeeeecccchhhhhhhhhcccC-cCccccccccchhccccchhhcccccc
Confidence            44455555555555555555555555 445555555555555555555554443


No 11 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.71  E-value=1.5e-08  Score=41.13  Aligned_cols=26  Identities=35%  Similarity=0.715  Sum_probs=22.4

Q ss_pred             HHHHHhhhhhCCCCceeccccccccCC
Q psy10080         57 NLMRHLRVECGKEPSQMCLFCSYKCKH   83 (101)
Q Consensus        57 ~l~~h~~~h~~~~~~~~c~~c~~~f~~   83 (101)
                      +|..|+++|++ ++||.|+.|++.|.+
T Consensus         1 ~l~~H~~~H~~-~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTG-EKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSS-SSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCC-CCCCCCCCCcCeeCc
Confidence            47889999999 788999999998863


No 12 
>PHA00616 hypothetical protein
Probab=98.66  E-value=1.6e-08  Score=45.67  Aligned_cols=34  Identities=18%  Similarity=0.336  Sum_probs=26.3

Q ss_pred             ccccCcchhhccChHHHHHHhhhhhCCCCceeccc
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLF   76 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~   76 (101)
                      ||+|..||+.|...+.+..|++.|++ ..++.|..
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg-~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHK-QNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcC-CCccceeE
Confidence            57888888888888888888888888 66776654


No 13 
>PHA00616 hypothetical protein
Probab=98.62  E-value=2.8e-08  Score=44.89  Aligned_cols=30  Identities=27%  Similarity=0.502  Sum_probs=28.1

Q ss_pred             ceeccccccccCChHHHHHHHHHhcCCCCC
Q psy10080         71 SQMCLFCSYKCKHKTDIMHHMRLKHKEFKI  100 (101)
Q Consensus        71 ~~~c~~c~~~f~~~~~l~~h~~~h~~e~~~  100 (101)
                      ||.|..||+.|.....|..|++.|+|++++
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~   30 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKL   30 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcc
Confidence            588999999999999999999999999775


No 14 
>PHA00732 hypothetical protein
Probab=98.54  E-value=4.9e-08  Score=49.91  Aligned_cols=45  Identities=20%  Similarity=0.462  Sum_probs=37.3

Q ss_pred             ccccCcchhhccChHHHHHHhhh-hhCCCCceeccccccccCChHHHHHHHHH
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRV-ECGKEPSQMCLFCSYKCKHKTDIMHHMRL   93 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~-h~~~~~~~~c~~c~~~f~~~~~l~~h~~~   93 (101)
                      ||.|..|++.|.....|..|++. |.+    +.|..|++.|.   .+..|.+.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~----~~C~~CgKsF~---~l~~H~~~   46 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL----TKCPVCNKSYR---RLNQHFYS   46 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC----CccCCCCCEeC---Chhhhhcc
Confidence            68999999999999999999884 554    47999999997   46667643


No 15 
>KOG3993|consensus
Probab=98.39  E-value=1.8e-07  Score=60.48  Aligned_cols=56  Identities=21%  Similarity=0.446  Sum_probs=47.8

Q ss_pred             ccccCcchhhccChHHHHHHhhhhhCC--------------------------------CCceeccccccccCChHHHHH
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRVECGK--------------------------------EPSQMCLFCSYKCKHKTDIMH   89 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~h~~~--------------------------------~~~~~c~~c~~~f~~~~~l~~   89 (101)
                      .|+|++|+|.|....+|..|+|+|...                                .-.|.|..|++.|.+...|+.
T Consensus       295 EYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrK  374 (500)
T KOG3993|consen  295 EYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRK  374 (500)
T ss_pred             eecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHH
Confidence            699999999999999999999988431                                113789999999999999999


Q ss_pred             HHHHhcCC
Q psy10080         90 HMRLKHKE   97 (101)
Q Consensus        90 h~~~h~~e   97 (101)
                      |+.+|...
T Consensus       375 Hqlthq~~  382 (500)
T KOG3993|consen  375 HQLTHQRA  382 (500)
T ss_pred             hHHhhhcc
Confidence            98888643


No 16 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.39  E-value=7.8e-07  Score=42.31  Aligned_cols=52  Identities=21%  Similarity=0.567  Sum_probs=40.3

Q ss_pred             ccccCcchhhccChHHHHHHhh-hhhCCCCceeccccccccCChHHHHHHHHHhcC
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLR-VECGKEPSQMCLFCSYKCKHKTDIMHHMRLKHK   96 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~-~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~   96 (101)
                      .|.|+.|++. .....|..|.. .|..+.+.+.|+.|...+.  .+|..|+..+++
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            5889999994 55678999955 4766556789999998654  489999988764


No 17 
>KOG3608|consensus
Probab=98.38  E-value=3.6e-07  Score=58.10  Aligned_cols=57  Identities=21%  Similarity=0.521  Sum_probs=31.9

Q ss_pred             cccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccCChHHHHHHHHHhcCC-CCC
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCKHKTDIMHHMRLKHKE-FKI  100 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~e-~~~  100 (101)
                      .+|.|..|.|.|.+...|..|+.-|..   .|.|+.|+.+....++|..|++..+.+ +||
T Consensus       236 n~fqC~~C~KrFaTeklL~~Hv~rHvn---~ykCplCdmtc~~~ssL~~H~r~rHs~dkpf  293 (467)
T KOG3608|consen  236 NSFQCAQCFKRFATEKLLKSHVVRHVN---CYKCPLCDMTCSSASSLTTHIRYRHSKDKPF  293 (467)
T ss_pred             CchHHHHHHHHHhHHHHHHHHHHHhhh---cccccccccCCCChHHHHHHHHhhhccCCCc
Confidence            355555555555555555555554443   355666666666666666666654433 554


No 18 
>PHA02768 hypothetical protein; Provisional
Probab=98.33  E-value=4.6e-07  Score=42.89  Aligned_cols=25  Identities=16%  Similarity=0.444  Sum_probs=23.8

Q ss_pred             ceeccccccccCChHHHHHHHHHhc
Q psy10080         71 SQMCLFCSYKCKHKTDIMHHMRLKH   95 (101)
Q Consensus        71 ~~~c~~c~~~f~~~~~l~~h~~~h~   95 (101)
                      .|.|+.||+.|....+|..|+++|+
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~   29 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN   29 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC
Confidence            3789999999999999999999999


No 19 
>KOG3608|consensus
Probab=98.28  E-value=1.4e-06  Score=55.56  Aligned_cols=53  Identities=21%  Similarity=0.582  Sum_probs=35.5

Q ss_pred             ccccCcchhhccChHHHHHHhhh-hhCCCCceeccccccccCChHHHHHHHHHhc
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRV-ECGKEPSQMCLFCSYKCKHKTDIMHHMRLKH   95 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~-h~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~   95 (101)
                      -|+|+.|..+.+..+.|.+|++. |+. .+||+|+.|++.|...+.|++|..+|.
T Consensus       263 ~ykCplCdmtc~~~ssL~~H~r~rHs~-dkpfKCd~Cd~~c~~esdL~kH~~~HS  316 (467)
T KOG3608|consen  263 CYKCPLCDMTCSSASSLTTHIRYRHSK-DKPFKCDECDTRCVRESDLAKHVQVHS  316 (467)
T ss_pred             cccccccccCCCChHHHHHHHHhhhcc-CCCccccchhhhhccHHHHHHHHHhcc
Confidence            46677777777777777777665 444 666777777777777777777766665


No 20 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.20  E-value=1.8e-06  Score=33.72  Aligned_cols=22  Identities=27%  Similarity=0.573  Sum_probs=13.7

Q ss_pred             eeccccccccCChHHHHHHHHH
Q psy10080         72 QMCLFCSYKCKHKTDIMHHMRL   93 (101)
Q Consensus        72 ~~c~~c~~~f~~~~~l~~h~~~   93 (101)
                      |.|..|++.|.....|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            3566666666666666666654


No 21 
>PHA00733 hypothetical protein
Probab=98.12  E-value=2.5e-06  Score=47.58  Aligned_cols=56  Identities=9%  Similarity=0.147  Sum_probs=44.2

Q ss_pred             CcccccCcchhhccChHHHHHHhh-----hhhCCCCceeccccccccCChHHHHHHHHHhcC
Q psy10080         40 KTTWACPMCRKIYAFKYNLMRHLR-----VECGKEPSQMCLFCSYKCKHKTDIMHHMRLKHK   96 (101)
Q Consensus        40 ~~p~~C~~c~~~~~~~~~l~~h~~-----~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~   96 (101)
                      ++++.|..|.+.|..+..|..+..     .+.+ ..||.|..|++.|.....|..|++.+..
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~-~kPy~C~~Cgk~Fss~s~L~~H~r~h~~   98 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKA-VSPYVCPLCLMPFSSSVSLKQHIRYTEH   98 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCC-CCCccCCCCCCcCCCHHHHHHHHhcCCc
Confidence            568999999998888777666511     2233 5689999999999999999999997643


No 22 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.09  E-value=2.4e-06  Score=33.39  Aligned_cols=23  Identities=43%  Similarity=0.940  Sum_probs=21.0

Q ss_pred             cccCcchhhccChHHHHHHhhhh
Q psy10080         43 WACPMCRKIYAFKYNLMRHLRVE   65 (101)
Q Consensus        43 ~~C~~c~~~~~~~~~l~~h~~~h   65 (101)
                      |.|+.|++.|..+..|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            68999999999999999998864


No 23 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.04  E-value=4.5e-07  Score=36.71  Aligned_cols=23  Identities=17%  Similarity=0.551  Sum_probs=19.6

Q ss_pred             ceecccCCCcccccCcchhhccC
Q psy10080         32 YNVDKEGKKTTWACPMCRKIYAF   54 (101)
Q Consensus        32 ~~~~~~~~~~p~~C~~c~~~~~~   54 (101)
                      .++..|.+++||.|+.|++.|..
T Consensus         4 ~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    4 RHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHSSSSSEEESSSSEEESS
T ss_pred             HHhhhcCCCCCCCCCCCcCeeCc
Confidence            45668999999999999998863


No 24 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=98.04  E-value=6e-06  Score=38.23  Aligned_cols=35  Identities=14%  Similarity=0.410  Sum_probs=22.6

Q ss_pred             hhCCCCceeccccccccCChHHHHHHHHHhcCCCC
Q psy10080         65 ECGKEPSQMCLFCSYKCKHKTDIMHHMRLKHKEFK   99 (101)
Q Consensus        65 h~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~e~~   99 (101)
                      +..+..|..|++|+..+++.-+|.+|+.++++.||
T Consensus        18 ~~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   18 KSQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             CCTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hhccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            33336677888888888888888888888887765


No 25 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.94  E-value=6.2e-06  Score=33.46  Aligned_cols=24  Identities=17%  Similarity=0.212  Sum_probs=14.2

Q ss_pred             eeccccccccCChHHHHHHHHHhc
Q psy10080         72 QMCLFCSYKCKHKTDIMHHMRLKH   95 (101)
Q Consensus        72 ~~c~~c~~~f~~~~~l~~h~~~h~   95 (101)
                      |.|..|++.|....+|..|++.|.
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCccCCccCChhHHHHHhHHhc
Confidence            556666666666666666655543


No 26 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.92  E-value=1.5e-05  Score=31.04  Aligned_cols=23  Identities=26%  Similarity=0.612  Sum_probs=14.3

Q ss_pred             eeccccccccCChHHHHHHHHHh
Q psy10080         72 QMCLFCSYKCKHKTDIMHHMRLK   94 (101)
Q Consensus        72 ~~c~~c~~~f~~~~~l~~h~~~h   94 (101)
                      |.|+.|+..|.....|..|++.+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            45667777777777777776655


No 27 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.89  E-value=7.2e-06  Score=33.27  Aligned_cols=26  Identities=27%  Similarity=0.607  Sum_probs=23.4

Q ss_pred             ccccCcchhhccChHHHHHHhhhhhC
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRVECG   67 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~h~~   67 (101)
                      ||.|..|++.|.....|..|++.|.+
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            68999999999999999999987653


No 28 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=97.83  E-value=2.5e-05  Score=53.01  Aligned_cols=51  Identities=16%  Similarity=0.341  Sum_probs=22.1

Q ss_pred             ccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccCChHHHHHHHHHhcCCC
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCKHKTDIMHHMRLKHKEF   98 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~e~   98 (101)
                      ++.|+.|++.|. ...+..|+..+.   .++.|+ |+..+ ....|..|+.+|.+++
T Consensus       453 H~~C~~Cgk~f~-~s~LekH~~~~H---kpv~Cp-Cg~~~-~R~~L~~H~~thCp~K  503 (567)
T PLN03086        453 HVHCEKCGQAFQ-QGEMEKHMKVFH---EPLQCP-CGVVL-EKEQMVQHQASTCPLR  503 (567)
T ss_pred             CccCCCCCCccc-hHHHHHHHHhcC---CCccCC-CCCCc-chhHHHhhhhccCCCC
Confidence            344555555443 334444444432   134444 44322 3344444444444443


No 29 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.63  E-value=2.5e-05  Score=49.29  Aligned_cols=53  Identities=23%  Similarity=0.503  Sum_probs=41.8

Q ss_pred             CcccccCc--chhhccChHHHHHHhhh-h-----------------hCCCCceeccccccccCChHHHHHHHH
Q psy10080         40 KTTWACPM--CRKIYAFKYNLMRHLRV-E-----------------CGKEPSQMCLFCSYKCKHKTDIMHHMR   92 (101)
Q Consensus        40 ~~p~~C~~--c~~~~~~~~~l~~h~~~-h-----------------~~~~~~~~c~~c~~~f~~~~~l~~h~~   92 (101)
                      .+||+|++  |.|.+.....|.-|+.- |                 ..+.+||+|.+|++.+.....|..|..
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            37999975  99999999999988642 2                 111478999999999998888877653


No 30 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.57  E-value=6.7e-05  Score=29.11  Aligned_cols=23  Identities=35%  Similarity=0.847  Sum_probs=19.1

Q ss_pred             cccCcchhhccChHHHHHHhhhh
Q psy10080         43 WACPMCRKIYAFKYNLMRHLRVE   65 (101)
Q Consensus        43 ~~C~~c~~~~~~~~~l~~h~~~h   65 (101)
                      |.|+.|++.|.....|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            68999999999999999998865


No 31 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=97.56  E-value=0.00011  Score=50.07  Aligned_cols=55  Identities=18%  Similarity=0.382  Sum_probs=41.6

Q ss_pred             cccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccC----------ChHHHHHHHHHhcCCCC
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCK----------HKTDIMHHMRLKHKEFK   99 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~----------~~~~l~~h~~~h~~e~~   99 (101)
                      .|+.|+ |++.+ ....|..|+..|.+ .+++.|..|+..|.          ....|..|.... |.++
T Consensus       477 kpv~Cp-Cg~~~-~R~~L~~H~~thCp-~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt  541 (567)
T PLN03086        477 EPLQCP-CGVVL-EKEQMVQHQASTCP-LRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRT  541 (567)
T ss_pred             CCccCC-CCCCc-chhHHHhhhhccCC-CCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcc
Confidence            588898 98655 56788889888888 77889999988874          235788888775 5544


No 32 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.51  E-value=0.00013  Score=28.64  Aligned_cols=22  Identities=32%  Similarity=0.522  Sum_probs=13.6

Q ss_pred             eccccccccCChHHHHHHHHHh
Q psy10080         73 MCLFCSYKCKHKTDIMHHMRLK   94 (101)
Q Consensus        73 ~c~~c~~~f~~~~~l~~h~~~h   94 (101)
                      .|..|++.|.....|..|++.|
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        2 RCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCcchhCCHHHHHHHHHHh
Confidence            4566666666666666666654


No 33 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.28  E-value=0.00032  Score=36.94  Aligned_cols=24  Identities=29%  Similarity=0.624  Sum_probs=20.8

Q ss_pred             ceeccccccccCChHHHHHHHHHh
Q psy10080         71 SQMCLFCSYKCKHKTDIMHHMRLK   94 (101)
Q Consensus        71 ~~~c~~c~~~f~~~~~l~~h~~~h   94 (101)
                      .+.|..|+..|.+...|..|++.+
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCc
Confidence            488999999999999999999864


No 34 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.26  E-value=0.00031  Score=27.54  Aligned_cols=24  Identities=33%  Similarity=0.791  Sum_probs=21.3

Q ss_pred             cccCcchhhccChHHHHHHhhhhh
Q psy10080         43 WACPMCRKIYAFKYNLMRHLRVEC   66 (101)
Q Consensus        43 ~~C~~c~~~~~~~~~l~~h~~~h~   66 (101)
                      |.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            579999999999999999988664


No 35 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.21  E-value=0.00068  Score=31.49  Aligned_cols=35  Identities=26%  Similarity=0.469  Sum_probs=23.6

Q ss_pred             ccCCCcccccCcchhhccChHHHHHHhhhhhCCCCc
Q psy10080         36 KEGKKTTWACPMCRKIYAFKYNLMRHLRVECGKEPS   71 (101)
Q Consensus        36 ~~~~~~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~   71 (101)
                      ....+.|..|+.|+..+....+|.+|+....+ .+|
T Consensus        18 ~~~S~~PatCP~C~a~~~~srnLrRHle~~H~-~k~   52 (54)
T PF09237_consen   18 KSQSEQPATCPICGAVIRQSRNLRRHLEIRHF-KKP   52 (54)
T ss_dssp             CCTTS--EE-TTT--EESSHHHHHHHHHHHTT-TS-
T ss_pred             hhccCCCCCCCcchhhccchhhHHHHHHHHhc-ccC
Confidence            34456799999999999999999999987766 443


No 36 
>PRK04860 hypothetical protein; Provisional
Probab=97.00  E-value=0.00049  Score=39.85  Aligned_cols=39  Identities=28%  Similarity=0.527  Sum_probs=32.4

Q ss_pred             cccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccCCh
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCKHK   84 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~   84 (101)
                      -+|.|. |+.   ....+.+|.++|++ .++|.|..|+..|...
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g-~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRG-EAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcC-CccEECCCCCceeEEe
Confidence            589998 987   55678899999999 8789999999887643


No 37 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.98  E-value=0.00095  Score=26.06  Aligned_cols=23  Identities=30%  Similarity=0.753  Sum_probs=14.9

Q ss_pred             eeccccccccCChHHHHHHHHHhc
Q psy10080         72 QMCLFCSYKCKHKTDIMHHMRLKH   95 (101)
Q Consensus        72 ~~c~~c~~~f~~~~~l~~h~~~h~   95 (101)
                      |.|+.|+.... ...|..|++.++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            46777777666 777877777654


No 38 
>PHA00732 hypothetical protein
Probab=96.96  E-value=0.00084  Score=34.38  Aligned_cols=26  Identities=15%  Similarity=0.301  Sum_probs=22.8

Q ss_pred             ceeccccccccCChHHHHHHHHH-hcC
Q psy10080         71 SQMCLFCSYKCKHKTDIMHHMRL-KHK   96 (101)
Q Consensus        71 ~~~c~~c~~~f~~~~~l~~h~~~-h~~   96 (101)
                      ||.|..|++.|.+..+|..|++. |++
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~   27 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL   27 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC
Confidence            57899999999999999999984 554


No 39 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.92  E-value=0.00077  Score=26.54  Aligned_cols=22  Identities=18%  Similarity=0.472  Sum_probs=14.1

Q ss_pred             eeccccccccCChHHHHHHHHH
Q psy10080         72 QMCLFCSYKCKHKTDIMHHMRL   93 (101)
Q Consensus        72 ~~c~~c~~~f~~~~~l~~h~~~   93 (101)
                      |.|..|...|.+...+..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            3466666677777666666653


No 40 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.75  E-value=0.0011  Score=26.08  Aligned_cols=23  Identities=30%  Similarity=0.735  Sum_probs=20.3

Q ss_pred             cccCcchhhccChHHHHHHhhhh
Q psy10080         43 WACPMCRKIYAFKYNLMRHLRVE   65 (101)
Q Consensus        43 ~~C~~c~~~~~~~~~l~~h~~~h   65 (101)
                      |.|..|++.|.....+..|.+.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            67999999999999999997754


No 41 
>KOG3993|consensus
Probab=96.37  E-value=0.00085  Score=44.09  Aligned_cols=53  Identities=17%  Similarity=0.375  Sum_probs=42.7

Q ss_pred             ccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccCChHHHHHHHHHhc
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCKHKTDIMHHMRLKH   95 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~   95 (101)
                      -|-|..|.-.|.....|..|.=...- ..-|+|+.|++.|+-..+|..|.|-|.
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV-~vEYrCPEC~KVFsCPANLASHRRWHK  319 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIV-HVEYRCPECDKVFSCPANLASHRRWHK  319 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeE-EeeecCCcccccccCchhhhhhhcccC
Confidence            47899999899999999888432222 234899999999999999999998774


No 42 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.93  E-value=0.0042  Score=24.95  Aligned_cols=21  Identities=24%  Similarity=0.710  Sum_probs=12.5

Q ss_pred             cccCcchhhccChHHHHHHhh
Q psy10080         43 WACPMCRKIYAFKYNLMRHLR   63 (101)
Q Consensus        43 ~~C~~c~~~~~~~~~l~~h~~   63 (101)
                      |.|..|++.|.....+..|+.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            456666666666666655544


No 43 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.70  E-value=0.012  Score=23.25  Aligned_cols=20  Identities=20%  Similarity=0.526  Sum_probs=11.9

Q ss_pred             eccccccccCChHHHHHHHHH
Q psy10080         73 MCLFCSYKCKHKTDIMHHMRL   93 (101)
Q Consensus        73 ~c~~c~~~f~~~~~l~~h~~~   93 (101)
                      .|+.|++.| ....|..|+.+
T Consensus         4 ~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHHHh
Confidence            466666666 45566666543


No 44 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.62  E-value=0.034  Score=23.47  Aligned_cols=22  Identities=14%  Similarity=0.501  Sum_probs=16.4

Q ss_pred             ceeccccccccCChHHHHHHHH
Q psy10080         71 SQMCLFCSYKCKHKTDIMHHMR   92 (101)
Q Consensus        71 ~~~c~~c~~~f~~~~~l~~h~~   92 (101)
                      +|.|..|+..|.....+..|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            4668888888887777777764


No 45 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.19  E-value=0.0082  Score=39.08  Aligned_cols=58  Identities=21%  Similarity=0.325  Sum_probs=51.5

Q ss_pred             cccccCcchhhccChHHHHHHhh--hhhCCC--Cceecc--ccccccCChHHHHHHHHHhcCCCC
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLR--VECGKE--PSQMCL--FCSYKCKHKTDIMHHMRLKHKEFK   99 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~--~h~~~~--~~~~c~--~c~~~f~~~~~l~~h~~~h~~e~~   99 (101)
                      .++.|..|...|.....+..|.+  .|.+ .  .++.|+  .|++.|.+...+..|..+|++..+
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~-~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~  351 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSG-ESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISP  351 (467)
T ss_pred             cCCCCccccCCcccccccccccccccccc-ccCCceeeeccCCCccccccccccCCcccccCCCc
Confidence            47889999999999999999999  7999 5  789999  799999999999999998887643


No 46 
>KOG2186|consensus
Probab=94.01  E-value=0.026  Score=34.96  Aligned_cols=49  Identities=14%  Similarity=0.331  Sum_probs=34.3

Q ss_pred             cccCcchhhccChHHHHHHhhhhhCCCCceeccccccccCChHHHHHHHHHhc
Q psy10080         43 WACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCKHKTDIMHHMRLKH   95 (101)
Q Consensus        43 ~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~   95 (101)
                      |.|..||.... +..+..|+....+ . .|.|..|+..|.. -+...|....+
T Consensus         4 FtCnvCgEsvK-Kp~vekH~srCrn-~-~fSCIDC~k~F~~-~sYknH~kCIT   52 (276)
T KOG2186|consen    4 FTCNVCGESVK-KPQVEKHMSRCRN-A-YFSCIDCGKTFER-VSYKNHTKCIT   52 (276)
T ss_pred             Eehhhhhhhcc-ccchHHHHHhccC-C-eeEEeeccccccc-chhhhhhhhcc
Confidence            67888887665 4457778776665 3 5888889988876 55666665444


No 47 
>PRK04860 hypothetical protein; Provisional
Probab=92.95  E-value=0.079  Score=30.84  Aligned_cols=26  Identities=23%  Similarity=0.393  Sum_probs=22.3

Q ss_pred             ceeccccccccCChHHHHHHHHHhcCCCCC
Q psy10080         71 SQMCLFCSYKCKHKTDIMHHMRLKHKEFKI  100 (101)
Q Consensus        71 ~~~c~~c~~~f~~~~~l~~h~~~h~~e~~~  100 (101)
                      +|.|. |+.   ....+..|.++|+|+++|
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~Y  144 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVY  144 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccE
Confidence            58897 886   788899999999999765


No 48 
>KOG1146|consensus
Probab=92.10  E-value=0.2  Score=37.88  Aligned_cols=57  Identities=21%  Similarity=0.404  Sum_probs=45.9

Q ss_pred             ccCCCcccccCcchhhccChHHHHHHhhhhh-----------------C-------CCCceeccccccccCChHHHHHHH
Q psy10080         36 KEGKKTTWACPMCRKIYAFKYNLMRHLRVEC-----------------G-------KEPSQMCLFCSYKCKHKTDIMHHM   91 (101)
Q Consensus        36 ~~~~~~p~~C~~c~~~~~~~~~l~~h~~~h~-----------------~-------~~~~~~c~~c~~~f~~~~~l~~h~   91 (101)
                      .+...+.+.|+.|+..|.....|..|++.-.                 +       ...+|.|..|..+++...+|-.|+
T Consensus       459 L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsihl  538 (1406)
T KOG1146|consen  459 LHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHL  538 (1406)
T ss_pred             eecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHH
Confidence            3444589999999999999999999998710                 0       024688999999999999999997


Q ss_pred             H
Q psy10080         92 R   92 (101)
Q Consensus        92 ~   92 (101)
                      .
T Consensus       539 q  539 (1406)
T KOG1146|consen  539 Q  539 (1406)
T ss_pred             H
Confidence            6


No 49 
>KOG2893|consensus
Probab=92.08  E-value=0.042  Score=33.91  Aligned_cols=42  Identities=19%  Similarity=0.348  Sum_probs=30.7

Q ss_pred             ccCcchhhccChHHHHHHhhhhhCCCCceeccccccccCChHHHHHH
Q psy10080         44 ACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCKHKTDIMHH   90 (101)
Q Consensus        44 ~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h   90 (101)
                      .|..|++.|....-|..||+     .+.|+|-.|-+.+.+-..|.-|
T Consensus        12 wcwycnrefddekiliqhqk-----akhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQK-----AKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeeecccccchhhhhhhhhh-----hccceeeeehhhhccCCCceee
Confidence            47778888888888888877     5678888887666555555544


No 50 
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=91.79  E-value=0.1  Score=29.23  Aligned_cols=15  Identities=13%  Similarity=0.516  Sum_probs=13.0

Q ss_pred             ccccCcchhhccChH
Q psy10080         42 TWACPMCRKIYAFKY   56 (101)
Q Consensus        42 p~~C~~c~~~~~~~~   56 (101)
                      |++|..||+.|...+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            789999999998765


No 51 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=91.77  E-value=0.15  Score=26.55  Aligned_cols=24  Identities=29%  Similarity=0.782  Sum_probs=21.1

Q ss_pred             ccccCcchhhccChHHHHHHhhhh
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRVE   65 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~h   65 (101)
                      .+.|..|++.|.....|..|++.+
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCc
Confidence            799999999999999999998864


No 52 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=90.78  E-value=0.12  Score=30.29  Aligned_cols=23  Identities=35%  Similarity=1.107  Sum_probs=18.0

Q ss_pred             ccccCcchhhccChHHHHHHhhhhhCCCCceeccccc
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCS   78 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~   78 (101)
                      -|.|++||.+             +.+ ..|.+|++|+
T Consensus       134 ~~vC~vCGy~-------------~~g-e~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYT-------------HEG-EAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCc-------------ccC-CCCCcCCCCC
Confidence            6999999843             445 6688899998


No 53 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=90.72  E-value=0.22  Score=23.67  Aligned_cols=30  Identities=20%  Similarity=0.552  Sum_probs=23.2

Q ss_pred             ecccCCCcccccCcchhhccChHHHHHHhh
Q psy10080         34 VDKEGKKTTWACPMCRKIYAFKYNLMRHLR   63 (101)
Q Consensus        34 ~~~~~~~~p~~C~~c~~~~~~~~~l~~h~~   63 (101)
                      ..+..|+.-+.|+.|+..|.....+.+|..
T Consensus         9 v~~RDGE~~lrCPRC~~~FR~~K~Y~RHVN   38 (65)
T COG4049           9 VRDRDGEEFLRCPRCGMVFRRRKDYIRHVN   38 (65)
T ss_pred             eeccCCceeeeCCchhHHHHHhHHHHHHhh
Confidence            344556777889999999998888888854


No 54 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=90.10  E-value=0.14  Score=21.53  Aligned_cols=24  Identities=33%  Similarity=0.874  Sum_probs=14.3

Q ss_pred             cccCcchhhccChHHHHHHhhhhhCCCCceecccccc
Q psy10080         43 WACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSY   79 (101)
Q Consensus        43 ~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~   79 (101)
                      |.|..||.++.-.             ..++.|+.|+.
T Consensus         2 ~~C~~CGy~y~~~-------------~~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGE-------------EAPWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCC-------------cCCCcCcCCCC
Confidence            5677777554321             24667877764


No 55 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=89.53  E-value=0.073  Score=32.39  Aligned_cols=43  Identities=26%  Similarity=0.495  Sum_probs=27.6

Q ss_pred             cccccCcchhhccChHHHHHHhhh----------hhCCCCc-----eeccccccccCCh
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLRV----------ECGKEPS-----QMCLFCSYKCKHK   84 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~~----------h~~~~~~-----~~c~~c~~~f~~~   84 (101)
                      +...|+.|++.|..........++          ..+ ..|     .+|+.||.++...
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~-vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKG-VNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCceEeeecCCCccccCC-CCCeeeeEEECCCCCCccccc
Confidence            467899999999887544433321          122 222     5799999877533


No 56 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=89.52  E-value=0.15  Score=21.72  Aligned_cols=25  Identities=32%  Similarity=0.875  Sum_probs=16.1

Q ss_pred             ccccCcchhhccChHHHHHHhhhhhCCCCceecccccc
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSY   79 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~   79 (101)
                      .|.|..||.++...             ..|..|+.|+.
T Consensus         2 ~~~C~~CG~i~~g~-------------~~p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEGE-------------EAPEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeECC-------------cCCCcCcCCCC
Confidence            47888888654321             34567888874


No 57 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=88.73  E-value=0.27  Score=21.20  Aligned_cols=34  Identities=15%  Similarity=0.324  Sum_probs=21.6

Q ss_pred             cccCcchhhccChHHHHHHhhhhhCCCCceeccccccccC
Q psy10080         43 WACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCK   82 (101)
Q Consensus        43 ~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~   82 (101)
                      ..|+.|+..|.......     ... .....|+.|+..|.
T Consensus         3 ~~CP~C~~~~~v~~~~~-----~~~-~~~v~C~~C~~~~~   36 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQL-----GAN-GGKVRCGKCGHVWY   36 (38)
T ss_pred             EECCCCCCEEEeCHHHc-----CCC-CCEEECCCCCCEEE
Confidence            57889998877665421     111 22467999987763


No 58 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=88.63  E-value=0.24  Score=26.95  Aligned_cols=30  Identities=17%  Similarity=0.421  Sum_probs=18.9

Q ss_pred             cccCcchhhccChHHHHHHhhhhhCCCCceeccccccccCCh
Q psy10080         43 WACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCKHK   84 (101)
Q Consensus        43 ~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~   84 (101)
                      ..|+.||..|-..           . +.|..|+.||..|.-.
T Consensus        10 R~Cp~CG~kFYDL-----------n-k~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYDL-----------N-KDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhccC-----------C-CCCccCCCCCCccCcc
Confidence            3677787655432           1 4467788888777544


No 59 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=87.67  E-value=0.13  Score=33.13  Aligned_cols=24  Identities=25%  Similarity=0.519  Sum_probs=20.6

Q ss_pred             CcccccCcchhhccChHHHHHHhh
Q psy10080         40 KTTWACPMCRKIYAFKYNLMRHLR   63 (101)
Q Consensus        40 ~~p~~C~~c~~~~~~~~~l~~h~~   63 (101)
                      .+||.|..|+|.+.....|.-|+.
T Consensus       396 ~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         396 DKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CCceeccccchhhccCccceeccc
Confidence            589999999999999888887743


No 60 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=87.64  E-value=0.41  Score=20.67  Aligned_cols=34  Identities=18%  Similarity=0.510  Sum_probs=21.5

Q ss_pred             cccCcchhhccChHHHHHHhhhhhCCCCceeccccccccC
Q psy10080         43 WACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCK   82 (101)
Q Consensus        43 ~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~   82 (101)
                      -.|+.|+..|.....     ++..+ .....|..|+..|.
T Consensus         3 i~CP~C~~~f~v~~~-----~l~~~-~~~vrC~~C~~~f~   36 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDD-----KLPAG-GRKVRCPKCGHVFR   36 (37)
T ss_pred             EECCCCCceEEcCHH-----HcccC-CcEEECCCCCcEee
Confidence            368888888776653     11222 33577888887663


No 61 
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=86.53  E-value=0.3  Score=25.61  Aligned_cols=27  Identities=15%  Similarity=0.277  Sum_probs=19.1

Q ss_pred             cccccCcchhhccChHHHHHHhhhhhCCCCceeccccc
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCS   78 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~   78 (101)
                      .|-.|..||..|.....           ++|..|+.|.
T Consensus        57 ~Pa~CkkCGfef~~~~i-----------k~pSRCP~CK   83 (97)
T COG3357          57 RPARCKKCGFEFRDDKI-----------KKPSRCPKCK   83 (97)
T ss_pred             cChhhcccCcccccccc-----------CCcccCCcch
Confidence            58899999988775211           4567788874


No 62 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=85.64  E-value=0.31  Score=25.34  Aligned_cols=31  Identities=26%  Similarity=0.589  Sum_probs=22.2

Q ss_pred             cccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccC
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCK   82 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~   82 (101)
                      .+|.|+.|++.        .+.+.-++   .|.|..|+..|.
T Consensus        34 ~~~~Cp~C~~~--------~VkR~a~G---IW~C~kCg~~fA   64 (89)
T COG1997          34 AKHVCPFCGRT--------TVKRIATG---IWKCRKCGAKFA   64 (89)
T ss_pred             cCCcCCCCCCc--------ceeeeccC---eEEcCCCCCeec
Confidence            47899999864        22344455   689999998874


No 63 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=85.12  E-value=0.33  Score=21.98  Aligned_cols=29  Identities=17%  Similarity=0.617  Sum_probs=18.2

Q ss_pred             ccccCcchhhccChHHHHHHhhhhhCCCCceecccccccc
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKC   81 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f   81 (101)
                      .|.|+.||..|.....           ...+.|+.||..+
T Consensus         3 ~y~C~~CG~~~~~~~~-----------~~~~~Cp~CG~~~   31 (46)
T PRK00398          3 EYKCARCGREVELDEY-----------GTGVRCPYCGYRI   31 (46)
T ss_pred             EEECCCCCCEEEECCC-----------CCceECCCCCCeE
Confidence            5788888876654321           1146788887654


No 64 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=85.10  E-value=0.46  Score=29.04  Aligned_cols=27  Identities=26%  Similarity=0.333  Sum_probs=17.1

Q ss_pred             ceeccccccccCChHHHHHHHHHhcCC
Q psy10080         71 SQMCLFCSYKCKHKTDIMHHMRLKHKE   97 (101)
Q Consensus        71 ~~~c~~c~~~f~~~~~l~~h~~~h~~e   97 (101)
                      .|.|..|++.|.-...+..|+...+.+
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             EECCCCCCcccCChHHHHHHHhhcCHH
Confidence            477777888887777777777665543


No 65 
>KOG2785|consensus
Probab=84.74  E-value=3  Score=27.78  Aligned_cols=53  Identities=25%  Similarity=0.355  Sum_probs=41.1

Q ss_pred             cccccCcchhhccChHHHHHHhhhhhCCC----------------------Cceeccccc---cccCChHHHHHHHHH
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLRVECGKE----------------------PSQMCLFCS---YKCKHKTDIMHHMRL   93 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~~h~~~~----------------------~~~~c~~c~---~~f~~~~~l~~h~~~   93 (101)
                      -|=.|-.|++.+..--.-..||..+.+.-                      .-+.|..|.   +.|.+..+.+.||.-
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            46678999999888877788887655531                      236788887   999999999999873


No 66 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=84.56  E-value=0.61  Score=18.57  Aligned_cols=10  Identities=30%  Similarity=1.042  Sum_probs=7.5

Q ss_pred             eccccccccC
Q psy10080         73 MCLFCSYKCK   82 (101)
Q Consensus        73 ~c~~c~~~f~   82 (101)
                      .|+.||..|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            5888888774


No 67 
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=83.35  E-value=0.91  Score=21.67  Aligned_cols=52  Identities=17%  Similarity=0.272  Sum_probs=26.1

Q ss_pred             ccCcchhhccChHHHHHHhhhhhCCCCceeccccccccCChHHHHHHHHHhcCCCC
Q psy10080         44 ACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCKHKTDIMHHMRLKHKEFK   99 (101)
Q Consensus        44 ~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~e~~   99 (101)
                      +|..|++.+.-........+.-..+...|.|..|....    ......+..+|.+.
T Consensus         4 kC~lCdk~~~Id~~~~~aKrLrnrPi~tYmC~eC~~RI----~~~t~~r~~~g~f~   55 (56)
T PF09963_consen    4 KCILCDKKEEIDEDTPEAKRLRNRPIHTYMCDECKERI----REETNERIATGKFN   55 (56)
T ss_pred             EEEecCCEEEeccCCHHHHHhhcCCCcceeChhHHHHH----hHHHHhhhccCCCC
Confidence            56677776544432222223322325568888885332    23334445555543


No 68 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=83.26  E-value=1  Score=21.73  Aligned_cols=32  Identities=16%  Similarity=0.630  Sum_probs=17.2

Q ss_pred             ccccCcchhhccChHHHHHHhhhhhCCCCceecccccc
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSY   79 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~   79 (101)
                      .|.|+.||...-..-.     +--.- ..+|.|+.||-
T Consensus        25 ~F~CPnCG~~~I~RC~-----~CRk~-~~~Y~CP~CGF   56 (59)
T PRK14890         25 KFLCPNCGEVIIYRCE-----KCRKQ-SNPYTCPKCGF   56 (59)
T ss_pred             EeeCCCCCCeeEeech-----hHHhc-CCceECCCCCC
Confidence            5778888765222211     11111 34788988873


No 69 
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=82.92  E-value=0.69  Score=24.84  Aligned_cols=15  Identities=13%  Similarity=0.470  Sum_probs=12.7

Q ss_pred             ccccCcchhhccChH
Q psy10080         42 TWACPMCRKIYAFKY   56 (101)
Q Consensus        42 p~~C~~c~~~~~~~~   56 (101)
                      |++|..||..|..-+
T Consensus         2 pH~CtrCG~vf~~g~   16 (112)
T COG3364           2 PHQCTRCGEVFDDGS   16 (112)
T ss_pred             Cceeccccccccccc
Confidence            789999999998754


No 70 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=82.84  E-value=0.86  Score=25.75  Aligned_cols=24  Identities=33%  Similarity=0.520  Sum_probs=12.8

Q ss_pred             ceeccccccccCChHHHHHHHHHhcCC
Q psy10080         71 SQMCLFCSYKCKHKTDIMHHMRLKHKE   97 (101)
Q Consensus        71 ~~~c~~c~~~f~~~~~l~~h~~~h~~e   97 (101)
                      ...|..||+.|...   .+|++.|+|.
T Consensus        72 ~i~clecGk~~k~L---krHL~~~~gl   95 (132)
T PF05443_consen   72 YIICLECGKKFKTL---KRHLRTHHGL   95 (132)
T ss_dssp             -EE-TBT--EESBH---HHHHHHTT-S
T ss_pred             eeEEccCCcccchH---HHHHHHccCC
Confidence            35677788777543   7777777654


No 71 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=82.53  E-value=1.4  Score=20.23  Aligned_cols=8  Identities=25%  Similarity=0.787  Sum_probs=4.3

Q ss_pred             HHHHHHHH
Q psy10080         85 TDIMHHMR   92 (101)
Q Consensus        85 ~~l~~h~~   92 (101)
                      ++|.+|+.
T Consensus        37 s~L~rHl~   44 (50)
T smart00614       37 SNLRRHLR   44 (50)
T ss_pred             HHHHHHHH
Confidence            45555555


No 72 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=81.62  E-value=0.82  Score=25.59  Aligned_cols=30  Identities=7%  Similarity=0.106  Sum_probs=18.3

Q ss_pred             cccCcchhhccChHHHHHHhhhhhCCCCceeccccccccCCh
Q psy10080         43 WACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCKHK   84 (101)
Q Consensus        43 ~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~   84 (101)
                      ..|+.||+.|-..           . +.|..|+.||..|.-.
T Consensus        10 r~Cp~cg~kFYDL-----------n-k~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYDL-----------N-RRPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCcccccc-----------C-CCCccCCCcCCccCcc
Confidence            3677777655432           1 4466778887776544


No 73 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=81.48  E-value=1.2  Score=19.16  Aligned_cols=33  Identities=18%  Similarity=0.389  Sum_probs=20.1

Q ss_pred             cccCcchhhccChHHHHHHhhhhhCCCCceecccccccc
Q psy10080         43 WACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKC   81 (101)
Q Consensus        43 ~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f   81 (101)
                      ..|+.|+..|......     +... .....|..|+..|
T Consensus         3 i~Cp~C~~~y~i~d~~-----ip~~-g~~v~C~~C~~~f   35 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEK-----IPPK-GRKVRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEEeCCHHH-----CCCC-CcEEECCCCCCEe
Confidence            3678888777766542     1111 2346788888765


No 74 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=80.93  E-value=2  Score=23.18  Aligned_cols=25  Identities=28%  Similarity=0.583  Sum_probs=21.9

Q ss_pred             eec----cccccccCChHHHHHHHHHhcC
Q psy10080         72 QMC----LFCSYKCKHKTDIMHHMRLKHK   96 (101)
Q Consensus        72 ~~c----~~c~~~f~~~~~l~~h~~~h~~   96 (101)
                      |.|    ..|+..+.+...+..|.+.++|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            779    8899999999999999988765


No 75 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=80.87  E-value=0.83  Score=22.04  Aligned_cols=31  Identities=16%  Similarity=0.519  Sum_probs=17.9

Q ss_pred             ccccCcchhhccChHHHHHHhhhhhCCCCceeccccc
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCS   78 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~   78 (101)
                      .|.|+.||...-....     +--.- ..+|.|+.||
T Consensus        27 ~F~CPnCGe~~I~Rc~-----~CRk~-g~~Y~Cp~CG   57 (61)
T COG2888          27 KFPCPNCGEVEIYRCA-----KCRKL-GNPYRCPKCG   57 (61)
T ss_pred             EeeCCCCCceeeehhh-----hHHHc-CCceECCCcC
Confidence            5788888854332221     11111 4479999887


No 76 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=80.59  E-value=1  Score=25.80  Aligned_cols=38  Identities=18%  Similarity=0.396  Sum_probs=23.7

Q ss_pred             CcccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccC
Q psy10080         40 KTTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCK   82 (101)
Q Consensus        40 ~~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~   82 (101)
                      ..-|.|+.|+..|.....+..- .   . ...|.|+.||....
T Consensus        97 ~~~Y~Cp~C~~~y~~~ea~~~~-d---~-~~~f~Cp~Cg~~l~  134 (147)
T smart00531       97 NAYYKCPNCQSKYTFLEANQLL-D---M-DGTFTCPRCGEELE  134 (147)
T ss_pred             CcEEECcCCCCEeeHHHHHHhc-C---C-CCcEECCCCCCEEE
Confidence            3478899999888854332210 1   1 22389999987653


No 77 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=79.96  E-value=0.31  Score=28.21  Aligned_cols=12  Identities=25%  Similarity=0.603  Sum_probs=5.6

Q ss_pred             cccCcchhhccC
Q psy10080         43 WACPMCRKIYAF   54 (101)
Q Consensus        43 ~~C~~c~~~~~~   54 (101)
                      ++|+.||..|..
T Consensus        29 ~~c~~c~~~f~~   40 (154)
T PRK00464         29 RECLACGKRFTT   40 (154)
T ss_pred             eeccccCCcceE
Confidence            444455544443


No 78 
>PHA00626 hypothetical protein
Probab=79.49  E-value=0.67  Score=22.07  Aligned_cols=12  Identities=25%  Similarity=0.647  Sum_probs=6.8

Q ss_pred             ceeccccccccC
Q psy10080         71 SQMCLFCSYKCK   82 (101)
Q Consensus        71 ~~~c~~c~~~f~   82 (101)
                      .|.|..|+..|+
T Consensus        23 rYkCkdCGY~ft   34 (59)
T PHA00626         23 DYVCCDCGYNDS   34 (59)
T ss_pred             ceEcCCCCCeec
Confidence            455666665554


No 79 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=77.77  E-value=1.2  Score=26.38  Aligned_cols=32  Identities=22%  Similarity=0.487  Sum_probs=22.1

Q ss_pred             cccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccC
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCK   82 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~   82 (101)
                      .-|.|+.|+..|+..-++          ..-|.|+.||....
T Consensus       116 ~~Y~Cp~C~~rytf~eA~----------~~~F~Cp~Cg~~L~  147 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAM----------EYGFRCPQCGEMLE  147 (178)
T ss_pred             CEEECCCCCcEEeHHHHh----------hcCCcCCCCCCCCe
Confidence            468899998877765443          12488999986553


No 80 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=77.37  E-value=1.2  Score=25.89  Aligned_cols=32  Identities=16%  Similarity=0.314  Sum_probs=21.6

Q ss_pred             CcccccCcchhhccChHHHHHHhhhhhCCCCceecccccccc
Q psy10080         40 KTTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKC   81 (101)
Q Consensus        40 ~~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f   81 (101)
                      ..-|.|+.|+..|+..-++.          .-|.|+.||...
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~~----------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAME----------LNFTCPRCGAML  138 (158)
T ss_pred             CCeEECCCCCcEeeHHHHHH----------cCCcCCCCCCEe
Confidence            34677888887777655442          148888888654


No 81 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=77.37  E-value=1.3  Score=20.02  Aligned_cols=26  Identities=23%  Similarity=0.629  Sum_probs=16.2

Q ss_pred             cccCcchhhccChHHHHHHhhhhhCCCCceeccccccc
Q psy10080         43 WACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYK   80 (101)
Q Consensus        43 ~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~   80 (101)
                      |.|..||..|...           . ..+..|+.||..
T Consensus         3 Y~C~~Cg~~~~~~-----------~-~~~irC~~CG~r   28 (44)
T smart00659        3 YICGECGRENEIK-----------S-KDVVRCRECGYR   28 (44)
T ss_pred             EECCCCCCEeecC-----------C-CCceECCCCCce
Confidence            6778888765532           1 335678888744


No 82 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=77.04  E-value=3.2  Score=16.40  Aligned_cols=19  Identities=21%  Similarity=0.406  Sum_probs=12.1

Q ss_pred             eccccccccCChHHHHHHHH
Q psy10080         73 MCLFCSYKCKHKTDIMHHMR   92 (101)
Q Consensus        73 ~c~~c~~~f~~~~~l~~h~~   92 (101)
                      .|+.|.+.+ ....+..|..
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            467777776 4556666654


No 83 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=75.19  E-value=1.5  Score=20.38  Aligned_cols=29  Identities=14%  Similarity=0.541  Sum_probs=18.4

Q ss_pred             cccccCcchhhccChHHHHHHhhhhhCCCCceeccccccc
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYK   80 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~   80 (101)
                      .-|.|..|++.|.....           .....|+.||..
T Consensus         5 ~~Y~C~~Cg~~~~~~~~-----------~~~irCp~Cg~r   33 (49)
T COG1996           5 MEYKCARCGREVELDQE-----------TRGIRCPYCGSR   33 (49)
T ss_pred             EEEEhhhcCCeeehhhc-----------cCceeCCCCCcE
Confidence            36889999987732111           335678888753


No 84 
>KOG4167|consensus
Probab=73.85  E-value=0.88  Score=32.74  Aligned_cols=25  Identities=16%  Similarity=0.125  Sum_probs=22.4

Q ss_pred             ceeccccccccCChHHHHHHHHHhc
Q psy10080         71 SQMCLFCSYKCKHKTDIMHHMRLKH   95 (101)
Q Consensus        71 ~~~c~~c~~~f~~~~~l~~h~~~h~   95 (101)
                      -|.|.+|++.|..-.+++.||+.|.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            3889999999999999999999875


No 85 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=73.13  E-value=5.3  Score=17.61  Aligned_cols=20  Identities=20%  Similarity=0.592  Sum_probs=9.4

Q ss_pred             eeccccccccCC----hHHHHHHH
Q psy10080         72 QMCLFCSYKCKH----KTDIMHHM   91 (101)
Q Consensus        72 ~~c~~c~~~f~~----~~~l~~h~   91 (101)
                      ..|..|++.+..    ..+|.+|+
T Consensus        17 a~C~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   17 AKCKYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             EEETTTTEE-----SSTHHHHHHH
T ss_pred             EEeCCCCeEEeeCCCcHHHHHHhh
Confidence            455556554443    35566665


No 86 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=72.65  E-value=1.9  Score=18.08  Aligned_cols=10  Identities=20%  Similarity=0.484  Sum_probs=5.5

Q ss_pred             ceeccccccc
Q psy10080         71 SQMCLFCSYK   80 (101)
Q Consensus        71 ~~~c~~c~~~   80 (101)
                      +..|..||..
T Consensus        17 ~irC~~CG~R   26 (32)
T PF03604_consen   17 PIRCPECGHR   26 (32)
T ss_dssp             TSSBSSSS-S
T ss_pred             cEECCcCCCe
Confidence            4567777643


No 87 
>PF14353 CpXC:  CpXC protein
Probab=72.53  E-value=2.4  Score=23.49  Aligned_cols=11  Identities=36%  Similarity=0.531  Sum_probs=5.5

Q ss_pred             ceecccccccc
Q psy10080         71 SQMCLFCSYKC   81 (101)
Q Consensus        71 ~~~c~~c~~~f   81 (101)
                      .+.|+.||..|
T Consensus        38 ~~~CP~Cg~~~   48 (128)
T PF14353_consen   38 SFTCPSCGHKF   48 (128)
T ss_pred             EEECCCCCCce
Confidence            34555555444


No 88 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=71.92  E-value=0.91  Score=18.46  Aligned_cols=8  Identities=38%  Similarity=0.878  Sum_probs=3.7

Q ss_pred             cccccccc
Q psy10080         74 CLFCSYKC   81 (101)
Q Consensus        74 c~~c~~~f   81 (101)
                      |..|++.|
T Consensus         3 CiDC~~~F   10 (28)
T PF08790_consen    3 CIDCSKDF   10 (28)
T ss_dssp             ETTTTEEE
T ss_pred             eecCCCCc
Confidence            44444444


No 89 
>KOG1146|consensus
Probab=70.88  E-value=3.2  Score=32.03  Aligned_cols=57  Identities=21%  Similarity=0.404  Sum_probs=44.6

Q ss_pred             CcccccCcchhhccChHHHHHHhhhhh----------------CCCCceeccccccccCChHHHHHHHHHhcCC
Q psy10080         40 KTTWACPMCRKIYAFKYNLMRHLRVEC----------------GKEPSQMCLFCSYKCKHKTDIMHHMRLKHKE   97 (101)
Q Consensus        40 ~~p~~C~~c~~~~~~~~~l~~h~~~h~----------------~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~e   97 (101)
                      ..+|.|..|...|.....|..|++...                ....+| |..|...|+....|+.|+++-+++
T Consensus      1282 ~~~~~~~~~~~~~~~~~~l~~~~~k~~~~~~~~~~~~~~~l~~~d~~~~-c~~c~~~~~~~~alqihm~~~~~~ 1354 (1406)
T KOG1146|consen 1282 THRYLCRQCKMAFDGEAPLTAHQRKFCFAGRGSGGSMPPPLRVPDCTYH-CLACEVLLSGREALQIHMRSSAHR 1354 (1406)
T ss_pred             chhHHHHHHHhhhcchhHHHHHHHHHHhccCccccCCCCcccCcccccc-chHHHhhcchhHHHHHHHHHhhhc
Confidence            458999999999999999998875321                002345 999999999999999999975544


No 90 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=67.57  E-value=1.6  Score=21.94  Aligned_cols=11  Identities=27%  Similarity=0.483  Sum_probs=5.2

Q ss_pred             ceecc--cccccc
Q psy10080         71 SQMCL--FCSYKC   81 (101)
Q Consensus        71 ~~~c~--~c~~~f   81 (101)
                      .+.|.  .||.+|
T Consensus        27 Y~qC~N~eCg~tF   39 (72)
T PRK09678         27 YHQCQNVNCSATF   39 (72)
T ss_pred             eeecCCCCCCCEE
Confidence            34454  455544


No 91 
>KOG3408|consensus
Probab=66.85  E-value=3.9  Score=22.77  Aligned_cols=21  Identities=14%  Similarity=0.392  Sum_probs=15.7

Q ss_pred             eeccccccccCChHHHHHHHH
Q psy10080         72 QMCLFCSYKCKHKTDIMHHMR   92 (101)
Q Consensus        72 ~~c~~c~~~f~~~~~l~~h~~   92 (101)
                      |-|..|.+.|.....|..|.+
T Consensus        58 fyCi~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   58 FYCIECARYFIDAKALKTHFK   78 (129)
T ss_pred             eehhhhhhhhcchHHHHHHHh
Confidence            567777777877777777765


No 92 
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=64.81  E-value=6.8  Score=19.06  Aligned_cols=9  Identities=33%  Similarity=0.748  Sum_probs=5.0

Q ss_pred             Cceeccccc
Q psy10080         70 PSQMCLFCS   78 (101)
Q Consensus        70 ~~~~c~~c~   78 (101)
                      ..|.|+.|.
T Consensus        30 rtymC~eC~   38 (68)
T COG4896          30 RTYMCPECE   38 (68)
T ss_pred             eeEechhhH
Confidence            346666664


No 93 
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=63.93  E-value=4.2  Score=18.88  Aligned_cols=16  Identities=25%  Similarity=0.582  Sum_probs=12.1

Q ss_pred             cccccCcchhhccChH
Q psy10080         41 TTWACPMCRKIYAFKY   56 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~   56 (101)
                      +++.|..||..|....
T Consensus         3 k~l~C~dCg~~FvfTa   18 (49)
T PF13451_consen    3 KTLTCKDCGAEFVFTA   18 (49)
T ss_pred             eeEEcccCCCeEEEeh
Confidence            5778999998777654


No 94 
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=61.98  E-value=13  Score=16.38  Aligned_cols=9  Identities=44%  Similarity=1.434  Sum_probs=4.2

Q ss_pred             ccCcchhhc
Q psy10080         44 ACPMCRKIY   52 (101)
Q Consensus        44 ~C~~c~~~~   52 (101)
                      .|+.||..|
T Consensus        15 ~C~~CgM~Y   23 (41)
T PF13878_consen   15 TCPTCGMLY   23 (41)
T ss_pred             CCCCCCCEE
Confidence            445555443


No 95 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=61.94  E-value=3.3  Score=16.18  Aligned_cols=10  Identities=30%  Similarity=0.936  Sum_probs=7.5

Q ss_pred             cccccCcchh
Q psy10080         41 TTWACPMCRK   50 (101)
Q Consensus        41 ~p~~C~~c~~   50 (101)
                      -+|.|+.||.
T Consensus        15 v~f~CPnCG~   24 (24)
T PF07754_consen   15 VPFPCPNCGF   24 (24)
T ss_pred             ceEeCCCCCC
Confidence            3788888873


No 96 
>KOG4167|consensus
Probab=61.63  E-value=2.6  Score=30.53  Aligned_cols=26  Identities=15%  Similarity=0.368  Sum_probs=22.7

Q ss_pred             ccccCcchhhccChHHHHHHhhhhhC
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRVECG   67 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~h~~   67 (101)
                      -|.|..|++.|.....+-.||+.|.-
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            58899999999988888899988864


No 97 
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=61.01  E-value=2.2  Score=22.45  Aligned_cols=30  Identities=33%  Similarity=0.688  Sum_probs=18.7

Q ss_pred             cccccCcchhhccChHHHHHHhhhhhCCCCceecccccccc
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKC   81 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f   81 (101)
                      ..|.|+.|++.-.        .+...|   .|.|..|++.|
T Consensus        34 ~ky~Cp~Cgk~~v--------kR~a~G---IW~C~~C~~~~   63 (90)
T PF01780_consen   34 AKYTCPFCGKTSV--------KRVATG---IWKCKKCGKKF   63 (90)
T ss_dssp             S-BEESSSSSSEE--------EEEETT---EEEETTTTEEE
T ss_pred             CCCcCCCCCCcee--------EEeeeE---EeecCCCCCEE
Confidence            3688888886421        133344   58888888766


No 98 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=60.86  E-value=2.6  Score=23.82  Aligned_cols=16  Identities=19%  Similarity=0.586  Sum_probs=12.5

Q ss_pred             CcccccCcchhhccCh
Q psy10080         40 KTTWACPMCRKIYAFK   55 (101)
Q Consensus        40 ~~p~~C~~c~~~~~~~   55 (101)
                      ...+.|..||..|...
T Consensus        68 p~~~~C~~CG~~~~~~   83 (135)
T PRK03824         68 EAVLKCRNCGNEWSLK   83 (135)
T ss_pred             ceEEECCCCCCEEecc
Confidence            3578999999887754


No 99 
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=60.78  E-value=8  Score=22.04  Aligned_cols=23  Identities=22%  Similarity=0.251  Sum_probs=14.3

Q ss_pred             eeccccccccCChHHHHHHHHHhcCC
Q psy10080         72 QMCLFCSYKCKHKTDIMHHMRLKHKE   97 (101)
Q Consensus        72 ~~c~~c~~~f~~~~~l~~h~~~h~~e   97 (101)
                      ..|.++|+.|.   +|.+|+.+|.|.
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~gm   99 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYGL   99 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccCC
Confidence            45666666653   567777776654


No 100
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=60.53  E-value=3.2  Score=17.84  Aligned_cols=31  Identities=16%  Similarity=0.457  Sum_probs=19.5

Q ss_pred             ccccCcchhhccChHHHHHHhhhhhCCCCceeccccccc
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYK   80 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~   80 (101)
                      .|.|..|+..|......      ..+  ....|+.||..
T Consensus         5 ~y~C~~Cg~~fe~~~~~------~~~--~~~~CP~Cg~~   35 (41)
T smart00834        5 EYRCEDCGHTFEVLQKI------SDD--PLATCPECGGD   35 (41)
T ss_pred             EEEcCCCCCEEEEEEec------CCC--CCCCCCCCCCc
Confidence            47899999887654321      112  23569999864


No 101
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=57.90  E-value=3.7  Score=21.63  Aligned_cols=31  Identities=26%  Similarity=0.512  Sum_probs=19.8

Q ss_pred             cccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccC
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCK   82 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~   82 (101)
                      ..|.|+.|++.-.        .+...+   .|.|..|++.|.
T Consensus        35 a~y~CpfCgk~~v--------kR~a~G---IW~C~~C~~~~A   65 (90)
T PTZ00255         35 AKYFCPFCGKHAV--------KRQAVG---IWRCKGCKKTVA   65 (90)
T ss_pred             CCccCCCCCCCce--------eeeeeE---EEEcCCCCCEEe
Confidence            4788999985311        122334   588988987774


No 102
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=56.53  E-value=5.3  Score=21.88  Aligned_cols=11  Identities=0%  Similarity=0.015  Sum_probs=6.5

Q ss_pred             ceecccccccc
Q psy10080         71 SQMCLFCSYKC   81 (101)
Q Consensus        71 ~~~c~~c~~~f   81 (101)
                      |..|+.||++|
T Consensus        26 PiVsPytG~s~   36 (129)
T COG4530          26 PIVSPYTGKSY   36 (129)
T ss_pred             ccccCcccccc
Confidence            45566666665


No 103
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=56.26  E-value=5.1  Score=23.51  Aligned_cols=49  Identities=20%  Similarity=0.282  Sum_probs=29.1

Q ss_pred             cccccceecccCCCcccccCcchhhccChHHHHHHhhhhhCCCCceeccccccc
Q psy10080         27 KMLVPYNVDKEGKKTTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYK   80 (101)
Q Consensus        27 ~~~~~~~~~~~~~~~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~   80 (101)
                      +...+.-...|+.-....|..|++.+.......   ..... . ...|+.|+..
T Consensus        90 ~AG~~~vielHG~l~~~~C~~C~~~~~~~~~~~---~~~~~-~-~~~C~~C~~~  138 (178)
T PF02146_consen   90 KAGSPKVIELHGSLFRLRCSKCGKEYDREDIVD---SIDEE-E-PPRCPKCGGL  138 (178)
T ss_dssp             HTTESCEEETTEEEEEEEETTTSBEEEGHHHHH---HHHTT-S-SCBCTTTSCB
T ss_pred             cccchhhHHHHhhhceeeecCCCccccchhhcc---ccccc-c-cccccccCcc
Confidence            333344455677777889999999877543221   12222 2 2368888753


No 104
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=56.13  E-value=3.6  Score=21.73  Aligned_cols=31  Identities=29%  Similarity=0.577  Sum_probs=19.7

Q ss_pred             cccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccC
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCK   82 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~   82 (101)
                      ..|.|+.|++.-.        .+...+   .|.|..|++.|.
T Consensus        34 a~y~CpfCgk~~v--------kR~a~G---IW~C~~C~~~~A   64 (91)
T TIGR00280        34 AKYVCPFCGKKTV--------KRGSTG---IWTCRKCGAKFA   64 (91)
T ss_pred             cCccCCCCCCCce--------EEEeeE---EEEcCCCCCEEe
Confidence            4788998875311        133334   588888887763


No 105
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=55.68  E-value=3.4  Score=19.35  Aligned_cols=27  Identities=15%  Similarity=0.600  Sum_probs=15.4

Q ss_pred             CcccccCcchhhccChHHHHHHhhhhh
Q psy10080         40 KTTWACPMCRKIYAFKYNLMRHLRVEC   66 (101)
Q Consensus        40 ~~p~~C~~c~~~~~~~~~l~~h~~~h~   66 (101)
                      ...|.|+.|.+.|-..-.+-.|...|.
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiHE~LH~   45 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIHETLHN   45 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTTTTS-S
T ss_pred             CCeEECCCCCCccccCcChhhhccccC
Confidence            347999999999988887777755544


No 106
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=55.14  E-value=8.2  Score=25.20  Aligned_cols=57  Identities=25%  Similarity=0.571  Sum_probs=44.4

Q ss_pred             CCcccccCcchhhccChHHHHHHhhhhhCCCCceeccc--cccccCChHHHHHHHHHhcC
Q psy10080         39 KKTTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLF--CSYKCKHKTDIMHHMRLKHK   96 (101)
Q Consensus        39 ~~~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~--c~~~f~~~~~l~~h~~~h~~   96 (101)
                      ..+++.|..|...|........|.+.+.+ .+++.|..  |...+.....+..|.+.++.
T Consensus        30 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   88 (467)
T COG5048          30 APRPDSCPNCTDSFSRLEHLTRHIRSHTG-EKPSQCSYSGCDKSFSRPLELSRHLRTHHN   88 (467)
T ss_pred             CCchhhcccccccccccchhhhhcccccc-cCCccccccccccccCCcchhhhhcccccc
Confidence            34688899999999999889999999999 77777765  55677777777777766554


No 107
>PLN02294 cytochrome c oxidase subunit Vb
Probab=54.88  E-value=9.6  Score=22.60  Aligned_cols=11  Identities=27%  Similarity=0.464  Sum_probs=5.9

Q ss_pred             ceecccccccc
Q psy10080         71 SQMCLFCSYKC   81 (101)
Q Consensus        71 ~~~c~~c~~~f   81 (101)
                      +..|..||..|
T Consensus       141 p~RCpeCG~~f  151 (174)
T PLN02294        141 SFECPVCTQYF  151 (174)
T ss_pred             ceeCCCCCCEE
Confidence            45565565544


No 108
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=54.67  E-value=4.4  Score=17.92  Aligned_cols=30  Identities=13%  Similarity=0.414  Sum_probs=19.6

Q ss_pred             ccccCcchhhccChHHHHHHhhhhhCCCCceecccccc
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSY   79 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~   79 (101)
                      .|.|..||..|.....      +..  ..+..|+.|+.
T Consensus         5 ey~C~~Cg~~fe~~~~------~~~--~~~~~CP~Cg~   34 (42)
T PF09723_consen    5 EYRCEECGHEFEVLQS------ISE--DDPVPCPECGS   34 (42)
T ss_pred             EEEeCCCCCEEEEEEE------cCC--CCCCcCCCCCC
Confidence            4789999988775432      111  23457999986


No 109
>KOG2593|consensus
Probab=54.16  E-value=8.9  Score=26.09  Aligned_cols=36  Identities=22%  Similarity=0.406  Sum_probs=20.7

Q ss_pred             CcccccCcchhhccChHHHHHHhhhhhCCCCceecccccc
Q psy10080         40 KTTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSY   79 (101)
Q Consensus        40 ~~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~   79 (101)
                      ..-|.|+.|.+.|...-.+   +-+-.. .-.|.|..|+.
T Consensus       126 ~~~Y~Cp~C~kkyt~Lea~---~L~~~~-~~~F~C~~C~g  161 (436)
T KOG2593|consen  126 VAGYVCPNCQKKYTSLEAL---QLLDNE-TGEFHCENCGG  161 (436)
T ss_pred             cccccCCccccchhhhHHH---Hhhccc-CceEEEecCCC
Confidence            3468888888777654332   222221 22577877764


No 110
>KOG4173|consensus
Probab=53.71  E-value=7.9  Score=23.77  Aligned_cols=47  Identities=30%  Similarity=0.565  Sum_probs=31.1

Q ss_pred             ccCcchhhccChHHHHHHhh-h---------hhCCCCceeccc--cccccCChHHHHHHH
Q psy10080         44 ACPMCRKIYAFKYNLMRHLR-V---------ECGKEPSQMCLF--CSYKCKHKTDIMHHM   91 (101)
Q Consensus        44 ~C~~c~~~~~~~~~l~~h~~-~---------h~~~~~~~~c~~--c~~~f~~~~~l~~h~   91 (101)
                      .|..|.+.|.+...|..|+. +         -.| ..-|.|.+  |+-.|...-.-..|+
T Consensus       108 sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG-~dMy~ClvEgCt~KFkT~r~RkdH~  166 (253)
T KOG4173|consen  108 SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERG-QDMYQCLVEGCTEKFKTSRDRKDHM  166 (253)
T ss_pred             hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcC-ccHHHHHHHhhhhhhhhhhhhhhHH
Confidence            68888888888877777743 1         233 34566743  777777766666664


No 111
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=52.15  E-value=10  Score=16.96  Aligned_cols=17  Identities=12%  Similarity=0.434  Sum_probs=11.5

Q ss_pred             eeccccccccCChHHHH
Q psy10080         72 QMCLFCSYKCKHKTDIM   88 (101)
Q Consensus        72 ~~c~~c~~~f~~~~~l~   88 (101)
                      -.|..|++.|++..-..
T Consensus         9 K~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen    9 KICPVCGRPFTWRKKWA   25 (42)
T ss_pred             CcCcccCCcchHHHHHH
Confidence            35888888887665443


No 112
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=52.13  E-value=3.8  Score=17.58  Aligned_cols=31  Identities=26%  Similarity=0.607  Sum_probs=17.7

Q ss_pred             cccCcchhhccChHHHHHHhhhhhCCCCceeccccccccC
Q psy10080         43 WACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCK   82 (101)
Q Consensus        43 ~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~   82 (101)
                      +.|+.||.+|.....        .. ...-.|..||..+.
T Consensus         2 r~C~~Cg~~Yh~~~~--------pP-~~~~~Cd~cg~~L~   32 (36)
T PF05191_consen    2 RICPKCGRIYHIEFN--------PP-KVEGVCDNCGGELV   32 (36)
T ss_dssp             EEETTTTEEEETTTB-----------SSTTBCTTTTEBEB
T ss_pred             cCcCCCCCccccccC--------CC-CCCCccCCCCCeeE
Confidence            357788877664321        12 33456888876543


No 113
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=52.11  E-value=2.5  Score=23.68  Aligned_cols=15  Identities=20%  Similarity=0.598  Sum_probs=8.4

Q ss_pred             CceeccccccccCCh
Q psy10080         70 PSQMCLFCSYKCKHK   84 (101)
Q Consensus        70 ~~~~c~~c~~~f~~~   84 (101)
                      +|.-|..||+.|+|.
T Consensus        67 ~psfchncgs~fpwt   81 (160)
T COG4306          67 PPSFCHNCGSRFPWT   81 (160)
T ss_pred             CcchhhcCCCCCCcH
Confidence            344466666666554


No 114
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=51.69  E-value=7.9  Score=26.32  Aligned_cols=29  Identities=17%  Similarity=0.401  Sum_probs=18.2

Q ss_pred             ccCcchhhccChHHHHHHhhhhhCCCCceeccccccccCCh
Q psy10080         44 ACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCKHK   84 (101)
Q Consensus        44 ~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~   84 (101)
                      .|+.||..+.+..            ..-|.|..|+..+...
T Consensus       352 ~Cp~Cg~~m~S~G------------~~g~rC~kCg~~~~~~  380 (421)
T COG1571         352 VCPRCGGRMKSAG------------RNGFRCKKCGTRARET  380 (421)
T ss_pred             CCCccCCchhhcC------------CCCcccccccccCCcc
Confidence            6888886544322            2267888888776544


No 115
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=51.42  E-value=5.9  Score=21.17  Aligned_cols=17  Identities=24%  Similarity=0.696  Sum_probs=13.1

Q ss_pred             cCCCcccccCcchhhccC
Q psy10080         37 EGKKTTWACPMCRKIYAF   54 (101)
Q Consensus        37 ~~~~~p~~C~~c~~~~~~   54 (101)
                      +.+ +|.+|..||..|.-
T Consensus        75 ~~g-~~~rC~eCG~~fkL   91 (97)
T cd00924          75 EKG-KPKRCPECGHVFKL   91 (97)
T ss_pred             eCC-CceeCCCCCcEEEE
Confidence            344 59999999988763


No 116
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=50.85  E-value=4.7  Score=21.25  Aligned_cols=31  Identities=29%  Similarity=0.558  Sum_probs=19.3

Q ss_pred             cccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccC
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCK   82 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~   82 (101)
                      ..|.|+.|++.-.        .+...+   .|.|..|++.|.
T Consensus        35 a~y~CpfCgk~~v--------kR~a~G---IW~C~~C~~~~A   65 (90)
T PRK03976         35 AKHVCPVCGRPKV--------KRVGTG---IWECRKCGAKFA   65 (90)
T ss_pred             cCccCCCCCCCce--------EEEEEE---EEEcCCCCCEEe
Confidence            4788888875311        133334   578888887764


No 117
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=50.30  E-value=7  Score=17.04  Aligned_cols=14  Identities=14%  Similarity=0.645  Sum_probs=11.0

Q ss_pred             ccccCcchhhccCh
Q psy10080         42 TWACPMCRKIYAFK   55 (101)
Q Consensus        42 p~~C~~c~~~~~~~   55 (101)
                      |+.|..|++.|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            78899898887653


No 118
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=50.25  E-value=7.5  Score=21.27  Aligned_cols=27  Identities=15%  Similarity=0.317  Sum_probs=17.1

Q ss_pred             CcccccCcchhhccChHHHHHHhhhhhCCCCceecccccc
Q psy10080         40 KTTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSY   79 (101)
Q Consensus        40 ~~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~   79 (101)
                      .-.+.|..|+..|....             ..+.|+.||.
T Consensus        68 p~~~~C~~Cg~~~~~~~-------------~~~~CP~Cgs   94 (113)
T PRK12380         68 PAQAWCWDCSQVVEIHQ-------------HDAQCPHCHG   94 (113)
T ss_pred             CcEEEcccCCCEEecCC-------------cCccCcCCCC
Confidence            34678899986655421             2355888874


No 119
>KOG0717|consensus
Probab=50.05  E-value=11  Score=25.99  Aligned_cols=21  Identities=19%  Similarity=0.529  Sum_probs=15.7

Q ss_pred             eeccccccccCChHHHHHHHH
Q psy10080         72 QMCLFCSYKCKHKTDIMHHMR   92 (101)
Q Consensus        72 ~~c~~c~~~f~~~~~l~~h~~   92 (101)
                      +-|.+|.++|.+...|..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            348888888888888877765


No 120
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=49.80  E-value=6.6  Score=18.27  Aligned_cols=12  Identities=17%  Similarity=0.567  Sum_probs=6.4

Q ss_pred             eccccccccCCh
Q psy10080         73 MCLFCSYKCKHK   84 (101)
Q Consensus        73 ~c~~c~~~f~~~   84 (101)
                      .|++|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            799999998743


No 121
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=49.58  E-value=8.1  Score=21.20  Aligned_cols=27  Identities=15%  Similarity=0.227  Sum_probs=17.5

Q ss_pred             cccccCcchhhccChHHHHHHhhhhhCCCCceeccccccc
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYK   80 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~   80 (101)
                      -...|..|+..|....             ..+.|+.|+..
T Consensus        69 ~~~~C~~Cg~~~~~~~-------------~~~~CP~Cgs~   95 (115)
T TIGR00100        69 VECECEDCSEEVSPEI-------------DLYRCPKCHGI   95 (115)
T ss_pred             cEEEcccCCCEEecCC-------------cCccCcCCcCC
Confidence            3578999987665431             13568888743


No 122
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=49.22  E-value=7.2  Score=21.38  Aligned_cols=29  Identities=14%  Similarity=0.378  Sum_probs=17.5

Q ss_pred             CcccccCcchhhccChHHHHHHhhhhhCCCCceeccccccc
Q psy10080         40 KTTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYK   80 (101)
Q Consensus        40 ~~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~   80 (101)
                      .-.+.|..|+..|....            ...+.|+.||..
T Consensus        68 p~~~~C~~Cg~~~~~~~------------~~~~~CP~Cgs~   96 (114)
T PRK03681         68 EAECWCETCQQYVTLLT------------QRVRRCPQCHGD   96 (114)
T ss_pred             CcEEEcccCCCeeecCC------------ccCCcCcCcCCC
Confidence            34678999987554321            112568888843


No 123
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=48.58  E-value=12  Score=16.32  Aligned_cols=19  Identities=11%  Similarity=0.205  Sum_probs=12.1

Q ss_pred             ceeccccccccCChHHHHH
Q psy10080         71 SQMCLFCSYKCKHKTDIMH   89 (101)
Q Consensus        71 ~~~c~~c~~~f~~~~~l~~   89 (101)
                      ...|..|+..+.....|.+
T Consensus        19 id~C~~C~G~W~d~~el~~   37 (41)
T PF13453_consen   19 IDVCPSCGGIWFDAGELEK   37 (41)
T ss_pred             EEECCCCCeEEccHHHHHH
Confidence            4567777777666665543


No 124
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=48.45  E-value=6.4  Score=16.98  Aligned_cols=13  Identities=23%  Similarity=0.649  Sum_probs=7.2

Q ss_pred             cccccCcchhhcc
Q psy10080         41 TTWACPMCRKIYA   53 (101)
Q Consensus        41 ~p~~C~~c~~~~~   53 (101)
                      +-|+|..||++..
T Consensus         5 ~~YkC~~CGniVe   17 (36)
T PF06397_consen    5 EFYKCEHCGNIVE   17 (36)
T ss_dssp             EEEE-TTT--EEE
T ss_pred             cEEEccCCCCEEE
Confidence            3689999998643


No 125
>KOG2071|consensus
Probab=48.37  E-value=12  Score=26.48  Aligned_cols=28  Identities=11%  Similarity=0.245  Sum_probs=22.7

Q ss_pred             CcccccCcchhhccChHHHHHHhhhhhC
Q psy10080         40 KTTWACPMCRKIYAFKYNLMRHLRVECG   67 (101)
Q Consensus        40 ~~p~~C~~c~~~~~~~~~l~~h~~~h~~   67 (101)
                      ..|.+|..||..|........|+..|..
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~d  443 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHDD  443 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhhh
Confidence            4678999999999999888877766643


No 126
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=48.24  E-value=6.5  Score=17.98  Aligned_cols=30  Identities=17%  Similarity=0.494  Sum_probs=19.0

Q ss_pred             ccccCcchhhccChHHHHHHhhhhhCCCCceecccccc
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSY   79 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~   79 (101)
                      .|.|..|+..|.....      ...  .....|+.|+.
T Consensus         5 ey~C~~Cg~~fe~~~~------~~~--~~~~~CP~Cg~   34 (52)
T TIGR02605         5 EYRCTACGHRFEVLQK------MSD--DPLATCPECGG   34 (52)
T ss_pred             EEEeCCCCCEeEEEEe------cCC--CCCCCCCCCCC
Confidence            4789999988775421      111  22356999985


No 127
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=45.62  E-value=22  Score=16.15  Aligned_cols=21  Identities=29%  Similarity=0.972  Sum_probs=12.6

Q ss_pred             eeccccccccCChHHHHHHHH
Q psy10080         72 QMCLFCSYKCKHKTDIMHHMR   92 (101)
Q Consensus        72 ~~c~~c~~~f~~~~~l~~h~~   92 (101)
                      |.|-.|.-+..-.+.|-.|+.
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            445556555556666666665


No 128
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=45.05  E-value=6.6  Score=21.45  Aligned_cols=26  Identities=15%  Similarity=0.252  Sum_probs=15.6

Q ss_pred             ccccCcchhhccChHHHHHHhhhhhCCCCceeccccccc
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYK   80 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~   80 (101)
                      ...|..|+..|.....             .+.|+.|+..
T Consensus        70 ~~~C~~Cg~~~~~~~~-------------~~~CP~Cgs~   95 (113)
T PF01155_consen   70 RARCRDCGHEFEPDEF-------------DFSCPRCGSP   95 (113)
T ss_dssp             EEEETTTS-EEECHHC-------------CHH-SSSSSS
T ss_pred             cEECCCCCCEEecCCC-------------CCCCcCCcCC
Confidence            5778889887775431             2458888754


No 129
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=44.65  E-value=20  Score=24.87  Aligned_cols=29  Identities=21%  Similarity=0.232  Sum_probs=23.8

Q ss_pred             CCceeccccccccCChHHHHHHHH-HhcCC
Q psy10080         69 EPSQMCLFCSYKCKHKTDIMHHMR-LKHKE   97 (101)
Q Consensus        69 ~~~~~c~~c~~~f~~~~~l~~h~~-~h~~e   97 (101)
                      ..-+.|+.|.+.|.....+..|+. .|.+.
T Consensus        55 WrFWiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   55 WRFWICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             eeEeeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            456889999999999999999976 45554


No 130
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=44.29  E-value=13  Score=15.26  Aligned_cols=10  Identities=20%  Similarity=0.414  Sum_probs=6.4

Q ss_pred             Cceecccccc
Q psy10080         70 PSQMCLFCSY   79 (101)
Q Consensus        70 ~~~~c~~c~~   79 (101)
                      ..+.|+.|+.
T Consensus        18 ~~~vCp~C~~   27 (30)
T PF08274_consen   18 ELLVCPECGH   27 (30)
T ss_dssp             SSEEETTTTE
T ss_pred             CEEeCCcccc
Confidence            3567777764


No 131
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=44.25  E-value=6.4  Score=20.05  Aligned_cols=32  Identities=16%  Similarity=0.597  Sum_probs=18.2

Q ss_pred             ccccCcchhhccChHHHHHHhhhhhCCCCceecccccccc
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKC   81 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f   81 (101)
                      .|.|..|+..|..    ..++.   . .+.-.|+.|+-.+
T Consensus        12 ~Y~c~~cg~~~dv----vq~~~---d-dplt~ce~c~a~~   43 (82)
T COG2331          12 SYECTECGNRFDV----VQAMT---D-DPLTTCEECGARL   43 (82)
T ss_pred             EEeecccchHHHH----HHhcc---c-CccccChhhChHH
Confidence            4789999876543    22222   2 3344577776543


No 132
>PRK14138 NAD-dependent deacetylase; Provisional
Probab=43.99  E-value=30  Score=21.60  Aligned_cols=43  Identities=21%  Similarity=0.389  Sum_probs=26.2

Q ss_pred             ceecccCCCcccccCcchhhccChHHHHHHhhhhhCCCCceecccccc
Q psy10080         32 YNVDKEGKKTTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSY   79 (101)
Q Consensus        32 ~~~~~~~~~~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~   79 (101)
                      .-...|+.-....|..|++.+.....+.   ..... ..| .|+.|+.
T Consensus       109 ~VielHG~~~~~~C~~C~~~~~~~~~~~---~~~~~-~~p-~Cp~Cgg  151 (244)
T PRK14138        109 KVIELHGNVEEYYCVRCGKRYTVEDVIE---KLEKS-DVP-RCDDCSG  151 (244)
T ss_pred             eEEEccCCcCeeEECCCCCcccHHHHHH---HHhcC-CCC-CCCCCCC
Confidence            4455688777889999998876543322   11112 223 5888863


No 133
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=43.84  E-value=9.3  Score=21.05  Aligned_cols=15  Identities=20%  Similarity=0.583  Sum_probs=10.5

Q ss_pred             CcccccCcchhhccC
Q psy10080         40 KTTWACPMCRKIYAF   54 (101)
Q Consensus        40 ~~p~~C~~c~~~~~~   54 (101)
                      +-.+.|..|+..|..
T Consensus        69 p~~~~C~~Cg~~~~~   83 (117)
T PRK00564         69 KVELECKDCSHVFKP   83 (117)
T ss_pred             CCEEEhhhCCCcccc
Confidence            346789999876654


No 134
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=41.83  E-value=17  Score=22.91  Aligned_cols=43  Identities=19%  Similarity=0.270  Sum_probs=25.5

Q ss_pred             ceecccCCCcccccCcchhhccChHHHHHHhhhhhCCCCceecccccc
Q psy10080         32 YNVDKEGKKTTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSY   79 (101)
Q Consensus        32 ~~~~~~~~~~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~   79 (101)
                      .-...|+.-..+.|..|+..+........   ...+ . +-.|+.|+.
T Consensus       112 ~Vi~lHGsl~~~~C~~C~~~~~~~~~~~~---~~~~-~-~p~C~~Cg~  154 (250)
T COG0846         112 NVIELHGSLKRVRCSKCGNQYYDEDVIKF---IEDG-L-IPRCPKCGG  154 (250)
T ss_pred             cEEEeccceeeeEeCCCcCccchhhhhhh---cccC-C-CCcCccCCC
Confidence            44455777788999999877664331111   1111 2 235888886


No 135
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=41.61  E-value=7.8  Score=17.15  Aligned_cols=15  Identities=27%  Similarity=0.762  Sum_probs=9.2

Q ss_pred             cccccCcchhhccCh
Q psy10080         41 TTWACPMCRKIYAFK   55 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~   55 (101)
                      -|+.|..|++.|-..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            388999999887754


No 136
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=40.60  E-value=12  Score=20.55  Aligned_cols=25  Identities=20%  Similarity=0.368  Sum_probs=16.9

Q ss_pred             ceeccccccccCChHHHHHHHHHhc
Q psy10080         71 SQMCLFCSYKCKHKTDIMHHMRLKH   95 (101)
Q Consensus        71 ~~~c~~c~~~f~~~~~l~~h~~~h~   95 (101)
                      .|.|..|...|...-++--|..+|.
T Consensus        81 ~y~C~~C~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        81 RYVCAVCKNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             ceeCCCCCCccccccchhhhhhccC
Confidence            4677777777776666666666553


No 137
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=39.44  E-value=11  Score=20.47  Aligned_cols=21  Identities=19%  Similarity=0.520  Sum_probs=17.1

Q ss_pred             eeccccccccCChHHHHHHHH
Q psy10080         72 QMCLFCSYKCKHKTDIMHHMR   92 (101)
Q Consensus        72 ~~c~~c~~~f~~~~~l~~h~~   92 (101)
                      +-|..|.+.|.+...|..|.+
T Consensus        56 hYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          56 HYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             eeeehhHHHHHHHHHHHHHhc
Confidence            448889999999888888865


No 138
>PRK12496 hypothetical protein; Provisional
Probab=39.37  E-value=18  Score=21.21  Aligned_cols=28  Identities=29%  Similarity=0.688  Sum_probs=17.6

Q ss_pred             cccccCcchhhccChHHHHHHhhhhhCCCCceecccccccc
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKC   81 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f   81 (101)
                      ..+.|..|++.|....             ..-.|+.||...
T Consensus       126 w~~~C~gC~~~~~~~~-------------~~~~C~~CG~~~  153 (164)
T PRK12496        126 WRKVCKGCKKKYPEDY-------------PDDVCEICGSPV  153 (164)
T ss_pred             eeEECCCCCccccCCC-------------CCCcCCCCCChh
Confidence            3477999998775321             113488898654


No 139
>KOG2482|consensus
Probab=39.36  E-value=23  Score=23.63  Aligned_cols=53  Identities=23%  Similarity=0.466  Sum_probs=35.9

Q ss_pred             cccccCcchhh-ccChHHHHHHhhh-hh---CC-----------------CCceeccccccccCChHHHHHHHHH
Q psy10080         41 TTWACPMCRKI-YAFKYNLMRHLRV-EC---GK-----------------EPSQMCLFCSYKCKHKTDIMHHMRL   93 (101)
Q Consensus        41 ~p~~C~~c~~~-~~~~~~l~~h~~~-h~---~~-----------------~~~~~c~~c~~~f~~~~~l~~h~~~   93 (101)
                      +..+|-.|... ....+.+..|... |.   |.                 -..+.|..|.+.|.....|..|||.
T Consensus       143 fslqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  143 FSLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             eeeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHh
Confidence            45668888764 4455666666442 21   10                 1136799999999999999999984


No 140
>PF14369 zf-RING_3:  zinc-finger
Probab=38.97  E-value=14  Score=15.72  Aligned_cols=10  Identities=20%  Similarity=0.301  Sum_probs=7.2

Q ss_pred             eccccccccC
Q psy10080         73 MCLFCSYKCK   82 (101)
Q Consensus        73 ~c~~c~~~f~   82 (101)
                      .|+.|+..|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            4888887764


No 141
>PRK14873 primosome assembly protein PriA; Provisional
Probab=38.95  E-value=20  Score=25.98  Aligned_cols=10  Identities=20%  Similarity=0.421  Sum_probs=6.5

Q ss_pred             ceeccccccc
Q psy10080         71 SQMCLFCSYK   80 (101)
Q Consensus        71 ~~~c~~c~~~   80 (101)
                      ++.|+.|+..
T Consensus       422 p~~Cp~Cgs~  431 (665)
T PRK14873        422 DWRCPRCGSD  431 (665)
T ss_pred             CccCCCCcCC
Confidence            5667777653


No 142
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=38.73  E-value=18  Score=24.85  Aligned_cols=9  Identities=33%  Similarity=0.837  Sum_probs=5.1

Q ss_pred             cccccCcch
Q psy10080         41 TTWACPMCR   49 (101)
Q Consensus        41 ~p~~C~~c~   49 (101)
                      .-++|+.|+
T Consensus        20 ~~g~Cp~C~   28 (454)
T TIGR00416        20 WQGKCPACH   28 (454)
T ss_pred             ccEECcCCC
Confidence            445566665


No 143
>PRK11823 DNA repair protein RadA; Provisional
Probab=38.52  E-value=21  Score=24.46  Aligned_cols=8  Identities=38%  Similarity=0.903  Sum_probs=3.8

Q ss_pred             ccccCcch
Q psy10080         42 TWACPMCR   49 (101)
Q Consensus        42 p~~C~~c~   49 (101)
                      -++|+.|+
T Consensus        21 ~g~Cp~C~   28 (446)
T PRK11823         21 LGRCPECG   28 (446)
T ss_pred             CeeCcCCC
Confidence            34455554


No 144
>PRK05978 hypothetical protein; Provisional
Probab=38.26  E-value=17  Score=21.07  Aligned_cols=33  Identities=27%  Similarity=0.575  Sum_probs=18.6

Q ss_pred             ccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccCCh
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCKHK   84 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~   84 (101)
                      ..+|+.|++.--..+.|          +..-.|+.||..|...
T Consensus        33 ~grCP~CG~G~LF~g~L----------kv~~~C~~CG~~~~~~   65 (148)
T PRK05978         33 RGRCPACGEGKLFRAFL----------KPVDHCAACGEDFTHH   65 (148)
T ss_pred             cCcCCCCCCCccccccc----------ccCCCccccCCccccC
Confidence            45789998643322222          1123588888776543


No 145
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=38.14  E-value=9  Score=16.35  Aligned_cols=10  Identities=20%  Similarity=0.494  Sum_probs=4.3

Q ss_pred             eecccccccc
Q psy10080         72 QMCLFCSYKC   81 (101)
Q Consensus        72 ~~c~~c~~~f   81 (101)
                      .-|..||-.+
T Consensus        22 isC~~CGPr~   31 (35)
T PF07503_consen   22 ISCTNCGPRY   31 (35)
T ss_dssp             --BTTCC-SC
T ss_pred             ccCCCCCCCE
Confidence            4466776444


No 146
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=37.13  E-value=19  Score=17.42  Aligned_cols=30  Identities=33%  Similarity=0.752  Sum_probs=17.8

Q ss_pred             ccccCcchhhccChHHHHHHhhhhhCCCCceeccccc
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCS   78 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~   78 (101)
                      .|.|+ ||..|.-.  |   .....| +...+|++|+
T Consensus        22 tyPCP-CGDRFeIs--L---eDl~~G-E~VArCPSCS   51 (67)
T COG5216          22 TYPCP-CGDRFEIS--L---EDLRNG-EVVARCPSCS   51 (67)
T ss_pred             EecCC-CCCEeEEE--H---HHhhCC-ceEEEcCCce
Confidence            56666 67666542  1   234566 5556788886


No 147
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=36.43  E-value=3.7  Score=22.05  Aligned_cols=14  Identities=29%  Similarity=0.714  Sum_probs=9.6

Q ss_pred             CcccccCcchhhcc
Q psy10080         40 KTTWACPMCRKIYA   53 (101)
Q Consensus        40 ~~p~~C~~c~~~~~   53 (101)
                      ++.|.|+.|+..-.
T Consensus        20 ~k~FtCp~Cghe~v   33 (104)
T COG4888          20 PKTFTCPRCGHEKV   33 (104)
T ss_pred             CceEecCccCCeee
Confidence            45788888886533


No 148
>KOG0782|consensus
Probab=35.18  E-value=5.7  Score=28.26  Aligned_cols=38  Identities=18%  Similarity=0.352  Sum_probs=21.5

Q ss_pred             cccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccCCh
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCKHK   84 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~~~   84 (101)
                      ..-+|..|++.|.++-      ..|..|.....|..|..+|-.+
T Consensus       252 qeGkC~~CgKgFQQKf------~FhsKEivAisCSWCKqayH~K  289 (1004)
T KOG0782|consen  252 QEGKCNTCGKGFQQKF------FFHSKEIVAISCSWCKQAYHLK  289 (1004)
T ss_pred             hccccchhhhhhhhhe------eeccccEEEEEehHHHHHhhcc
Confidence            3456778887776553      2344434445566676665433


No 149
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=35.10  E-value=18  Score=21.14  Aligned_cols=37  Identities=30%  Similarity=0.482  Sum_probs=23.6

Q ss_pred             CCcccccCcchhhccChHHHHHHhhhhhCCCCceecccccccc
Q psy10080         39 KKTTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKC   81 (101)
Q Consensus        39 ~~~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f   81 (101)
                      ...+|.|. |+.-|...   .+|-.+-.| + .|.|..|+...
T Consensus       114 ~~~~Y~C~-C~q~~l~~---RRhn~~~~g-~-~YrC~~C~gkL  150 (156)
T COG3091         114 TTYPYRCQ-CQQHYLRI---RRHNTVRRG-E-VYRCGKCGGKL  150 (156)
T ss_pred             cceeEEee-cCCccchh---hhccccccc-c-eEEeccCCceE
Confidence            34588999 98765543   344444555 4 58898887543


No 150
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=34.82  E-value=17  Score=16.79  Aligned_cols=15  Identities=13%  Similarity=0.470  Sum_probs=10.3

Q ss_pred             eccccccccCChHHH
Q psy10080         73 MCLFCSYKCKHKTDI   87 (101)
Q Consensus        73 ~c~~c~~~f~~~~~l   87 (101)
                      .|+.|++-|++..-+
T Consensus        14 ICpvCqRPFsWRkKW   28 (54)
T COG4338          14 ICPVCQRPFSWRKKW   28 (54)
T ss_pred             hhhhhcCchHHHHHH
Confidence            578888888766443


No 151
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=34.38  E-value=20  Score=21.00  Aligned_cols=19  Identities=26%  Similarity=0.482  Sum_probs=15.7

Q ss_pred             CcccccCcchhhccChHHH
Q psy10080         40 KTTWACPMCRKIYAFKYNL   58 (101)
Q Consensus        40 ~~p~~C~~c~~~~~~~~~l   58 (101)
                      ..|..|..||+.|.+....
T Consensus        66 ~~PsYC~~CGkpyPWt~~~   84 (158)
T PF10083_consen   66 EAPSYCHNCGKPYPWTENA   84 (158)
T ss_pred             CCChhHHhCCCCCchHHHH
Confidence            3689999999999998553


No 152
>cd01407 SIR2-fam SIR2 family of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose. Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer.
Probab=34.06  E-value=45  Score=20.32  Aligned_cols=44  Identities=20%  Similarity=0.310  Sum_probs=26.1

Q ss_pred             cceecccCCCcccccCcchhhccChHHHHHHhhhhhCCCCceecccccc
Q psy10080         31 PYNVDKEGKKTTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSY   79 (101)
Q Consensus        31 ~~~~~~~~~~~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~   79 (101)
                      +.-...|+.-....|..|++.+......   ...... .. -.|+.|+.
T Consensus        98 ~~v~elHG~~~~~~C~~C~~~~~~~~~~---~~~~~~-~~-p~C~~Cg~  141 (218)
T cd01407          98 PKVIELHGSLFRVRCTKCGKEYPRDELQ---ADIDRE-EV-PRCPKCGG  141 (218)
T ss_pred             CCEEECcCCcCcceeCCCcCCCcHHHHh---HhhccC-CC-CcCCCCCC
Confidence            3556668887788999999876544221   111122 22 35888864


No 153
>COG1773 Rubredoxin [Energy production and conversion]
Probab=33.90  E-value=15  Score=17.50  Aligned_cols=14  Identities=29%  Similarity=1.030  Sum_probs=10.5

Q ss_pred             ccccCcchhhccCh
Q psy10080         42 TWACPMCRKIYAFK   55 (101)
Q Consensus        42 p~~C~~c~~~~~~~   55 (101)
                      .|+|..||..|.-.
T Consensus         3 ~~~C~~CG~vYd~e   16 (55)
T COG1773           3 RWRCSVCGYVYDPE   16 (55)
T ss_pred             ceEecCCceEeccc
Confidence            68899999776543


No 154
>PTZ00409 Sir2 (Silent Information Regulator) protein; Provisional
Probab=33.76  E-value=60  Score=20.78  Aligned_cols=24  Identities=21%  Similarity=0.326  Sum_probs=17.1

Q ss_pred             ceecccCCCcccccCcchhhccCh
Q psy10080         32 YNVDKEGKKTTWACPMCRKIYAFK   55 (101)
Q Consensus        32 ~~~~~~~~~~p~~C~~c~~~~~~~   55 (101)
                      .-...|+.-....|..|+..+...
T Consensus       127 ~V~ElHG~l~~~~C~~C~~~~~~~  150 (271)
T PTZ00409        127 KVIPLHGSVFEARCCTCRKTIQLN  150 (271)
T ss_pred             cEEEeccCcCcceeCCCCCCcccC
Confidence            345567777788899998776543


No 155
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=33.57  E-value=26  Score=25.81  Aligned_cols=12  Identities=25%  Similarity=0.421  Sum_probs=8.0

Q ss_pred             CCceeccccccc
Q psy10080         69 EPSQMCLFCSYK   80 (101)
Q Consensus        69 ~~~~~c~~c~~~   80 (101)
                      ..|..|+.||..
T Consensus       473 ~~p~~Cp~Cgs~  484 (730)
T COG1198         473 PIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCC
Confidence            456778888754


No 156
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=33.26  E-value=27  Score=16.13  Aligned_cols=11  Identities=27%  Similarity=0.498  Sum_probs=8.1

Q ss_pred             ceecccccccc
Q psy10080         71 SQMCLFCSYKC   81 (101)
Q Consensus        71 ~~~c~~c~~~f   81 (101)
                      .+.|..|+..+
T Consensus        37 r~~C~~Cgyt~   47 (50)
T PRK00432         37 RWHCGKCGYTE   47 (50)
T ss_pred             cEECCCcCCEE
Confidence            57788888654


No 157
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=33.14  E-value=24  Score=22.77  Aligned_cols=12  Identities=17%  Similarity=0.537  Sum_probs=7.4

Q ss_pred             ceeccccccccC
Q psy10080         71 SQMCLFCSYKCK   82 (101)
Q Consensus        71 ~~~c~~c~~~f~   82 (101)
                      .+.|+.|+.-|.
T Consensus        45 ~~vc~~c~~h~r   56 (285)
T TIGR00515        45 LEVCPKCDHHMR   56 (285)
T ss_pred             CCCCCCCCCcCc
Confidence            356777776554


No 158
>KOG2923|consensus
Probab=32.96  E-value=32  Score=16.96  Aligned_cols=30  Identities=30%  Similarity=0.746  Sum_probs=16.9

Q ss_pred             ccccCcchhhccChHHHHHHhhhhhCCCCceeccccc
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCS   78 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~   78 (101)
                      .|.|+ ||..|.....     ..-.| +....|+.|+
T Consensus        22 ~yPCp-CGDrf~It~e-----dL~~g-e~Va~CpsCS   51 (67)
T KOG2923|consen   22 YYPCP-CGDRFQITLE-----DLENG-EDVARCPSCS   51 (67)
T ss_pred             EcCCC-CCCeeeecHH-----HHhCC-CeeecCCCce
Confidence            45565 6766654322     33455 4446788886


No 159
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=32.93  E-value=12  Score=21.37  Aligned_cols=18  Identities=28%  Similarity=0.746  Sum_probs=13.4

Q ss_pred             cCCCcccccCcchhhccCh
Q psy10080         37 EGKKTTWACPMCRKIYAFK   55 (101)
Q Consensus        37 ~~~~~p~~C~~c~~~~~~~   55 (101)
                      +.++ |.+|+.||..|.-.
T Consensus       108 ~~g~-~~RCpeCG~~fkL~  125 (136)
T PF01215_consen  108 HKGK-PQRCPECGQVFKLK  125 (136)
T ss_dssp             ETTS-EEEETTTEEEEEEE
T ss_pred             eCCC-ccCCCCCCeEEEEE
Confidence            3444 89999999887643


No 160
>COG4855 Uncharacterized protein conserved in archaea [Function unknown]
Probab=32.60  E-value=20  Score=17.84  Aligned_cols=28  Identities=11%  Similarity=0.262  Sum_probs=12.5

Q ss_pred             eccccccccCChHHHHHHHHHhcCCCCC
Q psy10080         73 MCLFCSYKCKHKTDIMHHMRLKHKEFKI  100 (101)
Q Consensus        73 ~c~~c~~~f~~~~~l~~h~~~h~~e~~~  100 (101)
                      .|.+||+...-....+.-..+..|.+||
T Consensus        25 iCIVCG~GlC~EHli~eE~p~w~G~YP~   52 (76)
T COG4855          25 ICIVCGMGLCMEHLIREETPMWGGGYPF   52 (76)
T ss_pred             EEEEeCchHHHHHHHhhhcccccCCCCC
Confidence            4566665554443333333334444443


No 161
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The Sir2 homolog from the archaea Sulfolobus solftaricus deacetylates the non-specific DNA protein Alba to mediate transcription repression.
Probab=32.59  E-value=46  Score=20.45  Aligned_cols=25  Identities=20%  Similarity=0.345  Sum_probs=18.0

Q ss_pred             ceecccCCCcccccCcchhhccChH
Q psy10080         32 YNVDKEGKKTTWACPMCRKIYAFKY   56 (101)
Q Consensus        32 ~~~~~~~~~~p~~C~~c~~~~~~~~   56 (101)
                      .-...|+.-....|..|++.+....
T Consensus       103 ~v~elHG~l~~~~C~~C~~~~~~~~  127 (222)
T cd01413         103 NVIELHGTLQTAYCVNCGSKYDLEE  127 (222)
T ss_pred             cEEEccCCcCcceECCCCCCcchhH
Confidence            3455677777888999998776543


No 162
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=31.91  E-value=68  Score=20.90  Aligned_cols=23  Identities=17%  Similarity=0.547  Sum_probs=15.7

Q ss_pred             CceeccccccccCChHHHHHHHH
Q psy10080         70 PSQMCLFCSYKCKHKTDIMHHMR   92 (101)
Q Consensus        70 ~~~~c~~c~~~f~~~~~l~~h~~   92 (101)
                      ..|.|..|-+.|.+...+.+|+.
T Consensus        47 ~lyiCe~Clky~~~~~~l~~H~~   69 (290)
T PLN03238         47 KLYICEYCLKYMRKKKSLLRHLA   69 (290)
T ss_pred             eEEEcCCCcchhCCHHHHHHHHH
Confidence            34667777777777777777765


No 163
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=31.65  E-value=42  Score=16.17  Aligned_cols=15  Identities=13%  Similarity=0.414  Sum_probs=9.9

Q ss_pred             CCceeccccccccCC
Q psy10080         69 EPSQMCLFCSYKCKH   83 (101)
Q Consensus        69 ~~~~~c~~c~~~f~~   83 (101)
                      ...|.|+.||..+..
T Consensus        44 ~r~~~C~~Cg~~~~r   58 (69)
T PF07282_consen   44 GRVFTCPNCGFEMDR   58 (69)
T ss_pred             cceEEcCCCCCEECc
Confidence            345788888866543


No 164
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=31.56  E-value=27  Score=16.85  Aligned_cols=10  Identities=30%  Similarity=0.969  Sum_probs=3.0

Q ss_pred             ccCcchhhcc
Q psy10080         44 ACPMCRKIYA   53 (101)
Q Consensus        44 ~C~~c~~~~~   53 (101)
                      .|..|++.|.
T Consensus        11 ~C~~C~~~F~   20 (69)
T PF01363_consen   11 NCMICGKKFS   20 (69)
T ss_dssp             B-TTT--B-B
T ss_pred             cCcCcCCcCC
Confidence            4555555553


No 165
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=31.56  E-value=31  Score=23.13  Aligned_cols=12  Identities=33%  Similarity=0.617  Sum_probs=7.9

Q ss_pred             CCcccccCcchh
Q psy10080         39 KKTTWACPMCRK   50 (101)
Q Consensus        39 ~~~p~~C~~c~~   50 (101)
                      .+.-++|+.|+.
T Consensus        11 ~~~~g~cp~c~~   22 (372)
T cd01121          11 PKWLGKCPECGE   22 (372)
T ss_pred             CCccEECcCCCC
Confidence            345677888874


No 166
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=31.24  E-value=24  Score=19.29  Aligned_cols=8  Identities=38%  Similarity=1.020  Sum_probs=3.8

Q ss_pred             eecccccc
Q psy10080         72 QMCLFCSY   79 (101)
Q Consensus        72 ~~c~~c~~   79 (101)
                      |.|+.|+.
T Consensus        20 ~iCpeC~~   27 (109)
T TIGR00686        20 LICPSCLY   27 (109)
T ss_pred             eECccccc
Confidence            44555543


No 167
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=31.15  E-value=27  Score=22.69  Aligned_cols=30  Identities=27%  Similarity=0.566  Sum_probs=16.1

Q ss_pred             cccCcchhhccChHHHHHHhhhhhCCCCceeccccccccC
Q psy10080         43 WACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCK   82 (101)
Q Consensus        43 ~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~   82 (101)
                      .+|+.|+..+-.+. |.         ...+.|+.|+.-|.
T Consensus        39 ~kc~~C~~~~~~~~-l~---------~~~~vcp~c~~h~r   68 (296)
T CHL00174         39 VQCENCYGLNYKKF-LK---------SKMNICEQCGYHLK   68 (296)
T ss_pred             eECCCccchhhHHH-HH---------HcCCCCCCCCCCcC
Confidence            35777775433221 11         22456888876654


No 168
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=30.57  E-value=9.2  Score=17.31  Aligned_cols=13  Identities=15%  Similarity=0.176  Sum_probs=7.5

Q ss_pred             Cceeccc--cccccC
Q psy10080         70 PSQMCLF--CSYKCK   82 (101)
Q Consensus        70 ~~~~c~~--c~~~f~   82 (101)
                      ..+.|..  ||.+|.
T Consensus        24 ~Y~qC~N~~Cg~tfv   38 (47)
T PF04606_consen   24 LYCQCTNPECGHTFV   38 (47)
T ss_pred             EEEEECCCcCCCEEE
Confidence            3456643  776664


No 169
>KOG2231|consensus
Probab=30.37  E-value=64  Score=23.66  Aligned_cols=20  Identities=35%  Similarity=0.723  Sum_probs=11.5

Q ss_pred             ccCcchhhccChHHHHHHhh
Q psy10080         44 ACPMCRKIYAFKYNLMRHLR   63 (101)
Q Consensus        44 ~C~~c~~~~~~~~~l~~h~~   63 (101)
                      .|..|...|.....|..|++
T Consensus       184 ~C~~C~~~fld~~el~rH~~  203 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLR  203 (669)
T ss_pred             cchhhhhhhccHHHHHHhhc
Confidence            45556666665555655554


No 170
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=30.17  E-value=21  Score=16.57  Aligned_cols=39  Identities=26%  Similarity=0.648  Sum_probs=19.1

Q ss_pred             ccccCc--chhhccChHHHHHHhhhhhCCCCceeccc----cccccC
Q psy10080         42 TWACPM--CRKIYAFKYNLMRHLRVECGKEPSQMCLF----CSYKCK   82 (101)
Q Consensus        42 p~~C~~--c~~~~~~~~~l~~h~~~h~~~~~~~~c~~----c~~~f~   82 (101)
                      +-.|+.  |...+. ...|..|....=. ..+..|..    |...+.
T Consensus         9 ~v~C~~~cc~~~i~-r~~l~~H~~~~C~-~~~v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen    9 PVPCPNGCCNEMIP-RKELDDHLENECP-KRPVPCPYSPYGCKERVP   53 (60)
T ss_dssp             EEE-TT--S-BEEE-CCCHHHHHHTTST-TSEEE-SS----S--EEE
T ss_pred             EeeCCCCCccccee-HHHHHHHHHccCC-CCcEECCCCCCCCCCccc
Confidence            456765  444344 4467778664333 44567777    766554


No 171
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=29.99  E-value=50  Score=15.35  Aligned_cols=31  Identities=16%  Similarity=0.331  Sum_probs=17.3

Q ss_pred             ccCcchhhccChHHHHHHhhhhhCCCCceecccccc
Q psy10080         44 ACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSY   79 (101)
Q Consensus        44 ~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~   79 (101)
                      .|..|....+....    ..+..+ .....|+.|++
T Consensus        24 ~C~gC~~~l~~~~~----~~i~~~-~~i~~Cp~CgR   54 (56)
T PF02591_consen   24 TCSGCHMELPPQEL----NEIRKG-DEIVFCPNCGR   54 (56)
T ss_pred             ccCCCCEEcCHHHH----HHHHcC-CCeEECcCCCc
Confidence            67777765443322    233333 34567999986


No 172
>KOG1842|consensus
Probab=29.81  E-value=36  Score=23.59  Aligned_cols=20  Identities=15%  Similarity=0.473  Sum_probs=9.5

Q ss_pred             eeccccccccCChHHHHHHH
Q psy10080         72 QMCLFCSYKCKHKTDIMHHM   91 (101)
Q Consensus        72 ~~c~~c~~~f~~~~~l~~h~   91 (101)
                      |.|+.|...|.....|..|.
T Consensus        16 flCPiC~~dl~~~~~L~~H~   35 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHL   35 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHH
Confidence            44444444444444444443


No 173
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=29.61  E-value=56  Score=19.38  Aligned_cols=22  Identities=9%  Similarity=0.042  Sum_probs=15.5

Q ss_pred             ceeccccccccCChHHHHHHHH
Q psy10080         71 SQMCLFCSYKCKHKTDIMHHMR   92 (101)
Q Consensus        71 ~~~c~~c~~~f~~~~~l~~h~~   92 (101)
                      -+.|+.|++.|---+.+..-.+
T Consensus       130 f~~C~~CgkiYW~GsHw~~m~~  151 (165)
T COG1656         130 FYRCPKCGKIYWKGSHWRRMVE  151 (165)
T ss_pred             eeECCCCcccccCchHHHHHHH
Confidence            4679999999976666654433


No 174
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=29.42  E-value=21  Score=22.30  Aligned_cols=15  Identities=20%  Similarity=0.651  Sum_probs=12.5

Q ss_pred             cccccCcchhhccCh
Q psy10080         41 TTWACPMCRKIYAFK   55 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~   55 (101)
                      ++.+|..||..|.-.
T Consensus       180 kpqRCpECGqVFKLV  194 (268)
T PTZ00043        180 FLYRCGECDQIFMLV  194 (268)
T ss_pred             CCccCCCCCcEEEEE
Confidence            499999999988753


No 175
>KOG2807|consensus
Probab=28.93  E-value=83  Score=21.01  Aligned_cols=54  Identities=19%  Similarity=0.274  Sum_probs=34.0

Q ss_pred             cccccCcchhhccChHHHHHHhhh----------hhC----C------------CCceeccccccccCChHHHHHHHHHh
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLRV----------ECG----K------------EPSQMCLFCSYKCKHKTDIMHHMRLK   94 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~~----------h~~----~------------~~~~~c~~c~~~f~~~~~l~~h~~~h   94 (101)
                      -|-.|+.|+-+......|.+-.+.          ...    +            ...|.|..|...|....+.--|..+|
T Consensus       289 LP~eCpiC~ltLVss~hLARSyhhL~PL~~F~Eip~~~~~~~~~Cf~C~~~~~~~~~y~C~~Ck~~FCldCDv~iHesLh  368 (378)
T KOG2807|consen  289 LPIECPICSLTLVSSPHLARSYHHLFPLKPFVEIPETEYNGSRFCFACQGELLSSGRYRCESCKNVFCLDCDVFIHESLH  368 (378)
T ss_pred             CCccCCccceeEecchHHHHHHHhhcCCcchhhccccccCCCcceeeeccccCCCCcEEchhccceeeccchHHHHhhhh
Confidence            477888888887777777653220          000    0            12367777888887777777676665


No 176
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=28.84  E-value=21  Score=23.52  Aligned_cols=24  Identities=21%  Similarity=0.409  Sum_probs=17.0

Q ss_pred             ceeccccccccCChHHHHHHHHHh
Q psy10080         71 SQMCLFCSYKCKHKTDIMHHMRLK   94 (101)
Q Consensus        71 ~~~c~~c~~~f~~~~~l~~h~~~h   94 (101)
                      .|.|..|...|....+.--|..+|
T Consensus       388 rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         388 RYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             ceechhhhhhhhhhhHHHHHHHHh
Confidence            367777877887777777676655


No 177
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=28.78  E-value=24  Score=19.68  Aligned_cols=33  Identities=12%  Similarity=0.238  Sum_probs=17.6

Q ss_pred             CcccccCcchhhccChHHHHHHhhhhhCCCCceecccccc
Q psy10080         40 KTTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSY   79 (101)
Q Consensus        40 ~~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~   79 (101)
                      .-.+.| .|+..|.....-..    +.  ...+.|+.|+.
T Consensus        68 p~~~~C-~Cg~~~~~~~~~~~----~~--~~~~~CP~Cgs  100 (124)
T PRK00762         68 PVEIEC-ECGYEGVVDEDEID----HY--AAVIECPVCGN  100 (124)
T ss_pred             CeeEEe-eCcCcccccccchh----cc--ccCCcCcCCCC
Confidence            346789 99977654311000    01  11256999974


No 178
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=28.70  E-value=16  Score=21.07  Aligned_cols=10  Identities=30%  Similarity=0.637  Sum_probs=6.7

Q ss_pred             ccccCcchhh
Q psy10080         42 TWACPMCRKI   51 (101)
Q Consensus        42 p~~C~~c~~~   51 (101)
                      .+.|..||..
T Consensus       112 ~l~C~~Cg~~  121 (146)
T PF07295_consen  112 TLVCENCGHE  121 (146)
T ss_pred             eEecccCCCE
Confidence            5677777754


No 179
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=28.54  E-value=22  Score=14.73  Aligned_cols=12  Identities=25%  Similarity=0.872  Sum_probs=8.8

Q ss_pred             ccccCcchhhcc
Q psy10080         42 TWACPMCRKIYA   53 (101)
Q Consensus        42 p~~C~~c~~~~~   53 (101)
                      -|+|..|+....
T Consensus         4 ~ykC~~CGniv~   15 (34)
T cd00974           4 VYKCEICGNIVE   15 (34)
T ss_pred             EEEcCCCCcEEE
Confidence            578888887643


No 180
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=28.18  E-value=22  Score=14.67  Aligned_cols=13  Identities=23%  Similarity=0.782  Sum_probs=9.5

Q ss_pred             cccccCcchhhcc
Q psy10080         41 TTWACPMCRKIYA   53 (101)
Q Consensus        41 ~p~~C~~c~~~~~   53 (101)
                      +-|+|..|+....
T Consensus         6 ~~ykC~~Cgniv~   18 (34)
T TIGR00319         6 QVYKCEVCGNIVE   18 (34)
T ss_pred             cEEEcCCCCcEEE
Confidence            3688999987653


No 181
>KOG3362|consensus
Probab=27.99  E-value=22  Score=20.54  Aligned_cols=19  Identities=21%  Similarity=0.331  Sum_probs=10.0

Q ss_pred             eeccccccccCChHHHHHH
Q psy10080         72 QMCLFCSYKCKHKTDIMHH   90 (101)
Q Consensus        72 ~~c~~c~~~f~~~~~l~~h   90 (101)
                      |.|..||-.+.+-.=+..|
T Consensus       130 ysC~~CG~kyCsv~C~~~H  148 (156)
T KOG3362|consen  130 YSCVNCGTKYCSVRCLKTH  148 (156)
T ss_pred             hHHHhcCCceeechhhhhc
Confidence            4566666555554444444


No 182
>PTZ00408 NAD-dependent deacetylase; Provisional
Probab=27.71  E-value=56  Score=20.48  Aligned_cols=25  Identities=8%  Similarity=0.266  Sum_probs=18.4

Q ss_pred             cceecccCCCcccccCcchhhccCh
Q psy10080         31 PYNVDKEGKKTTWACPMCRKIYAFK   55 (101)
Q Consensus        31 ~~~~~~~~~~~p~~C~~c~~~~~~~   55 (101)
                      ..-...|+.-....|..|+..|...
T Consensus       106 ~~v~elHG~~~~~~C~~C~~~~~~~  130 (242)
T PTZ00408        106 THVLHMHGELLKVRCTATGHVFDWT  130 (242)
T ss_pred             CcEEEecCccceEEECCCCcccCch
Confidence            3455668887788999999877653


No 183
>PRK10220 hypothetical protein; Provisional
Probab=27.14  E-value=38  Score=18.61  Aligned_cols=8  Identities=25%  Similarity=0.687  Sum_probs=3.8

Q ss_pred             eecccccc
Q psy10080         72 QMCLFCSY   79 (101)
Q Consensus        72 ~~c~~c~~   79 (101)
                      |.|+.|+.
T Consensus        21 ~vCpeC~h   28 (111)
T PRK10220         21 YICPECAH   28 (111)
T ss_pred             EECCcccC
Confidence            44555543


No 184
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=27.09  E-value=33  Score=22.22  Aligned_cols=11  Identities=18%  Similarity=0.615  Sum_probs=6.9

Q ss_pred             eeccccccccC
Q psy10080         72 QMCLFCSYKCK   82 (101)
Q Consensus        72 ~~c~~c~~~f~   82 (101)
                      +.|+.|+.-|.
T Consensus        47 ~vc~~c~~h~r   57 (292)
T PRK05654         47 NVCPKCGHHMR   57 (292)
T ss_pred             CCCCCCCCCee
Confidence            46777776553


No 185
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=26.87  E-value=19  Score=20.47  Aligned_cols=32  Identities=22%  Similarity=0.427  Sum_probs=19.3

Q ss_pred             cccccCcchhhccChHHHHHHhhhhhCCCCceecccccccc
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKC   81 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f   81 (101)
                      -.|.|..|+..+...      .++  . ...+.|..|+..+
T Consensus       122 ~~~~C~~C~~~~~r~------~~~--~-~~~~~C~~C~~~l  153 (157)
T PF10263_consen  122 YVYRCPSCGREYKRH------RRS--K-RKRYRCGRCGGPL  153 (157)
T ss_pred             eEEEcCCCCCEeeee------ccc--c-hhhEECCCCCCEE
Confidence            367888888765332      232  1 2347788887655


No 186
>PRK04351 hypothetical protein; Provisional
Probab=26.30  E-value=31  Score=19.94  Aligned_cols=33  Identities=24%  Similarity=0.351  Sum_probs=20.2

Q ss_pred             cccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccC
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCK   82 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~   82 (101)
                      -.|.|..|+..+..      +++ +.  ...|.|..|+..+.
T Consensus       111 y~Y~C~~Cg~~~~r------~Rr-~n--~~~yrCg~C~g~L~  143 (149)
T PRK04351        111 YLYECQSCGQQYLR------KRR-IN--TKRYRCGKCRGKLK  143 (149)
T ss_pred             EEEECCCCCCEeee------eee-cC--CCcEEeCCCCcEee
Confidence            46889889865543      222 22  23588988876654


No 187
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=25.66  E-value=28  Score=19.61  Aligned_cols=17  Identities=12%  Similarity=0.563  Sum_probs=13.7

Q ss_pred             CcccccCcchhhccChH
Q psy10080         40 KTTWACPMCRKIYAFKY   56 (101)
Q Consensus        40 ~~p~~C~~c~~~~~~~~   56 (101)
                      .-.|.|..|++.|....
T Consensus        51 ~qRyrC~~C~~tf~~~~   67 (129)
T COG3677          51 HQRYKCKSCGSTFTVET   67 (129)
T ss_pred             ccccccCCcCcceeeec
Confidence            45799999999887653


No 188
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=25.47  E-value=15  Score=15.54  Aligned_cols=9  Identities=22%  Similarity=0.877  Sum_probs=5.8

Q ss_pred             ceecccccc
Q psy10080         71 SQMCLFCSY   79 (101)
Q Consensus        71 ~~~c~~c~~   79 (101)
                      .+.|+.|+.
T Consensus        22 R~vC~~Cg~   30 (34)
T PF14803_consen   22 RLVCPACGF   30 (34)
T ss_dssp             EEEETTTTE
T ss_pred             ceECCCCCC
Confidence            466777764


No 189
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=25.41  E-value=1e+02  Score=18.77  Aligned_cols=43  Identities=16%  Similarity=0.192  Sum_probs=25.4

Q ss_pred             eecccCCCcccccCcchhhccChHHHHHHhhhhhCCCCceecccccc
Q psy10080         33 NVDKEGKKTTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSY   79 (101)
Q Consensus        33 ~~~~~~~~~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~   79 (101)
                      -...|+.-....|..|+..+.....+.   ..... .....|+.|+.
T Consensus        86 vielHG~~~~~~C~~C~~~~~~~~~~~---~~~~~-~~~p~C~~Cgg  128 (206)
T cd01410          86 LSELHGNMFIEVCKSCGPEYVRDDVVE---TRGDK-ETGRRCHACGG  128 (206)
T ss_pred             EEEecCCcCcccCCCCCCccchHHHHH---HhhcC-CCCCcCCCCcC
Confidence            455688778888999997765443221   11112 22235888864


No 190
>PF09947 DUF2180:  Uncharacterized protein conserved in archaea (DUF2180);  InterPro: IPR017211 This group represents a predicted zinc finger protein, AF1427 type.
Probab=24.99  E-value=23  Score=17.66  Aligned_cols=7  Identities=29%  Similarity=0.985  Sum_probs=3.2

Q ss_pred             ccCcchh
Q psy10080         44 ACPMCRK   50 (101)
Q Consensus        44 ~C~~c~~   50 (101)
                      .|..||+
T Consensus        18 vCivCG~   24 (68)
T PF09947_consen   18 VCIVCGA   24 (68)
T ss_pred             hHHhcCc
Confidence            3444554


No 191
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=24.93  E-value=28  Score=16.15  Aligned_cols=12  Identities=33%  Similarity=0.924  Sum_probs=9.5

Q ss_pred             cccCcchhhccC
Q psy10080         43 WACPMCRKIYAF   54 (101)
Q Consensus        43 ~~C~~c~~~~~~   54 (101)
                      |.|..|+..+.-
T Consensus         2 y~C~~CgyiYd~   13 (50)
T cd00730           2 YECRICGYIYDP   13 (50)
T ss_pred             cCCCCCCeEECC
Confidence            789999987764


No 192
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=24.79  E-value=24  Score=15.22  Aligned_cols=14  Identities=29%  Similarity=0.759  Sum_probs=7.1

Q ss_pred             ccCcchhhccChHH
Q psy10080         44 ACPMCRKIYAFKYN   57 (101)
Q Consensus        44 ~C~~c~~~~~~~~~   57 (101)
                      .|..|++.|.+.+.
T Consensus         4 ~CprC~kg~Hwa~~   17 (36)
T PF14787_consen    4 LCPRCGKGFHWASE   17 (36)
T ss_dssp             C-TTTSSSCS-TTT
T ss_pred             cCcccCCCcchhhh
Confidence            46666666665543


No 193
>PF12907 zf-met2:  Zinc-binding
Probab=24.79  E-value=54  Score=14.48  Aligned_cols=18  Identities=28%  Similarity=0.707  Sum_probs=8.6

Q ss_pred             ccCcchhhccCh---HHHHHH
Q psy10080         44 ACPMCRKIYAFK---YNLMRH   61 (101)
Q Consensus        44 ~C~~c~~~~~~~---~~l~~h   61 (101)
                      .|..|...|-..   ..|..|
T Consensus         3 ~C~iC~qtF~~t~~~~~L~eH   23 (40)
T PF12907_consen    3 ICKICRQTFMQTTNEPQLKEH   23 (40)
T ss_pred             CcHHhhHHHHhcCCHHHHHHH
Confidence            466666443332   335444


No 194
>PLN02748 tRNA dimethylallyltransferase
Probab=24.74  E-value=61  Score=22.63  Aligned_cols=23  Identities=13%  Similarity=0.301  Sum_probs=17.8

Q ss_pred             Cceecccccc-ccCChHHHHHHHH
Q psy10080         70 PSQMCLFCSY-KCKHKTDIMHHMR   92 (101)
Q Consensus        70 ~~~~c~~c~~-~f~~~~~l~~h~~   92 (101)
                      +.|.|..|+. .+.....+..|++
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlk  440 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQ  440 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhc
Confidence            4567999997 7888888888765


No 195
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=24.54  E-value=62  Score=18.48  Aligned_cols=47  Identities=15%  Similarity=0.036  Sum_probs=24.9

Q ss_pred             cccCcchhhccChHHHHHHhh----hhhCCCCceeccccccccCChHHHHH
Q psy10080         43 WACPMCRKIYAFKYNLMRHLR----VECGKEPSQMCLFCSYKCKHKTDIMH   89 (101)
Q Consensus        43 ~~C~~c~~~~~~~~~l~~h~~----~h~~~~~~~~c~~c~~~f~~~~~l~~   89 (101)
                      -.|..|+..+...+.-.....    +......-+.|+.|++.|-.-+.+.+
T Consensus        92 sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiyW~GsH~~~  142 (147)
T PF01927_consen   92 SRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIYWEGSHWRR  142 (147)
T ss_pred             CccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEecccccHHH
Confidence            568888875443322111001    11110224789999999976555543


No 196
>PRK00481 NAD-dependent deacetylase; Provisional
Probab=24.45  E-value=61  Score=20.14  Aligned_cols=25  Identities=16%  Similarity=0.379  Sum_probs=17.7

Q ss_pred             ceecccCCCcccccCcchhhccChH
Q psy10080         32 YNVDKEGKKTTWACPMCRKIYAFKY   56 (101)
Q Consensus        32 ~~~~~~~~~~p~~C~~c~~~~~~~~   56 (101)
                      .-...|+.-....|..|++.+....
T Consensus       112 ~v~elHG~~~~~~C~~C~~~~~~~~  136 (242)
T PRK00481        112 NVIELHGSLLRARCTKCGQTYDLDE  136 (242)
T ss_pred             ceeeccCCcCceeeCCCCCCcChhh
Confidence            3455677777888999987765443


No 197
>PTZ00448 hypothetical protein; Provisional
Probab=24.45  E-value=66  Score=21.74  Aligned_cols=22  Identities=18%  Similarity=0.434  Sum_probs=17.1

Q ss_pred             ceeccccccccCChHHHHHHHH
Q psy10080         71 SQMCLFCSYKCKHKTDIMHHMR   92 (101)
Q Consensus        71 ~~~c~~c~~~f~~~~~l~~h~~   92 (101)
                      .|.|..|+-.|......+.|.+
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~K  335 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYR  335 (373)
T ss_pred             CccccccccccCCHHHHHHHhh
Confidence            4779999999977777777765


No 198
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=23.78  E-value=56  Score=22.87  Aligned_cols=9  Identities=22%  Similarity=0.663  Sum_probs=5.4

Q ss_pred             ceecccccc
Q psy10080         71 SQMCLFCSY   79 (101)
Q Consensus        71 ~~~c~~c~~   79 (101)
                      |..|+.|+.
T Consensus       253 ~~~Cp~C~s  261 (505)
T TIGR00595       253 PKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCC
Confidence            455666654


No 199
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=23.44  E-value=56  Score=20.62  Aligned_cols=35  Identities=14%  Similarity=0.360  Sum_probs=19.7

Q ss_pred             ccccCcchhhccChHHHHHHhhhhhCCCCceecccccccc
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKC   81 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f   81 (101)
                      -..|..|....+...  ..-.+.  + .....|+.||+-.
T Consensus       197 g~~C~GC~m~l~~~~--~~~V~~--~-d~iv~CP~CgRIL  231 (239)
T COG1579         197 GRVCGGCHMKLPSQT--LSKVRK--K-DEIVFCPYCGRIL  231 (239)
T ss_pred             CCcccCCeeeecHHH--HHHHhc--C-CCCccCCccchHH
Confidence            345777876555432  222232  3 4456699999754


No 200
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=23.13  E-value=53  Score=21.20  Aligned_cols=11  Identities=18%  Similarity=0.866  Sum_probs=5.9

Q ss_pred             ccccCcchhhc
Q psy10080         42 TWACPMCRKIY   52 (101)
Q Consensus        42 p~~C~~c~~~~   52 (101)
                      -|.|+.|--.|
T Consensus       255 GyvCs~Clsi~  265 (279)
T TIGR00627       255 GFVCSVCLSVL  265 (279)
T ss_pred             eEECCCccCCc
Confidence            36666665443


No 201
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=22.99  E-value=81  Score=21.97  Aligned_cols=26  Identities=27%  Similarity=0.443  Sum_probs=21.4

Q ss_pred             CCceeccccccccCChHHHHHHHHHh
Q psy10080         69 EPSQMCLFCSYKCKHKTDIMHHMRLK   94 (101)
Q Consensus        69 ~~~~~c~~c~~~f~~~~~l~~h~~~h   94 (101)
                      ...|.|..|-+.|.....|.+|+...
T Consensus       196 ~~lyiCe~Cl~y~~~~~~~~~H~~~C  221 (450)
T PLN00104        196 SKLYFCEFCLKFMKRKEQLQRHMKKC  221 (450)
T ss_pred             CeEEEchhhhhhhcCHHHHHHHHhcC
Confidence            34588999999999999999998643


No 202
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=22.98  E-value=27  Score=18.75  Aligned_cols=34  Identities=18%  Similarity=0.499  Sum_probs=18.5

Q ss_pred             cccccCcchhhccChHHHHHHhhhhhCCCCceeccccccccC
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKCK   82 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f~   82 (101)
                      .-|.|+.|+.. ...-      ....+ .....|..||..+.
T Consensus        20 t~f~CP~Cge~-~v~v------~~~k~-~~h~~C~~CG~y~~   53 (99)
T PRK14892         20 KIFECPRCGKV-SISV------KIKKN-IAIITCGNCGLYTE   53 (99)
T ss_pred             cEeECCCCCCe-Eeee------ecCCC-cceEECCCCCCccC
Confidence            36788888831 1110      11113 44567888886654


No 203
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=22.91  E-value=33  Score=19.51  Aligned_cols=8  Identities=38%  Similarity=1.385  Sum_probs=4.9

Q ss_pred             eccccccc
Q psy10080         73 MCLFCSYK   80 (101)
Q Consensus        73 ~c~~c~~~   80 (101)
                      .|+.|++.
T Consensus        46 ~CPvC~~~   53 (131)
T COG1645          46 FCPVCGYR   53 (131)
T ss_pred             ECCCCCce
Confidence            47777743


No 204
>KOG3014|consensus
Probab=22.86  E-value=85  Score=20.03  Aligned_cols=23  Identities=22%  Similarity=0.401  Sum_probs=12.0

Q ss_pred             ecccccccc--CChHHHHHHHHHhc
Q psy10080         73 MCLFCSYKC--KHKTDIMHHMRLKH   95 (101)
Q Consensus        73 ~c~~c~~~f--~~~~~l~~h~~~h~   95 (101)
                      .|..|+..+  .....-..|.+.|+
T Consensus        39 ~C~~Cgm~Yt~~s~EDe~~H~~fH~   63 (257)
T KOG3014|consen   39 KCKECGMKYTVTSPEDEALHEKFHN   63 (257)
T ss_pred             ehhhcCceecCCCHHHHHHHHHHHH
Confidence            466666433  34455555665554


No 205
>KOG2636|consensus
Probab=22.69  E-value=62  Score=22.53  Aligned_cols=30  Identities=20%  Similarity=0.491  Sum_probs=22.0

Q ss_pred             ceecccCCCcccccCcch-hhccChHHHHHH
Q psy10080         32 YNVDKEGKKTTWACPMCR-KIYAFKYNLMRH   61 (101)
Q Consensus        32 ~~~~~~~~~~p~~C~~c~-~~~~~~~~l~~h   61 (101)
                      +-.+.|+=...|.|.+|| .++.-+..+.+|
T Consensus       391 WLyKLHGL~~ey~CEICGNy~Y~GrkaF~RH  421 (497)
T KOG2636|consen  391 WLYKLHGLDIEYNCEICGNYVYKGRKAFDRH  421 (497)
T ss_pred             HHHhhcCCCcccceeeccCccccCcHHHHHH
Confidence            445556667789999999 466667777777


No 206
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=22.57  E-value=42  Score=15.31  Aligned_cols=10  Identities=30%  Similarity=0.803  Sum_probs=5.8

Q ss_pred             eecccccccc
Q psy10080         72 QMCLFCSYKC   81 (101)
Q Consensus        72 ~~c~~c~~~f   81 (101)
                      |+|..|+..+
T Consensus         2 y~C~~CgyvY   11 (47)
T PF00301_consen    2 YQCPVCGYVY   11 (47)
T ss_dssp             EEETTTSBEE
T ss_pred             cCCCCCCEEE
Confidence            4566666544


No 207
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=22.48  E-value=40  Score=20.20  Aligned_cols=13  Identities=23%  Similarity=0.723  Sum_probs=10.5

Q ss_pred             cccccCcchhhcc
Q psy10080         41 TTWACPMCRKIYA   53 (101)
Q Consensus        41 ~p~~C~~c~~~~~   53 (101)
                      ..+.|..|.+.|.
T Consensus       138 w~~rC~GC~~~f~  150 (177)
T COG1439         138 WRLRCHGCKRIFP  150 (177)
T ss_pred             eeEEEecCceecC
Confidence            4677999998887


No 208
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=22.43  E-value=41  Score=19.10  Aligned_cols=33  Identities=24%  Similarity=0.381  Sum_probs=18.5

Q ss_pred             cccccCcchhhccChHHHHHHhhhhhCCCCceecccccccc
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSYKC   81 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~~f   81 (101)
                      -.|.|..|+..+.      .+.+...  ...+.|..|+..+
T Consensus       111 ~~y~C~~C~~~~~------~~rr~~~--~~~y~C~~C~g~l  143 (146)
T smart00731      111 YPYRCTGCGQRYL------RVRRSNN--VSRYRCGKCGGKL  143 (146)
T ss_pred             EEEECCCCCCCCc------eEccccC--cceEEcCCCCCEE
Confidence            3788888886543      2222211  1347787787654


No 209
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis]
Probab=22.33  E-value=29  Score=17.22  Aligned_cols=12  Identities=25%  Similarity=0.600  Sum_probs=8.0

Q ss_pred             ceeccccccccC
Q psy10080         71 SQMCLFCSYKCK   82 (101)
Q Consensus        71 ~~~c~~c~~~f~   82 (101)
                      ...|..||....
T Consensus        38 ~V~C~~CG~~l~   49 (67)
T COG2051          38 VVTCLICGTTLA   49 (67)
T ss_pred             EEEecccccEEE
Confidence            356888876653


No 210
>cd01408 SIRT1 SIRT1: Eukaryotic group (class1) which includes human sirtuins SIRT1-3 and yeast Hst1-4; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The nuclear SIRT1 has been shown to target the p53 tumor suppressor protein for deacetylation to suppress DNA damage, and the cytoplasmic SIRT2 homolog has been shown to target alpha-tubulin for deacetylation for the maintenance of cell integrity.
Probab=21.88  E-value=1e+02  Score=19.13  Aligned_cols=22  Identities=23%  Similarity=0.428  Sum_probs=16.4

Q ss_pred             eecccCCCcccccCcchhhccC
Q psy10080         33 NVDKEGKKTTWACPMCRKIYAF   54 (101)
Q Consensus        33 ~~~~~~~~~p~~C~~c~~~~~~   54 (101)
                      -...|+.-....|..|+..+..
T Consensus       107 V~elHG~l~~~~C~~C~~~~~~  128 (235)
T cd01408         107 IIEAHGSFATAHCIKCKHKYPG  128 (235)
T ss_pred             EEEeCcCCCccccccCCCcCCH
Confidence            4556777778889999987654


No 211
>KOG2684|consensus
Probab=21.74  E-value=1.1e+02  Score=21.08  Aligned_cols=42  Identities=24%  Similarity=0.362  Sum_probs=26.3

Q ss_pred             eecccCCCcccccCcchhhccChHHHHHHhhhhhCCCCceecccccc
Q psy10080         33 NVDKEGKKTTWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSY   79 (101)
Q Consensus        33 ~~~~~~~~~p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~   79 (101)
                      -...|+.=+...|..|+..+... .+..  ..-+. +.| .|+.|..
T Consensus       194 lVq~HGSf~t~sCt~C~~k~~~~-~~~~--~~~~~-~vp-~CP~C~~  235 (412)
T KOG2684|consen  194 LVQCHGSFKTASCTKCGYKKPFE-ELRE--DIRNQ-EVP-VCPDCEG  235 (412)
T ss_pred             eEEeccccceeeecccccccChH-HHHH--HHhcC-cCc-cCccccc
Confidence            45567777788999999766655 3322  33344 444 4888853


No 212
>PTZ00064 histone acetyltransferase; Provisional
Probab=21.58  E-value=1e+02  Score=21.96  Aligned_cols=25  Identities=12%  Similarity=0.369  Sum_probs=21.2

Q ss_pred             CceeccccccccCChHHHHHHHHHh
Q psy10080         70 PSQMCLFCSYKCKHKTDIMHHMRLK   94 (101)
Q Consensus        70 ~~~~c~~c~~~f~~~~~l~~h~~~h   94 (101)
                      ..|.|..|-+.|.....|.+|+...
T Consensus       279 ~LYICEfCLkY~~s~~~l~rH~~~C  303 (552)
T PTZ00064        279 TLHFCEYCLDFFCFEDELIRHLSRC  303 (552)
T ss_pred             eEEEccchhhhhCCHHHHHHHHhcC
Confidence            3588999999999999999998743


No 213
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=21.42  E-value=54  Score=18.78  Aligned_cols=13  Identities=23%  Similarity=0.629  Sum_probs=9.6

Q ss_pred             eccccccccCChH
Q psy10080         73 MCLFCSYKCKHKT   85 (101)
Q Consensus        73 ~c~~c~~~f~~~~   85 (101)
                      +|+.|..+|.+..
T Consensus       123 vCPvCkTSFKss~  135 (140)
T PF05290_consen  123 VCPVCKTSFKSSS  135 (140)
T ss_pred             CCCcccccccccc
Confidence            5888888887653


No 214
>PRK06260 threonine synthase; Validated
Probab=21.29  E-value=50  Score=22.21  Aligned_cols=9  Identities=33%  Similarity=1.132  Sum_probs=4.7

Q ss_pred             ccccCcchh
Q psy10080         42 TWACPMCRK   50 (101)
Q Consensus        42 p~~C~~c~~   50 (101)
                      .+.|+.|+-
T Consensus        19 ~~~Cp~cg~   27 (397)
T PRK06260         19 IYTCPECGG   27 (397)
T ss_pred             cccCCCCCC
Confidence            345655554


No 215
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=21.17  E-value=32  Score=25.28  Aligned_cols=28  Identities=32%  Similarity=0.637  Sum_probs=14.9

Q ss_pred             cCcchhhccChHHHHHHhhhhhCCCCceecccccc
Q psy10080         45 CPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSY   79 (101)
Q Consensus        45 C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~   79 (101)
                      |+.|.+.|..+.+    +|.|..   |.-|+.||-
T Consensus       154 C~~C~~EY~dP~n----RRfHAQ---p~aCp~CGP  181 (750)
T COG0068         154 CPFCDKEYKDPLN----RRFHAQ---PIACPKCGP  181 (750)
T ss_pred             CHHHHHHhcCccc----cccccc---cccCcccCC
Confidence            5555555554443    344444   456777764


No 216
>PRK06450 threonine synthase; Validated
Probab=20.72  E-value=54  Score=21.60  Aligned_cols=10  Identities=30%  Similarity=0.424  Sum_probs=5.3

Q ss_pred             cccCcchhhc
Q psy10080         43 WACPMCRKIY   52 (101)
Q Consensus        43 ~~C~~c~~~~   52 (101)
                      +.|..|++.+
T Consensus         4 ~~C~~Cg~~~   13 (338)
T PRK06450          4 EVCMKCGKER   13 (338)
T ss_pred             eEECCcCCcC
Confidence            4555565543


No 217
>KOG1280|consensus
Probab=20.72  E-value=93  Score=20.95  Aligned_cols=37  Identities=19%  Similarity=0.482  Sum_probs=24.1

Q ss_pred             cccccCcchhhccChHHHHHHhh-hhhCCCC-ceeccccc
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLR-VECGKEP-SQMCLFCS   78 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~-~h~~~~~-~~~c~~c~   78 (101)
                      .-|.|+.|+..-.+...+..|.. .|.. .. ...|+.|+
T Consensus        78 qSftCPyC~~~Gfte~~f~~Hv~s~Hpd-a~~~~icp~c~  116 (381)
T KOG1280|consen   78 QSFTCPYCGIMGFTERQFGTHVLSQHPE-ASTSVICPLCA  116 (381)
T ss_pred             ccccCCcccccccchhHHHHHhhhcCcc-cCcceeeeccc
Confidence            36889999987666677888854 4544 32 24566664


No 218
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=20.51  E-value=51  Score=13.39  Aligned_cols=11  Identities=27%  Similarity=0.942  Sum_probs=3.7

Q ss_pred             CcccccCcchh
Q psy10080         40 KTTWACPMCRK   50 (101)
Q Consensus        40 ~~p~~C~~c~~   50 (101)
                      ...|.|+.|+.
T Consensus        11 ~~kY~Cp~C~~   21 (30)
T PF04438_consen   11 PAKYRCPRCGA   21 (30)
T ss_dssp             EESEE-TTT--
T ss_pred             CCEEECCCcCC
Confidence            33445554443


No 219
>KOG1994|consensus
Probab=20.46  E-value=52  Score=20.68  Aligned_cols=22  Identities=23%  Similarity=0.446  Sum_probs=19.0

Q ss_pred             cccccCcchhhccChHHHHHHh
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHL   62 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~   62 (101)
                      .-|.|-+||-.|.....|..|-
T Consensus       238 eh~YC~fCG~~y~~~edl~ehC  259 (268)
T KOG1994|consen  238 EHYYCFFCGIKYKDEEDLYEHC  259 (268)
T ss_pred             cceEEEEeccccCCHHHHHHhC
Confidence            4799999999999999888774


No 220
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=20.35  E-value=52  Score=22.16  Aligned_cols=23  Identities=17%  Similarity=0.314  Sum_probs=19.5

Q ss_pred             cccccCcchhhccChHHHHHHhh
Q psy10080         41 TTWACPMCRKIYAFKYNLMRHLR   63 (101)
Q Consensus        41 ~p~~C~~c~~~~~~~~~l~~h~~   63 (101)
                      +.+-|..|++.|...+.+..|..
T Consensus       237 ~~~YC~~C~r~f~~~~VFe~Hl~  259 (470)
T COG5188         237 PKVYCVKCGREFSRSKVFEYHLE  259 (470)
T ss_pred             cceeeHhhhhHhhhhHHHHHHHh
Confidence            35779999999999999988854


No 221
>KOG3507|consensus
Probab=20.25  E-value=51  Score=15.97  Aligned_cols=12  Identities=25%  Similarity=0.595  Sum_probs=7.6

Q ss_pred             Cceecccccccc
Q psy10080         70 PSQMCLFCSYKC   81 (101)
Q Consensus        70 ~~~~c~~c~~~f   81 (101)
                      ..+.|..||...
T Consensus        36 D~irCReCG~RI   47 (62)
T KOG3507|consen   36 DVIRCRECGYRI   47 (62)
T ss_pred             CcEehhhcchHH
Confidence            356777777544


No 222
>PLN02925 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
Probab=20.12  E-value=1.1e+02  Score=22.71  Aligned_cols=26  Identities=15%  Similarity=0.245  Sum_probs=19.4

Q ss_pred             eeccccccccCChHHHHHHHHHhcCC
Q psy10080         72 QMCLFCSYKCKHKTDIMHHMRLKHKE   97 (101)
Q Consensus        72 ~~c~~c~~~f~~~~~l~~h~~~h~~e   97 (101)
                      .-|+.||++......+...++.+++.
T Consensus       635 isCPgCGRT~~dlq~~~~~I~~~~~h  660 (733)
T PLN02925        635 VSCPSCGRTLFDLQEVSAEIREKTSH  660 (733)
T ss_pred             EECCCCCCccccHHHHHHHHHHHhhc
Confidence            45999999988877777777666544


No 223
>PRK00420 hypothetical protein; Validated
Probab=20.11  E-value=62  Score=17.85  Aligned_cols=10  Identities=10%  Similarity=0.142  Sum_probs=6.3

Q ss_pred             eecccccccc
Q psy10080         72 QMCLFCSYKC   81 (101)
Q Consensus        72 ~~c~~c~~~f   81 (101)
                      ..|+.||...
T Consensus        41 ~~Cp~Cg~~~   50 (112)
T PRK00420         41 VVCPVHGKVY   50 (112)
T ss_pred             eECCCCCCee
Confidence            4577777644


No 224
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=20.06  E-value=1.7e+02  Score=15.83  Aligned_cols=36  Identities=8%  Similarity=0.135  Sum_probs=21.4

Q ss_pred             ccccCcchhhccChHHHHHHhhhhhCCCCceecccccc
Q psy10080         42 TWACPMCRKIYAFKYNLMRHLRVECGKEPSQMCLFCSY   79 (101)
Q Consensus        42 p~~C~~c~~~~~~~~~l~~h~~~h~~~~~~~~c~~c~~   79 (101)
                      .|.|+.-+..|..-..+...+.....  +.|.|...|+
T Consensus         3 Vf~i~~T~EiF~dYe~Y~~R~~~y~~--~vwtC~~TGk   38 (102)
T PF10537_consen    3 VFYIPFTGEIFRDYEEYLKRMILYNQ--RVWTCEITGK   38 (102)
T ss_pred             eEEeCCCCcccCCHHHHHHHHHHHhC--CeeEEecCCC
Confidence            45566666667766666555544443  3477777664


No 225
>cd01412 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E. coli CobB; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. CobB is a bacterial sirtuin that deacetylates acetyl-CoA synthetase at an active site lysine to stimulate its enzymatic activity.
Probab=20.04  E-value=87  Score=19.13  Aligned_cols=25  Identities=12%  Similarity=0.193  Sum_probs=17.3

Q ss_pred             cceecccCCCcccccCcchhhccCh
Q psy10080         31 PYNVDKEGKKTTWACPMCRKIYAFK   55 (101)
Q Consensus        31 ~~~~~~~~~~~p~~C~~c~~~~~~~   55 (101)
                      ..-...|+.-....|..|+..+...
T Consensus        98 ~~v~e~HG~~~~~~C~~C~~~~~~~  122 (224)
T cd01412          98 RNVIELHGSLFRVRCSSCGYVGENN  122 (224)
T ss_pred             CceEeeCCCcCccccCCCCCCCCcc
Confidence            4455667777778888888766543


Done!