Diaphorina citri psyllid: psy10118

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41

MHRIVPKYANSPPVLLQHGLCLASDSWVLRGQEDLEMGPGVKHSVNVCIAGMLVLSLLPSNEEVTGKRYPLNIKYTYMFLSSKSNRSDKMRIDTSNPWRFNFIDTAALIELWGYKSEEHKVTTEDGYIISLYRILPKQEGSPPVLVMHGFLACSETFLVRGKPDLAIMLSEAGYDVWLSNFRGNYNGKGHINMTAEDENFWKFSFHEMGLYDLPAFVDFILHRTGFMKMTLLGHSFSNAIIMIMTSLRPEYNEKINLFVGMAPFVFASHLRQGPLLEFLIKSVSNLVPSINGYFPSGTSLYTMAHLIDLYRQRRFCQFDYGRDQNLLRYNSEEPPDYDLSRVTIPILLYSGGADFFTDSRDVTRLEMSLPNLIGSHVLTTYNHFDFVISSDTKEVFYDDMMEVVAKYQQ

ccccccccccccccEEEcHHccccccEEEccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHccccccccccccccccccccccccHHHHHHHHcccccEEEEEcccccEEEEEECcccccccccEEEEcccccccccccccccccHHHHHHHHcccEEEcccccccccccccccccccccccccccHHHHccccHHHHHHHHHHccccEEEEEEEcHHHHHHHHHHcccHHHHHHHHHHHccccHHccccccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEEECcccccccHHHHHHHHHHccccEEEEEcccccccHHHHccccHHHHHHHHHHHHHHHHc

*******YANSPPVLLQHGLCLASDSWVLRGQEDLEMGPGVKHSVNVCIAGMLVLSLLPSNEEVTGKRYPLNIKYTYMFLS**********IDTSNPWRFNFIDTAALIELWGYKSEEHKVTTEDGYIISLYRILPKQEGSPPVLVMHGFLACSETFLVRGKPDLAIMLSEAGYDVWLSNFRGNYNGKGHINMTAEDENFWKFSFHEMGLYDLPAFVDFILHRTGFMKMTLLGHSFSNAIIMIMTSLRPEYNEKINLFVGMAPFVFASHLRQGPLLEFLIKSVSNLVPSINGYFPSGTSLYTMAHLIDLYRQRRFCQFDYGRDQNLLRYNSEEPPDYDLSRVTIPILLYSGGADFFTDSRDVTRLEMSLPNLIGSHVLTTYNHFDFVISSDTKEVFYDDMMEVVAKYQ*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Lipase member K	Plays a highly specific role in the last step of keratinocyte differentiation. May have an essential function in lipid metabolism of the most differentiated epidermal layers.	confident	Q8BM14
Gastric triacylglycerol lipase		confident	Q29458

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0003824 [MF]	catalytic activity	probable	GO:0003674
GO:0008150 [BP]	biological_process	probable
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1K8Q, chain A
Confidence level:very confident
Coverage over the Query: 101-407
View the alignment between query and template
View the model in PyMOL