Query         psy10166
Match_columns 104
No_of_seqs    51 out of 53
Neff          4.2 
Searched_HMMs 46136
Date          Fri Aug 16 19:32:21 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10166.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10166hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF10253 PRCC:  Mitotic checkpo  99.9 4.6E-22   1E-26  146.2   5.2   87   13-102    82-175 (182)
  2 KOG3903|consensus               99.8   1E-21 2.2E-26  162.9   3.9   79    6-102   318-403 (410)
  3 PF15144 DUF4576:  Domain of un  31.5      13 0.00027   25.9  -0.5   38   34-71     48-85  (88)
  4 PF04487 CITED:  CITED;  InterP  28.0      25 0.00055   27.9   0.6   20    4-23    157-176 (214)
  5 PF04783 DUF630:  Protein of un  26.4      18 0.00039   23.4  -0.4   21    8-28      2-22  (60)
  6 PF13986 DUF4224:  Domain of un  22.5      52  0.0011   19.8   1.1   17   13-29      2-18  (47)
  7 PF06518 DUF1104:  Protein of u  21.2      63  0.0014   22.3   1.5   16   10-25      2-17  (93)
  8 PF14190 DUF4313:  Domain of un  20.6   1E+02  0.0022   21.7   2.5   27   34-63     46-73  (105)
  9 PF10562 CaM_bdg_C0:  Calmoduli  15.8 1.5E+02  0.0032   16.8   1.9   14   83-96     14-27  (29)
 10 PF06465 DUF1087:  Domain of Un  14.8 1.1E+02  0.0024   20.1   1.4   17   20-36     43-59  (66)

No 1  
>PF10253 PRCC:  Mitotic checkpoint regulator, MAD2B-interacting;  InterPro: IPR018800  This is the highly conserved C-terminal domain of the renal papillary carcinoma protein PRCC. The function of this domain is not known. 
Probab=99.85  E-value=4.6e-22  Score=146.18  Aligned_cols=87  Identities=25%  Similarity=0.449  Sum_probs=80.4

Q ss_pred             ccChHHHHHhhcCCCCCCccceEEecCCCCccchHHHHHHHhhcccccccCCCCCCCCCCChhhhhhhhhHHHHhhh---
Q psy10166         13 IVSMSHELRKLGGRKRKGEDLIVKDVDGNSLVSDSQQWLTKQLSTETTYRPSHNSKHDGPTSQQKRKHQITYLAFQG---   89 (104)
Q Consensus        13 ~iddea~~rL~Gkr~R~~eei~iIdV~~dd~l~~~~qwl~K~Ltee~~~~p~s~~~~~~Ps~~~KRKHQITYLA~qA---   89 (104)
                      .++..++.+|.|+++++  +++||||++|+++++.++|+.+.++++..+++.+.. +..|+..+||||||||||++|   
T Consensus        82 ~~~~~~~r~l~~r~~~~--~~~iie~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~krKHQit~L~~~A~~~  158 (182)
T PF10253_consen   82 NLSAAARRKLFGRGGRG--NIKIIEFNADDEYASNEEWLAKALTEEAAAQQESSH-NPVPSIAQKRKHQITYLAHQAKEN  158 (182)
T ss_pred             hcCHHHHHHHhcccccC--ccceEEecHHHhccchHHHHHhhhhhhhhccccccc-CCCcccccCCcchHHHHHHHHHHH
Confidence            88999999999987666  999999999999999999999999999999997664 778888899999999999999   


Q ss_pred             ----hhhHhHhhhhhhc
Q psy10166         90 ----DNEWTERTVVCLK  102 (104)
Q Consensus        90 ----kn~Wa~nr~tRR~  102 (104)
                          +++||.||++||+
T Consensus       159 e~eL~e~~a~~r~~kr~  175 (182)
T PF10253_consen  159 EEELEERWAQGRKNKRE  175 (182)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence                7899999999996


No 2  
>KOG3903|consensus
Probab=99.84  E-value=1e-21  Score=162.88  Aligned_cols=79  Identities=23%  Similarity=0.373  Sum_probs=71.4

Q ss_pred             cccCcccccChHHHHHhhcCCCCCCccceEEecCCCCccchHHHHHHHhhcccccccCCCCCCCCCCChhhhhhhhhHHH
Q psy10166          6 RQDCDFHIVSMSHELRKLGGRKRKGEDLIVKDVDGNSLVSDSQQWLTKQLSTETTYRPSHNSKHDGPTSQQKRKHQITYL   85 (104)
Q Consensus         6 ~~~~d~~~iddea~~rL~Gkr~R~~eei~iIdV~~dd~l~~~~qwl~K~Ltee~~~~p~s~~~~~~Ps~~~KRKHQITYL   85 (104)
                      +..-++++|.|+.+.||+|.    +.+|+||+|.|      .++||...|++.++++++|+        ++|||||||||
T Consensus       318 ~iae~m~~Ivdvn~drl~~~----r~e~n~vki~G------~~~wm~~~la~s~t~q~~sk--------l~RRKHQITYL  379 (410)
T KOG3903|consen  318 RIAEQMPEIVDVNQDRLMKN----RPEVNQVKITG------IAFWMAYQLATSSTKQKVSK--------LHRRKHQITYL  379 (410)
T ss_pred             hcchhhhHHHhHHHHHHhcc----cccccchhhhh------HHHHhhhcccccccccchhh--------hhhhhHHHHHH
Confidence            33458899999999999997    47999999998      79999999999999999865        35999999999


Q ss_pred             Hhhh-------hhhHhHhhhhhhc
Q psy10166         86 AFQG-------DNEWTERTVVCLK  102 (104)
Q Consensus        86 A~qA-------kn~Wa~nr~tRR~  102 (104)
                      ||+|       |++||+||+|||+
T Consensus       380 ah~Ak~rE~ELk~~WS~nkltkR~  403 (410)
T KOG3903|consen  380 AHDAKHRESELKERWSRNKLTKRE  403 (410)
T ss_pred             HHHHHHhHHHHHHHHhhhhHHHHH
Confidence            9999       8999999999996


No 3  
>PF15144 DUF4576:  Domain of unknown function (DUF4576)
Probab=31.54  E-value=13  Score=25.88  Aligned_cols=38  Identities=5%  Similarity=0.271  Sum_probs=31.9

Q ss_pred             eEEecCCCCccchHHHHHHHhhcccccccCCCCCCCCC
Q psy10166         34 IVKDVDGNSLVSDSQQWLTKQLSTETTYRPSHNSKHDG   71 (104)
Q Consensus        34 ~iIdV~~dd~l~~~~qwl~K~Ltee~~~~p~s~~~~~~   71 (104)
                      +|+++=|.+++.++.++++.+++..+.+--+..+.|+-
T Consensus        48 kFLn~LGteIiEnAVefiLrSMtR~tgF~E~~dk~geh   85 (88)
T PF15144_consen   48 KFLNLLGTEIIENAVEFILRSMTRSTGFMEFEDKQGEH   85 (88)
T ss_pred             HHHHHhhHHHHHHHHHHHHHHhhcccCceecCCCCCCc
Confidence            78888899999999999999999999877766555544


No 4  
>PF04487 CITED:  CITED;  InterPro: IPR007576 CITED, CBP/p300-interacting transactivator with ED-rich tail, is characterised by a conserved 32-amino acid sequence at the C terminus. CITED protein does not bind DNA directly and is thought to function as a transcriptional co-activator [].; GO: 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1R8U_A 1P4Q_A.
Probab=27.95  E-value=25  Score=27.92  Aligned_cols=20  Identities=10%  Similarity=0.067  Sum_probs=11.6

Q ss_pred             cccccCcccccChHHHHHhh
Q psy10166          4 LRRQDCDFHIVSMSHELRKL   23 (104)
Q Consensus         4 ~~~~~~d~~~iddea~~rL~   23 (104)
                      |.-.-.|+++||+|.|..|+
T Consensus       157 ~~~~~~D~d~iDEevL~sLv  176 (214)
T PF04487_consen  157 LPPNVIDTDLIDEEVLMSLV  176 (214)
T ss_dssp             ------S-SSS-CCHHHHHH
T ss_pred             CCCCCccccccCHHHHHHHH
Confidence            44566899999999999998


No 5  
>PF04783 DUF630:  Protein of unknown function (DUF630);  InterPro: IPR006868 This region is sometimes found at the N terminus of putative plant bZIP proteins IPR006867 from INTERPRO. The function of this conserved region is not known.
Probab=26.38  E-value=18  Score=23.40  Aligned_cols=21  Identities=19%  Similarity=0.253  Sum_probs=17.2

Q ss_pred             cCcccccChHHHHHhhcCCCC
Q psy10166          8 DCDFHIVSMSHELRKLGGRKR   28 (104)
Q Consensus         8 ~~d~~~iddea~~rL~Gkr~R   28 (104)
                      +|-.|+||+|....++-.|+|
T Consensus         2 GC~~SK~d~eeaV~~CkeRkr   22 (60)
T PF04783_consen    2 GCSQSKLDDEEAVSLCKERKR   22 (60)
T ss_pred             CCCcccccCcHHHHHHHHHHH
Confidence            499999999999998865543


No 6  
>PF13986 DUF4224:  Domain of unknown function (DUF4224)
Probab=22.45  E-value=52  Score=19.84  Aligned_cols=17  Identities=6%  Similarity=0.036  Sum_probs=14.1

Q ss_pred             ccChHHHHHhhcCCCCC
Q psy10166         13 IVSMSHELRKLGGRKRK   29 (104)
Q Consensus        13 ~iddea~~rL~Gkr~R~   29 (104)
                      |+++|++..|.|.+++.
T Consensus         2 fLT~~El~elTG~k~~~   18 (47)
T PF13986_consen    2 FLTDEELQELTGYKRPS   18 (47)
T ss_pred             CCCHHHHHHHHCCCCHH
Confidence            78999999999976443


No 7  
>PF06518 DUF1104:  Protein of unknown function (DUF1104);  InterPro: IPR009488 This family consists of several hypothetical proteins of unknown function which appear to be found exclusively in Helicobacter pylori.; PDB: 2XRH_A.
Probab=21.22  E-value=63  Score=22.33  Aligned_cols=16  Identities=25%  Similarity=0.291  Sum_probs=14.2

Q ss_pred             cccccChHHHHHhhcC
Q psy10166         10 DFHIVSMSHELRKLGG   25 (104)
Q Consensus        10 d~~~iddea~~rL~Gk   25 (104)
                      |||..+++.|..|.|+
T Consensus         2 DFsk~sn~EL~kmaG~   17 (93)
T PF06518_consen    2 DFSKKSNEELIKMAGK   17 (93)
T ss_dssp             SSTTS-HHHHHHTTTT
T ss_pred             cchhcChHHHHHHHCC
Confidence            8999999999999995


No 8  
>PF14190 DUF4313:  Domain of unknown function (DUF4313)
Probab=20.61  E-value=1e+02  Score=21.66  Aligned_cols=27  Identities=22%  Similarity=0.359  Sum_probs=22.1

Q ss_pred             eEEecCCCCccchHHHHHHH-hhcccccccC
Q psy10166         34 IVKDVDGNSLVSDSQQWLTK-QLSTETTYRP   63 (104)
Q Consensus        34 ~iIdV~~dd~l~~~~qwl~K-~Ltee~~~~p   63 (104)
                      -|||+|..   |+.-+|+.+ +|++.+.++-
T Consensus        46 afId~n~~---~~~~~fl~~n~Lg~~tg~~~   73 (105)
T PF14190_consen   46 AFIDTNNN---PDALEFLKRNKLGKPTGRTR   73 (105)
T ss_pred             EEEeCCCC---HHHHHHHHHCCCCcccCccc
Confidence            79999988   899999998 7888775443


No 9  
>PF10562 CaM_bdg_C0:  Calmodulin-binding domain C0 of NMDA receptor NR1 subunit;  InterPro: IPR018882  This is a very short highly conserved domain that is C-terminal to the cytosolic transmembrane region IV of the NMDA-receptor 1. It has been shown to bind Calmodulin-Calcium with high affinity. The ionotropic N-methyl-D-aspartate receptor (NMDAR) is a major source of calcium flux into neurons in the brain and plays a critical role in learning, memory, neural development, and synaptic plasticity. Calmodulin (CaM) regulates NMDARs by binding tightly to the C0 and C1 regions of their NR1 subunit. The conserved tryptophan is considered to be the anchor residue []. 
Probab=15.80  E-value=1.5e+02  Score=16.83  Aligned_cols=14  Identities=21%  Similarity=0.418  Sum_probs=9.2

Q ss_pred             HHHHhhhhhhHhHh
Q psy10166         83 TYLAFQGDNEWTER   96 (104)
Q Consensus        83 TYLA~qAkn~Wa~n   96 (104)
                      .-||.-|-+.|..|
T Consensus        14 ~elAr~a~dkWR~~   27 (29)
T PF10562_consen   14 LELARHAADKWRGN   27 (29)
T ss_pred             HHHHHHHHHHHHhh
Confidence            45777777777654


No 10 
>PF06465 DUF1087:  Domain of Unknown Function (DUF1087);  InterPro: IPR009463 This is a group of proteins of unknown function.
Probab=14.83  E-value=1.1e+02  Score=20.14  Aligned_cols=17  Identities=24%  Similarity=0.288  Sum_probs=11.3

Q ss_pred             HHhhcCCCCCCccceEE
Q psy10166         20 LRKLGGRKRKGEDLIVK   36 (104)
Q Consensus        20 ~rL~Gkr~R~~eei~iI   36 (104)
                      .+-+||++|.+..|+..
T Consensus        43 ~~~LGKGKR~RKqV~y~   59 (66)
T PF06465_consen   43 EKALGKGKRSRKQVNYA   59 (66)
T ss_pred             HHHhccccccccccccc
Confidence            44557887877777544


Done!