Query         psy10100
Match_columns 65
No_of_seqs    78 out of 80
Neff          3.8 
Searched_HMMs 46136
Date          Fri Aug 16 17:54:04 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10100.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10100hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF10853 DUF2650:  Protein of u  96.6   0.003 6.4E-08   35.2   3.0   28    2-29     11-38  (38)
  2 PF01788 PsbJ:  PsbJ;  InterPro  63.2      14 0.00031   20.8   3.1   21   13-33     12-32  (40)
  3 PF02419 PsbL:  PsbL protein;    59.8      12 0.00025   20.9   2.4   17   17-33     18-34  (37)
  4 PF05082 Rop-like:  Rop-like;    55.3     8.4 0.00018   23.6   1.5   31   31-64     22-52  (66)
  5 PRK00753 psbL photosystem II r  55.2      14 0.00031   20.7   2.3   16   17-32     20-35  (39)
  6 PF10958 DUF2759:  Protein of u  54.0      27 0.00059   20.6   3.4   27   13-39      6-36  (52)
  7 CHL00038 psbL photosystem II p  53.0      17 0.00037   20.3   2.3   16   17-32     19-34  (38)
  8 PF11084 DUF2621:  Protein of u  52.1      33 0.00071   23.9   4.1   33   11-43      6-38  (141)
  9 PF08362 TetR_C_3:  YcdC-like p  48.5      22 0.00047   23.9   2.8   43   11-56     91-133 (143)
 10 PF08285 DPM3:  Dolichol-phosph  45.7      36 0.00078   21.5   3.3   52    9-63     34-85  (91)
 11 PF07709 SRR:  Seven Residue Re  45.4      14  0.0003   16.0   1.0   10   56-65      4-13  (14)
 12 PF06196 DUF997:  Protein of un  44.8      68  0.0015   19.8   4.4   32   14-47     47-78  (80)
 13 PF01484 Col_cuticle_N:  Nemato  38.3      65  0.0014   17.1   3.9   17   49-65     37-53  (53)
 14 PF12537 DUF3735:  Protein of u  37.5      40 0.00086   20.0   2.4   26   10-35      8-33  (72)
 15 CHL00108 psbJ photosystem II p  37.0     5.7 0.00012   22.4  -1.2   17   17-33     16-32  (40)
 16 PRK02565 photosystem II reacti  36.4     7.8 0.00017   21.8  -0.7   17   17-33     15-31  (39)
 17 COG5420 Uncharacterized conser  35.9      26 0.00056   21.9   1.4   32   30-64     25-56  (71)
 18 PF05545 FixQ:  Cbb3-type cytoc  33.9      84  0.0018   17.1   3.3    6   27-32     24-29  (49)
 19 KOG1513|consensus               33.8      21 0.00045   31.9   1.1   20   10-29   1237-1256(1300)
 20 PF07589 VPEP:  PEP-CTERM motif  33.5      63  0.0014   15.9   2.4   15   16-30      6-20  (25)
 21 PF06480 FtsH_ext:  FtsH Extrac  31.6      16 0.00034   21.1   0.0   17   17-33      3-19  (110)
 22 KOG3202|consensus               31.0      49  0.0011   24.3   2.5   21    6-26    211-231 (235)
 23 PF04995 CcmD:  Heme exporter p  30.4      91   0.002   17.0   3.0   20   13-32      6-25  (46)
 24 COG5336 Uncharacterized protei  29.6      59  0.0013   22.0   2.5   18   16-33     73-90  (116)
 25 PF11346 DUF3149:  Protein of u  28.8      95  0.0021   17.3   2.9   18   14-31     13-30  (42)
 26 PF11833 DUF3353:  Protein of u  27.5      27 0.00059   24.6   0.6   19   47-65     19-37  (194)
 27 PF07503 zf-HYPF:  HypF finger;  25.5      24 0.00051   18.9   0.0   10    1-10     24-33  (35)
 28 COG0109 CyoE Polyprenyltransfe  24.9 1.1E+02  0.0024   23.4   3.5   26    8-33    101-137 (304)
 29 PF00746 Gram_pos_anchor:  Gram  23.2      27 0.00059   18.0   0.0   18   13-30     18-35  (39)
 30 COG3790 Predicted membrane pro  22.2      66  0.0014   21.2   1.6   25   13-37     51-75  (97)
 31 PF10270 MMgT:  Membrane magnes  21.9      85  0.0018   19.9   2.1   16    9-24     42-57  (106)
 32 PF05814 DUF843:  Baculovirus p  21.0 1.5E+02  0.0033   18.9   3.1   44   16-63     31-74  (83)
 33 PF03530 SK_channel:  Calcium-a  20.9      96  0.0021   20.7   2.3   19    7-25     14-32  (119)
 34 PRK13747 putative mercury resi  20.9 2.3E+02  0.0049   18.0   3.8   26   12-37     46-71  (78)
 35 PF10661 EssA:  WXG100 protein   20.4 1.7E+02  0.0036   19.8   3.4   20   13-32    121-140 (145)
 36 PLN03160 uncharacterized prote  20.2      70  0.0015   22.6   1.6   25    7-31     35-59  (219)

No 1  
>PF10853 DUF2650:  Protein of unknown function (DUF2650);  InterPro: IPR022559  This region is found in proteins with unknown function in metazoa. 
Probab=96.59  E-value=0.003  Score=35.15  Aligned_cols=28  Identities=39%  Similarity=0.691  Sum_probs=26.1

Q ss_pred             cccCCcchhHHHHHHHHHHHHHHHHHHH
Q psy10100          2 KICGPKLSLCGVIISAWGIVQLALMGVF   29 (65)
Q Consensus         2 ~~cGpk~s~cc~vlSvWGii~L~llGi~   29 (65)
                      +.||.+..-||.-+..|.+++|+++|+.
T Consensus        11 ~CCg~~~~eCCf~lq~Wv~v~l~v~~v~   38 (38)
T PF10853_consen   11 KCCGDLNKECCFRLQIWVIVLLAVLGVC   38 (38)
T ss_pred             ECCCCChHhHHHHHHHHHHHHHHHHhcC
Confidence            5799999999999999999999999973


No 2  
>PF01788 PsbJ:  PsbJ;  InterPro: IPR002682 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbJ found in PSII. PsbJ is one of the most hydrophobic proteins in the thylakoid membrane, and is located in a gene cluster with PsbE, PsbF and PsbL (PsbEFJL). Both PsbJ and PsbL (IPR003372 from INTERPRO) are essential for proper assembly of the OEC. Mutations in PsbJ cause the light-harvesting antenna to remain detached from the PSII dimers []. In addition, both PsbJ and PsbL are involved in the unidirectional flow of electrons, where PsbJ regulates the forward electron flow from D2 (Qa) to the plastoquinone pool, and PsbL prevents the reduction of PSII by back electron flow from plastoquinol protecting PSII from photo-inactivation [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane; PDB: 3A0H_J 3ARC_J 3A0B_J 3KZI_J 2AXT_J 3PRQ_J 4FBY_b 3BZ2_J 1S5L_j 3PRR_J ....
Probab=63.21  E-value=14  Score=20.83  Aligned_cols=21  Identities=24%  Similarity=0.479  Sum_probs=16.2

Q ss_pred             HHHHHHHHHHHHHHHHHHhhh
Q psy10100         13 VIISAWGIVQLALMGVFYHIR   33 (65)
Q Consensus        13 ~vlSvWGii~L~llGi~F~~~   33 (65)
                      +|--+=|+.-+.++|+|||-.
T Consensus        12 lVgtv~G~~vi~lvglFfYGs   32 (40)
T PF01788_consen   12 LVGTVAGIAVIGLVGLFFYGS   32 (40)
T ss_dssp             HHHHHHHHHHHHHHHHHHHCT
T ss_pred             HHHHHHHHHHHHHHHHheecc
Confidence            344566889999999999853


No 3  
>PF02419 PsbL:  PsbL protein;  InterPro: IPR003372 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbL found in PSII. PsbL is located in a gene cluster with PsbE, PsbF and PsbJ (PsbEFJL). Both PsbL and PsbJ (IPR002682 from INTERPRO) are essential for proper assembly of the OEC. Mutations in PsbL prevent the formation of both PSII core dimers and PSII-light harvesting complex []. In addition, both PsbL and PsbJ are involved in the unidirectional flow of electrons, where PsbJ regulates the forward electron flow from D2 (Qa) to the plastoquinone pool, and PsbL prevents the reduction of PSII by back electron flow from plastoquinol protecting PSII from photo-inactivation [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane; PDB: 3A0H_L 3A0B_l 3ARC_l 1S5L_l 2AXT_l 3BZ2_L 4FBY_L 3PRQ_L 3PRR_L 3KZI_L ....
Probab=59.78  E-value=12  Score=20.86  Aligned_cols=17  Identities=18%  Similarity=0.665  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHHHHHhhh
Q psy10100         17 AWGIVQLALMGVFYHIR   33 (65)
Q Consensus        17 vWGii~L~llGi~F~~~   33 (65)
                      -||.+...++|++|+..
T Consensus        18 Y~GLllifvl~vLFssy   34 (37)
T PF02419_consen   18 YWGLLLIFVLAVLFSSY   34 (37)
T ss_dssp             HHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhhhh
Confidence            49999999999999764


No 4  
>PF05082 Rop-like:  Rop-like;  InterPro: IPR007774 This family contains several uncharacterised bacterial proteins. These proteins are found in nitrogen fixation operons, so are likely to play a role in this process.; PDB: 3CSX_A 2JS5_B.
Probab=55.27  E-value=8.4  Score=23.56  Aligned_cols=31  Identities=26%  Similarity=0.380  Sum_probs=21.6

Q ss_pred             hhhhhhhhcCCCCCCcccCchhhHHHHHHHhhhc
Q psy10100         31 HIRSVALIEDLPGEETHFASIDDFYQTVERGYTL   64 (65)
Q Consensus        31 ~~~s~~L~edlp~~~~~~~s~~~f~~~~~~~Y~~   64 (65)
                      ..+=.-|.||||.   +|.++.+--++.+++|..
T Consensus        22 kmdLHDLaEdLP~---~w~~i~~vA~~ty~a~~~   52 (66)
T PF05082_consen   22 KMDLHDLAEDLPT---NWEEIPEVAQKTYDAYAE   52 (66)
T ss_dssp             HHHHHHHHHCTTT---TGGGHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHccch---hHHHHHHHHHHHHHHHHH
Confidence            3445678999997   777776666777777653


No 5  
>PRK00753 psbL photosystem II reaction center L; Provisional
Probab=55.16  E-value=14  Score=20.70  Aligned_cols=16  Identities=13%  Similarity=0.534  Sum_probs=14.3

Q ss_pred             HHHHHHHHHHHHHHhh
Q psy10100         17 AWGIVQLALMGVFYHI   32 (65)
Q Consensus        17 vWGii~L~llGi~F~~   32 (65)
                      -||.+...++|++|+.
T Consensus        20 y~GlLlifvl~vLFss   35 (39)
T PRK00753         20 YLGLLLVFVLGILFSS   35 (39)
T ss_pred             HHHHHHHHHHHHHHHh
Confidence            4999999999999975


No 6  
>PF10958 DUF2759:  Protein of unknown function (DUF2759);  InterPro: IPR024490 This family of proteins with unknown function appear to be restricted to Bacillales.
Probab=53.96  E-value=27  Score=20.61  Aligned_cols=27  Identities=19%  Similarity=0.570  Sum_probs=21.8

Q ss_pred             HHHHHHHHHHHH----HHHHHHhhhhhhhhc
Q psy10100         13 VIISAWGIVQLA----LMGVFYHIRSVALIE   39 (65)
Q Consensus        13 ~vlSvWGii~L~----llGi~F~~~s~~L~e   39 (65)
                      .++++||++.-+    ++|+.|..-|++.++
T Consensus         6 tlla~~g~~rslK~KN~l~i~F~~~t~~VFG   36 (52)
T PF10958_consen    6 TLLAAFGVLRSLKNKNFLGIGFALVTVAVFG   36 (52)
T ss_pred             HHHHHHHHHHHHHHhhHHHHHHHHHHHHHHH
Confidence            678999999864    889998888877654


No 7  
>CHL00038 psbL photosystem II protein L
Probab=52.97  E-value=17  Score=20.32  Aligned_cols=16  Identities=19%  Similarity=0.723  Sum_probs=14.2

Q ss_pred             HHHHHHHHHHHHHHhh
Q psy10100         17 AWGIVQLALMGVFYHI   32 (65)
Q Consensus        17 vWGii~L~llGi~F~~   32 (65)
                      -||.+...++|++|+.
T Consensus        19 y~GLLlifvl~vlfss   34 (38)
T CHL00038         19 YWGLLLIFVLAVLFSN   34 (38)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            4999999999999975


No 8  
>PF11084 DUF2621:  Protein of unknown function (DUF2621);  InterPro: IPR020203 This entry represents a group of uncharacterised proteins.
Probab=52.11  E-value=33  Score=23.91  Aligned_cols=33  Identities=21%  Similarity=0.261  Sum_probs=24.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhhhhhhcCCCC
Q psy10100         11 CGVIISAWGIVQLALMGVFYHIRSVALIEDLPG   43 (65)
Q Consensus        11 cc~vlSvWGii~L~llGi~F~~~s~~L~edlp~   43 (65)
                      +-.++-.|+++|+.+|+|.=+--=.-++.-+|-
T Consensus         6 Fm~fI~~W~~vli~l~~IGGfFMFRKFLK~lPK   38 (141)
T PF11084_consen    6 FMWFILFWVVVLIGLMAIGGFFMFRKFLKRLPK   38 (141)
T ss_pred             HHHHHHHHHHHHHHHHHHhHHHHHHHHHHhCCc
Confidence            456788999999998866544444567788885


No 9  
>PF08362 TetR_C_3:  YcdC-like protein, C-terminal region;  InterPro: IPR013573 This entry represents the C-terminal domain found in the hypothetical transcriptional regulators RutR and YcdC (P75899 from SWISSPROT) from Escherichia coli. Both of these proteins are member of the TetR (tetracycline resistance) transcriptional regulator family of proteins. RutR negatively controls the transcription of the rut operon involved in pyrimidine utilization. The C-terminal domains of RutR, YsiA and TetR share a multi-helical, interlocking structure. These proteins also contain helix-turn-helix (HTH) DNA-binding domains.; GO: 0045892 negative regulation of transcription, DNA-dependent; PDB: 3LOC_B.
Probab=48.53  E-value=22  Score=23.87  Aligned_cols=43  Identities=14%  Similarity=0.221  Sum_probs=30.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhhhhhhcCCCCCCcccCchhhHHH
Q psy10100         11 CGVIISAWGIVQLALMGVFYHIRSVALIEDLPGEETHFASIDDFYQ   56 (65)
Q Consensus        11 cc~vlSvWGii~L~llGi~F~~~s~~L~edlp~~~~~~~s~~~f~~   56 (65)
                      --+++|+|+.-|-=   .=|..+..++.+.-++++++|++..++..
T Consensus        91 ~hL~f~IWa~TQ~Y---ADf~~Qi~~~~g~~~~~~~d~e~a~~~v~  133 (143)
T PF08362_consen   91 EHLFFMIWAMTQHY---ADFAAQIRAVLGKSELSEEDFEQAAEFVT  133 (143)
T ss_dssp             HHHHHHHHHHHHHH---HHTHHHHHHHHS--TTSHHHHHHHHHHHH
T ss_pred             HHHHHHHHHhhhhh---hhHHHHHHHHhCCCCCCHHHHHHHHHHHH
Confidence            35789999999843   45778888899888887777766555443


No 10 
>PF08285 DPM3:  Dolichol-phosphate mannosyltransferase subunit 3 (DPM3);  InterPro: IPR013174 This family corresponds to subunit 3 of dolichol-phosphate mannosyltransferase, an enzyme which generates mannosyl donors for glycosylphosphatidylinositols, N-glycan and protein O- and C-mannosylation. DPM3 is an integral membrane protein and plays a role in stabilising the dolichol-phosphate mannosyl transferase complex [].
Probab=45.68  E-value=36  Score=21.50  Aligned_cols=52  Identities=12%  Similarity=0.110  Sum_probs=36.0

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHhhhhhhhhcCCCCCCcccCchhhHHHHHHHhhh
Q psy10100          9 SLCGVIISAWGIVQLALMGVFYHIRSVALIEDLPGEETHFASIDDFYQTVERGYT   63 (65)
Q Consensus         9 s~cc~vlSvWGii~L~llGi~F~~~s~~L~edlp~~~~~~~s~~~f~~~~~~~Y~   63 (65)
                      ...-..+-+|.++.+++-..+=-.-.++-+.|-|   |.+.+++...+++.+-++
T Consensus        34 ~~ii~~lP~~~Lv~fG~Ysl~~lgy~v~tFnDcp---eA~~eL~~eI~eAK~dLr   85 (91)
T PF08285_consen   34 QEIIPYLPFYALVSFGCYSLFTLGYGVATFNDCP---EAAKELQKEIKEAKADLR   85 (91)
T ss_pred             HHHHHHhhHHHHHHHHHHHHHHHHHhhhccCCCH---HHHHHHHHHHHHHHHHHH
Confidence            3456677788888888777777677788888877   455666655566655443


No 11 
>PF07709 SRR:  Seven Residue Repeat;  InterPro: IPR011714 This repeat is found in some Plasmodium and Theileria proteins.
Probab=45.39  E-value=14  Score=15.97  Aligned_cols=10  Identities=30%  Similarity=0.577  Sum_probs=8.1

Q ss_pred             HHHHHhhhcC
Q psy10100         56 QTVERGYTLL   65 (65)
Q Consensus        56 ~~~~~~Y~~~   65 (65)
                      +++..+|+++
T Consensus         4 ~~V~~aY~~l   13 (14)
T PF07709_consen    4 EKVKNAYEQL   13 (14)
T ss_pred             HHHHHHHHhc
Confidence            7888888875


No 12 
>PF06196 DUF997:  Protein of unknown function (DUF997);  InterPro: IPR010398 This is a family of predicted bacterial membrane protein with unknown function.
Probab=44.78  E-value=68  Score=19.77  Aligned_cols=32  Identities=19%  Similarity=0.335  Sum_probs=18.8

Q ss_pred             HHHHHHHHHHHHHHHHHhhhhhhhhcCCCCCCcc
Q psy10100         14 IISAWGIVQLALMGVFYHIRSVALIEDLPGEETH   47 (65)
Q Consensus        14 vlSvWGii~L~llGi~F~~~s~~L~edlp~~~~~   47 (65)
                      ++|.-+.-.+.+..+.+-++  -++.|+|+|+|+
T Consensus        47 ~~SCi~~~il~~~l~~~~vk--~~Fkd~~Ld~~~   78 (80)
T PF06196_consen   47 FYSCIGGPILFIILVWLMVK--FFFKDIPLDDEE   78 (80)
T ss_pred             HHHHHHHHHHHHHHHHHHHH--HHhhcCCCCccc
Confidence            45555444555555555544  356999996653


No 13 
>PF01484 Col_cuticle_N:  Nematode cuticle collagen N-terminal domain;  InterPro: IPR002486 The function of this domain is unknown. It is found in the N-terminal region of nematode cuticle collagens (see IPR008160 from INTERPRO). Cuticle is a tough elastic structure secreted by hypodermal cells and is primarily composed of collagen proteins [, ].; GO: 0042302 structural constituent of cuticle
Probab=38.27  E-value=65  Score=17.11  Aligned_cols=17  Identities=6%  Similarity=0.399  Sum_probs=12.8

Q ss_pred             CchhhHHHHHHHhhhcC
Q psy10100         49 ASIDDFYQTVERGYTLL   65 (65)
Q Consensus        49 ~s~~~f~~~~~~~Y~~~   65 (65)
                      .++++|+...+++++++
T Consensus        37 ~em~~fk~~s~d~W~~m   53 (53)
T PF01484_consen   37 DEMEEFKEISDDAWNEM   53 (53)
T ss_pred             HHHHHHHHHHHHHHhhC
Confidence            45678888888888763


No 14 
>PF12537 DUF3735:  Protein of unknown function (DUF3735);  InterPro: IPR022535  This conserved domain is found in a subunit of a voltage dependent anion channel required for acidification and functions of the Golgi apparatus; it may function in counter-ion conductance. It belongs to the Golgi pH regulator (1.A.38 from TC) family
Probab=37.46  E-value=40  Score=19.99  Aligned_cols=26  Identities=15%  Similarity=0.165  Sum_probs=20.7

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHhhhhh
Q psy10100         10 LCGVIISAWGIVQLALMGVFYHIRSV   35 (65)
Q Consensus        10 ~cc~vlSvWGii~L~llGi~F~~~s~   35 (65)
                      .|-.=+|+-||.+|++|-.|=.++++
T Consensus         8 ~~l~ri~ViGVt~mAiLSG~gaVstp   33 (72)
T PF12537_consen    8 NVLSRIGVIGVTLMAILSGFGAVSTP   33 (72)
T ss_pred             HHHHHHHHHHHHHHHHHhhhhHHccH
Confidence            34456899999999999988777765


No 15 
>CHL00108 psbJ photosystem II protein J
Probab=37.03  E-value=5.7  Score=22.44  Aligned_cols=17  Identities=29%  Similarity=0.602  Sum_probs=13.0

Q ss_pred             HHHHHHHHHHHHHHhhh
Q psy10100         17 AWGIVQLALMGVFYHIR   33 (65)
Q Consensus        17 vWGii~L~llGi~F~~~   33 (65)
                      +=|+.-+.++|+|||-.
T Consensus        16 v~G~~vi~~vgiFfyGs   32 (40)
T CHL00108         16 VAGIAVIGLLGIFFYGS   32 (40)
T ss_pred             hhhHhHHheeeeEEeec
Confidence            34677889999999853


No 16 
>PRK02565 photosystem II reaction center protein J; Provisional
Probab=36.37  E-value=7.8  Score=21.78  Aligned_cols=17  Identities=18%  Similarity=0.360  Sum_probs=13.1

Q ss_pred             HHHHHHHHHHHHHHhhh
Q psy10100         17 AWGIVQLALMGVFYHIR   33 (65)
Q Consensus        17 vWGii~L~llGi~F~~~   33 (65)
                      +=|+.-+.++|+|||-.
T Consensus        15 v~G~~vi~~vgiFfyGs   31 (39)
T PRK02565         15 VAGMGVIFVVGLFFYGS   31 (39)
T ss_pred             hhHHHHHhheeeEEeec
Confidence            44777889999999843


No 17 
>COG5420 Uncharacterized conserved small protein containing a coiled-coil domain [Function unknown]
Probab=35.86  E-value=26  Score=21.88  Aligned_cols=32  Identities=19%  Similarity=0.211  Sum_probs=21.0

Q ss_pred             HhhhhhhhhcCCCCCCcccCchhhHHHHHHHhhhc
Q psy10100         30 YHIRSVALIEDLPGEETHFASIDDFYQTVERGYTL   64 (65)
Q Consensus        30 F~~~s~~L~edlp~~~~~~~s~~~f~~~~~~~Y~~   64 (65)
                      -.++-..|.||+|.   +|....+--.+..++|.+
T Consensus        25 akm~LhDLAEgLP~---~wtei~~VA~kt~~~yae   56 (71)
T COG5420          25 AKMELHDLAEGLPV---KWTEIMAVAEKTFEAYAE   56 (71)
T ss_pred             HHhhHHHHhccCCc---cHHHHHHHHHHHHHHHHH
Confidence            34556778999997   555555555666666654


No 18 
>PF05545 FixQ:  Cbb3-type cytochrome oxidase component FixQ;  InterPro: IPR008621 This family consists of several Cbb3-type cytochrome oxidase components (FixQ/CcoQ). FixQ is found in nitrogen fixing bacteria. Since nitrogen fixation is an energy-consuming process, effective symbioses depend on operation of a respiratory chain with a high affinity for O2, closely coupled to ATP production. This requirement is fulfilled by a special three-subunit terminal oxidase (cytochrome terminal oxidase cbb3), which was first identified in Bradyrhizobium japonicum as the product of the fixNOQP operon [].
Probab=33.91  E-value=84  Score=17.08  Aligned_cols=6  Identities=17%  Similarity=0.418  Sum_probs=2.9

Q ss_pred             HHHHhh
Q psy10100         27 GVFYHI   32 (65)
Q Consensus        27 Gi~F~~   32 (65)
                      |+.++.
T Consensus        24 gi~~w~   29 (49)
T PF05545_consen   24 GIVIWA   29 (49)
T ss_pred             HHHHHH
Confidence            554443


No 19 
>KOG1513|consensus
Probab=33.84  E-value=21  Score=31.91  Aligned_cols=20  Identities=35%  Similarity=0.665  Sum_probs=16.8

Q ss_pred             hHHHHHHHHHHHHHHHHHHH
Q psy10100         10 LCGVIISAWGIVQLALMGVF   29 (65)
Q Consensus        10 ~cc~vlSvWGii~L~llGi~   29 (65)
                      +|+.||||||.|=.++-+.-
T Consensus      1237 LsGsvLsVW~rVE~Vla~~s 1256 (1300)
T KOG1513|consen 1237 LSGSVLSVWGRVEAVLADSS 1256 (1300)
T ss_pred             eccchhhhhHHHHHHHhcCC
Confidence            68999999999988876654


No 20 
>PF07589 VPEP:  PEP-CTERM motif;  InterPro: IPR013424  This entry describes a 25-residue region including an invariant Pro-Glu-Pro (PEP) motif, a thirteen residue strongly hydrophobic sequence likely to span the membrane, and a five-residue strongly basic motif that often contains four Arg residues. In most cases, this motif is found within nine residues of the C-terminal end of the protein. Proteins containing this motif typically have signal sequences at the N terminus [].
Probab=33.46  E-value=63  Score=15.90  Aligned_cols=15  Identities=27%  Similarity=0.638  Sum_probs=10.8

Q ss_pred             HHHHHHHHHHHHHHH
Q psy10100         16 SAWGIVQLALMGVFY   30 (65)
Q Consensus        16 SvWGii~L~llGi~F   30 (65)
                      |.|+.+.++++|+.+
T Consensus         6 st~~l~~~gl~~l~~   20 (25)
T PF07589_consen    6 STLALLGLGLLGLAF   20 (25)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            447777777777776


No 21 
>PF06480 FtsH_ext:  FtsH Extracellular;  InterPro: IPR011546 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This domain is found in the FtsH family of proteins that include FtsH a membrane-bound ATP-dependent protease universally conserved in prokaryotes []. The FtsH peptidases, which belong to MEROPS peptidase family M41 (clan MA(E)), efficiently degrade proteins that have a low thermodynamic stability - e.g. they lack robust unfoldase activity. This feature may be key and implies that this could be a criterion for degrading a protein. In Oenococcus oeni (Leuconostoc oenos) FtsH is involved in protection against environmental stress [], and shows increased expression under heat or osmotic stress. These two lines of evidence suggest that it is a fundamental prokaryotic self-protection mechanism that checks if proteins are correctly folded. The precise function of this N-terminal region is unclear. ; GO: 0004222 metalloendopeptidase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0016021 integral to membrane; PDB: 2LNA_A.
Probab=31.59  E-value=16  Score=21.11  Aligned_cols=17  Identities=12%  Similarity=0.252  Sum_probs=0.4

Q ss_pred             HHHHHHHHHHHHHHhhh
Q psy10100         17 AWGIVQLALMGVFYHIR   33 (65)
Q Consensus        17 vWGii~L~llGi~F~~~   33 (65)
                      +|-+|++++++++++..
T Consensus         3 ~~ili~~vi~~l~~~~~   19 (110)
T PF06480_consen    3 LYILIILVILLLFNFFF   19 (110)
T ss_dssp             ----------------S
T ss_pred             ceehhHHHHHHHHHHHH
Confidence            57888888888887754


No 22 
>KOG3202|consensus
Probab=30.96  E-value=49  Score=24.30  Aligned_cols=21  Identities=19%  Similarity=0.271  Sum_probs=17.7

Q ss_pred             CcchhHHHHHHHHHHHHHHHH
Q psy10100          6 PKLSLCGVIISAWGIVQLALM   26 (65)
Q Consensus         6 pk~s~cc~vlSvWGii~L~ll   26 (65)
                      .+|+-||+++++-|++.+++.
T Consensus       211 s~~~~~~~il~l~~~~~lvv~  231 (235)
T KOG3202|consen  211 SQCSQWCAILLLVGLLLLVVI  231 (235)
T ss_pred             ccccchhHHHHHHHHHHHHHH
Confidence            367889999999999988764


No 23 
>PF04995 CcmD:  Heme exporter protein D (CcmD);  InterPro: IPR007078 The CcmD protein is part of a C-type cytochrome biogenesis operon []. The exact function of this protein is uncertain. It has been proposed that CcmC, CcmD and CcmE interact directly with each other, establishing a cytoplasm to periplasm haem delivery pathway for cytochrome c maturation []. This protein is found fused to CcmE in P52224 from SWISSPROT. These proteins contain a predicted transmembrane helix.; GO: 0006810 transport, 0016021 integral to membrane
Probab=30.44  E-value=91  Score=16.95  Aligned_cols=20  Identities=25%  Similarity=0.504  Sum_probs=16.5

Q ss_pred             HHHHHHHHHHHHHHHHHHhh
Q psy10100         13 VIISAWGIVQLALMGVFYHI   32 (65)
Q Consensus        13 ~vlSvWGii~L~llGi~F~~   32 (65)
                      .|.+.+|+-++++.+.....
T Consensus         6 yVW~sYg~t~~~l~~l~~~~   25 (46)
T PF04995_consen    6 YVWSSYGVTALVLAGLIVWS   25 (46)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            57889999999998887764


No 24 
>COG5336 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=29.59  E-value=59  Score=22.02  Aligned_cols=18  Identities=28%  Similarity=0.632  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHHHHHHhhh
Q psy10100         16 SAWGIVQLALMGVFYHIR   33 (65)
Q Consensus        16 SvWGii~L~llGi~F~~~   33 (65)
                      |=||.|.++++|..--++
T Consensus        73 sPwglIv~lllGf~AG~l   90 (116)
T COG5336          73 SPWGLIVFLLLGFGAGVL   90 (116)
T ss_pred             CcHHHHHHHHHHHHHHHH
Confidence            459999999988654443


No 25 
>PF11346 DUF3149:  Protein of unknown function (DUF3149);  InterPro: IPR021494  This bacterial family of proteins has no known function. 
Probab=28.85  E-value=95  Score=17.31  Aligned_cols=18  Identities=39%  Similarity=0.440  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHHHHHHHHh
Q psy10100         14 IISAWGIVQLALMGVFYH   31 (65)
Q Consensus        14 vlSvWGii~L~llGi~F~   31 (65)
                      ++|.-.|+..+.||.+|.
T Consensus        13 L~Sl~vI~~~igm~~~~~   30 (42)
T PF11346_consen   13 LMSLIVIVFTIGMGVFFI   30 (42)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            567778888888887763


No 26 
>PF11833 DUF3353:  Protein of unknown function (DUF3353);  InterPro: IPR021788  This family of proteins are functionally uncharacterised. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 205 to 258 amino acids in length. 
Probab=27.47  E-value=27  Score=24.61  Aligned_cols=19  Identities=16%  Similarity=0.391  Sum_probs=14.9

Q ss_pred             ccCchhhHHHHHHHhhhcC
Q psy10100         47 HFASIDDFYQTVERGYTLL   65 (65)
Q Consensus        47 ~~~s~~~f~~~~~~~Y~~~   65 (65)
                      +|...+.-++++++||+.|
T Consensus        19 ~y~gd~~~~~~IEaAYD~I   37 (194)
T PF11833_consen   19 QYAGDEKSREAIEAAYDAI   37 (194)
T ss_pred             HhcCCHHHHHHHHHHHHHH
Confidence            5666677789999999864


No 27 
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=25.54  E-value=24  Score=18.85  Aligned_cols=10  Identities=40%  Similarity=0.992  Sum_probs=6.5

Q ss_pred             CcccCCcchh
Q psy10100          1 MKICGPKLSL   10 (65)
Q Consensus         1 ~~~cGpk~s~   10 (65)
                      |+-|||..+.
T Consensus        24 C~~CGPr~~i   33 (35)
T PF07503_consen   24 CTNCGPRYSI   33 (35)
T ss_dssp             BTTCC-SCCC
T ss_pred             CCCCCCCEEE
Confidence            4679998764


No 28 
>COG0109 CyoE Polyprenyltransferase (cytochrome oxidase assembly factor) [Posttranslational modification, protein turnover, chaperones]
Probab=24.90  E-value=1.1e+02  Score=23.44  Aligned_cols=26  Identities=23%  Similarity=0.535  Sum_probs=20.0

Q ss_pred             chhHHHHHHHHHHHHH-----------HHHHHHHhhh
Q psy10100          8 LSLCGVIISAWGIVQL-----------ALMGVFYHIR   33 (65)
Q Consensus         8 ~s~cc~vlSvWGii~L-----------~llGi~F~~~   33 (65)
                      .-..++++++-|+++|           ++.|+|||+-
T Consensus       101 al~fgl~L~~~g~~~l~~~vn~laa~l~~~gi~~Yv~  137 (304)
T COG0109         101 ALAFGLVLGVAGFSLLWFLVNLLAAVLGLFGIFFYVV  137 (304)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            3467889999999888           5678888763


No 29 
>PF00746 Gram_pos_anchor:  Gram positive anchor;  InterPro: IPR019948 Viruses, parasites and bacteria are covered in protein and sugar molecules that help them gain entry into a host by counteracting the host's defences. One such molecule is the M protein produced by certain streptococcal bacteria. M proteins embody a motif that is now known to be shared by many Gram-positive bacterial surface proteins. The motif includes a conserved hexapeptide, which precedes a hydrophobic C-terminal membrane anchor, which itself precedes a cluster of basic residues [, ]. This structure is represented in the following schematic representation:  +--------------------------------------------+-+--------+-+ | Variable length extracellular domain |H| Anchor |B| +--------------------------------------------+-+--------+-+ 'H': conserved hexapeptide. 'B': cluster of basic residues.  It has been proposed that this hexapeptide sequence is responsible for a post- translational modification necessary for the proper anchoring of the proteins which bear it, to the cell wall.; PDB: 2XTL_B 3QDH_A 2Y1V_C 2X9X_A 3RPK_A 2X9W_A 2X9Y_A.
Probab=23.21  E-value=27  Score=17.98  Aligned_cols=18  Identities=22%  Similarity=0.318  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q psy10100         13 VIISAWGIVQLALMGVFY   30 (65)
Q Consensus        13 ~vlSvWGii~L~llGi~F   30 (65)
                      .++.+.|++++++.++++
T Consensus        18 ~~~~~~G~l~~~~~~~~~   35 (39)
T PF00746_consen   18 SILTILGALLLLGGGLLL   35 (39)
T ss_dssp             ------------------
T ss_pred             HHHHHHHHHHHHHHHHHh
Confidence            456778885555555444


No 30 
>COG3790 Predicted membrane protein [Function unknown]
Probab=22.21  E-value=66  Score=21.18  Aligned_cols=25  Identities=24%  Similarity=0.417  Sum_probs=21.6

Q ss_pred             HHHHHHHHHHHHHHHHHHhhhhhhh
Q psy10100         13 VIISAWGIVQLALMGVFYHIRSVAL   37 (65)
Q Consensus        13 ~vlSvWGii~L~llGi~F~~~s~~L   37 (65)
                      -++-+||+--..+-|+.|..+|+..
T Consensus        51 ~llmiWavca~~IhGVGFrpr~~~w   75 (97)
T COG3790          51 GLLMIWAVCAGVIHGVGFRPRSVLW   75 (97)
T ss_pred             HHHHHHHHHHHHHhcccCchHHHHH
Confidence            3577999999999999999998754


No 31 
>PF10270 MMgT:  Membrane magnesium transporter;  InterPro: IPR018937 This entry represents a novel family of membrane magnesium transporters (MMgT) []. The proteins, MMgT1 and MMgT2, are localised to the Golgi complex and post-Golgi vesicles, including the early endosomes, suggesting that they may provide regulated pathways for Mg2+ transport in the Golgi and post-Golgi organelles of epithelium-derived cells []. 
Probab=21.92  E-value=85  Score=19.88  Aligned_cols=16  Identities=38%  Similarity=0.586  Sum_probs=11.9

Q ss_pred             hhHHHHHHHHHHHHHH
Q psy10100          9 SLCGVIISAWGIVQLA   24 (65)
Q Consensus         9 s~cc~vlSvWGii~L~   24 (65)
                      +.+++++.+||+++..
T Consensus        42 ~lv~l~l~~~G~v~~~   57 (106)
T PF10270_consen   42 TLVSLILFVFGIVLSA   57 (106)
T ss_pred             HHHHHHHHHHHHHHcc
Confidence            3578888888887654


No 32 
>PF05814 DUF843:  Baculovirus protein of unknown function (DUF843);  InterPro: IPR008561 This family consists of several unidentified baculovirus proteins of around 85 residues long with no known function.
Probab=20.98  E-value=1.5e+02  Score=18.92  Aligned_cols=44  Identities=14%  Similarity=0.246  Sum_probs=27.2

Q ss_pred             HHHHHHHHHHHHHHHhhhhhhhhcCCCCCCcccCchhhHHHHHHHhhh
Q psy10100         16 SAWGIVQLALMGVFYHIRSVALIEDLPGEETHFASIDDFYQTVERGYT   63 (65)
Q Consensus        16 SvWGii~L~llGi~F~~~s~~L~edlp~~~~~~~s~~~f~~~~~~~Y~   63 (65)
                      =+-=+++..++++. |++...-..|++-  ++-++... .++.+++++
T Consensus        31 LilfviF~~~L~~y-y~kteS~~~dL~t--~k~K~~KK-K~~ln~afD   74 (83)
T PF05814_consen   31 LILFVIFFCVLQVY-YIKTESTPQDLQT--EKAKSIKK-KRDLNDAFD   74 (83)
T ss_pred             HHHHHHHHHHHHHH-HcCCCCcHHHHhh--hhhhhHHH-HHHHHHHHH
Confidence            33446677777776 4477777888874  34455533 366777665


No 33 
>PF03530 SK_channel:  Calcium-activated SK potassium channel;  InterPro: IPR011996 Potassium channels are the most diverse group of the ion channel family [, ]. They are important in shaping the action potential, and in neuronal excitability and plasticity []. The potassium channel family is composed of several functionally distinct isoforms, which can be broadly separated into 2 groups []: the practically non-inactivating 'delayed' group and the rapidly inactivating 'transient' group. These are all highly similar proteins, with only small amino acid changes causing the diversity of the voltage-dependent gating mechanism, channel conductance and toxin binding properties. Each type of K+ channel is activated by different signals and conditions depending on their type of regulation: some open in response to depolarisation of the plasma membrane; others in response to hyperpolarisation or an increase in intracellular calcium concentration; some can be regulated by binding of a transmitter, together with intracellular kinases; while others are regulated by GTP-binding proteins or other second messengers []. In eukaryotic cells, K+ channels are involved in neural signalling and generation of the cardiac rhythm, act as effectors in signal transduction pathways involving G protein-coupled receptors (GPCRs) and may have a role in target cell lysis by cytotoxic T-lymphocytes []. In prokaryotic cells, they play a role in the maintenance of ionic homeostasis [].  All K+ channels discovered so far possess a core of alpha subunits, each comprising either one or two copies of a highly conserved pore loop domain (P-domain). The P-domain contains the sequence (T/SxxTxGxG), which has been termed the K+ selectivity sequence. In families that contain one P-domain, four subunits assemble to form a selective pathway for K+ across the membrane. However, it remains unclear how the 2 P-domain subunits assemble to form a selective pore. The functional diversity of these families can arise through homo- or hetero-associations of alpha subunits or association with auxiliary cytoplasmic beta subunits. K+ channel subunits containing one pore domain can be assigned into one of two superfamilies: those that possess six transmembrane (TM) domains and those that possess only two TM domains. The six TM domain superfamily can be further subdivided into conserved gene families: the voltage-gated (Kv) channels; the KCNQ channels (originally known as KvLQT channels); the EAG-like K+ channels; and three types of calcium (Ca)-activated K+ channels (BK, IK and SK) []. The 2TM domain family comprises inward-rectifying K+ channels. In addition, there are K+ channel alpha-subunits that possess two P-domains. These are usually highly regulated K+ selective leak channels. Ca2+-activated K+ channels are a diverse group of channels that are activated by an increase in intracellular Ca2+ concentration. They are found in the majority of nerve cells, where they modulate cell excitability and action potential. Three types of Ca2+-activated K+ channel have been characterised, termed small-conductance (SK), intermediate conductance (IK) and large conductance (BK) respectively []. SK channels are thought to play an important role in the functioning of all excitable tissues. To date, 3 subtypes (designated SK1-SK3) have been cloned, each of which possesses a different tissue expression profile: SK1 channels are expressed in the heart; SK2 channels are found in the adrenal gland; and SK3 channels are known to be present in skeletal muscle []. SK channels have a single-channel conductance of 2-20 pS and are activated by rises in cytosolic calcium with half maximal activation in the 400-800 nM range [, ]. Unlike BK channels, they are voltage insensitive and unaffected by low concentrations of TEA, charybdotoxin, or iberiotoxin. However, they are potently blocked by the bee venom apamin [, ], tubocurarine, and quaternary salts of bicuculline [, ]. A new series of compounds that block SK channels include dequalinium Synonym(s): SK Channel This entry represents a conserved region, found in proteins of SK channels family.
Probab=20.93  E-value=96  Score=20.68  Aligned_cols=19  Identities=26%  Similarity=0.541  Sum_probs=13.4

Q ss_pred             cchhHHHHHHHHHHHHHHH
Q psy10100          7 KLSLCGVIISAWGIVQLAL   25 (65)
Q Consensus         7 k~s~cc~vlSvWGii~L~l   25 (65)
                      +.+.+.+++++.||+.|++
T Consensus        14 rlsD~aL~~a~~GIvlMvi   32 (119)
T PF03530_consen   14 RLSDYALFFAMFGIVLMVI   32 (119)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            4566777888888777654


No 34 
>PRK13747 putative mercury resistance protein; Provisional
Probab=20.92  E-value=2.3e+02  Score=18.00  Aligned_cols=26  Identities=31%  Similarity=0.538  Sum_probs=20.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhhhhh
Q psy10100         12 GVIISAWGIVQLALMGVFYHIRSVAL   37 (65)
Q Consensus        12 c~vlSvWGii~L~llGi~F~~~s~~L   37 (65)
                      ..+-+-|+|+.+.+.|.|+..-+.+|
T Consensus        46 afl~e~w~iaal~lt~LFvlsl~~~l   71 (78)
T PRK13747         46 AFLGEHWGIAALTLTGLFVLSVTRLL   71 (78)
T ss_pred             HHHHHhHHHHHHHHHHHHHHHHHHHH
Confidence            45677899999999998876655544


No 35 
>PF10661 EssA:  WXG100 protein secretion system (Wss), protein EssA;  InterPro: IPR018920  The Wss (WXG100 protein secretion system) in Staphylococcus aureus seems to be encoded by a locus of eight ORFs, called ess (eSAT-6 secretion system) []. This locus encodes, amongst several other proteins, EssA, a protein predicted to possess one transmembrane domain. Due to its predicted membrane location and its absolute requirement for WXG100 protein secretion, it has been speculated that EssA could form a secretion apparatus in conjunction with YukC and YukAB. Proteins homologous to EssA, YukC, EsaA and YukD were absent from mycobacteria [].   Members of this family are associated with type VII secretion of WXG100 family targets in the Firmicutes, but not in the Actinobacteria. This highly divergent protein family consists largely of a central region of highly polar low-complexity sequence containing occasional LF motifs in weak repeats about 17 residues in length, flanked by hydrophobic N- and C-terminal regions. 
Probab=20.41  E-value=1.7e+02  Score=19.81  Aligned_cols=20  Identities=20%  Similarity=0.408  Sum_probs=10.7

Q ss_pred             HHHHHHHHHHHHHHHHHHhh
Q psy10100         13 VIISAWGIVQLALMGVFYHI   32 (65)
Q Consensus        13 ~vlSvWGii~L~llGi~F~~   32 (65)
                      +++++-|+|+++.-||..-.
T Consensus       121 i~~~i~g~ll~i~~giy~~~  140 (145)
T PF10661_consen  121 ILLSIGGILLAICGGIYVVL  140 (145)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            44555566655555555443


No 36 
>PLN03160 uncharacterized protein; Provisional
Probab=20.23  E-value=70  Score=22.58  Aligned_cols=25  Identities=16%  Similarity=0.072  Sum_probs=12.5

Q ss_pred             cchhHHHHHHHHHHHHHHHHHHHHh
Q psy10100          7 KLSLCGVIISAWGIVQLALMGVFYH   31 (65)
Q Consensus         7 k~s~cc~vlSvWGii~L~llGi~F~   31 (65)
                      +|..||.++-.+-++..++.+++++
T Consensus        35 ~~~~c~~~~~a~~l~l~~v~~~l~~   59 (219)
T PLN03160         35 NCIKCCGCITATLLILATTILVLVF   59 (219)
T ss_pred             cceEEHHHHHHHHHHHHHHHHheee
Confidence            4444555554444444555555544


Done!