BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy10161
(197 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3ZYY|X Chain X, Reductive Activator For Corrinoid,Iron-Sulfur Protein
pdb|3ZYY|Y Chain Y, Reductive Activator For Corrinoid,Iron-Sulfur Protein
Length = 631
Score = 30.4 bits (67), Expect = 0.69, Method: Composition-based stats.
Identities = 14/63 (22%), Positives = 28/63 (44%), Gaps = 4/63 (6%)
Query: 79 IIQMVSSFTFTLCRNHEISRRLSHDPTICSQAQFTLLILMSFVLVSPYYCKDGPQTLAYI 138
++ ++ F LC+ H + ++ + T L F+ + P Y + P T A +
Sbjct: 268 VLSTINELIFQLCKEHGVEKKEIMAAVVAGNTTMTHL----FLEIDPRYIRLEPYTPAAL 323
Query: 139 FLP 141
F+P
Sbjct: 324 FIP 326
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.329 0.142 0.469
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,708,882
Number of Sequences: 62578
Number of extensions: 204671
Number of successful extensions: 290
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 290
Number of HSP's gapped (non-prelim): 1
length of query: 197
length of database: 14,973,337
effective HSP length: 94
effective length of query: 103
effective length of database: 9,091,005
effective search space: 936373515
effective search space used: 936373515
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 49 (23.5 bits)