BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy10177
         (116 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1I8F|A Chain A, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|B Chain B, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|C Chain C, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|D Chain D, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|E Chain E, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|F Chain F, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|G Chain G, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1LNX|A Chain A, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|B Chain B, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|C Chain C, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|D Chain D, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|E Chain E, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|F Chain F, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|G Chain G, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
          Length = 81

 Score = 40.4 bits (93), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 33/59 (55%), Gaps = 4/59 (6%)

Query: 1  MVLLRDGRTLIGYLRSVDQFANLVLHKTIERIHVGNQYGDIPRGIFIIRGENVVLMGEV 59
          +V LRD   + G LRS DQ  NL+L    E I  GN Y    RG  ++RGENV+ +  V
Sbjct: 25 LVKLRDSHEIRGILRSFDQHVNLLLEDA-EEIIDGNVY---KRGTMVVRGENVLFISPV 79


>pdb|3CW1|G Chain G, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|3 Chain 3, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|4 Chain 4, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|5 Chain 5, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3PGW|G Chain G, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|J Chain J, Crystal Structure Of Human U1 Snrnp
 pdb|2Y9A|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|3S6N|G Chain G, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
          Gemin2 In Complex With Smd1D2FEG FROM HUMAN
 pdb|4F7U|G Chain G, Macromolecular Machine 6
 pdb|4F7U|J Chain J, Macromolecular Machine 6
 pdb|1VU2|H Chain H, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|P Chain P, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|X Chain X, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|FF Chain f, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|NN Chain n, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|VV Chain v, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|4 Chain 4, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|H Chain H, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|P Chain P, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|X Chain X, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|FF Chain f, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|NN Chain n, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|VV Chain v, The 8s Snrnp Assembly Intermediate
 pdb|4F77|P Chain P, The 8s Snrnp Assembly Intermediate
 pdb|4F77|H Chain H, The 8s Snrnp Assembly Intermediate
 pdb|4F77|X Chain X, The 8s Snrnp Assembly Intermediate
 pdb|4F77|FF Chain f, The 8s Snrnp Assembly Intermediate
 pdb|4F77|NN Chain n, The 8s Snrnp Assembly Intermediate
 pdb|4F77|VV Chain v, The 8s Snrnp Assembly Intermediate
 pdb|4F77|4 Chain 4, The 8s Snrnp Assembly Intermediate
          Length = 76

 Score = 33.9 bits (76), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 4  LRDGRTLIGYLRSVDQFANLVLHKTIERIHVGNQYGDIPRGIFIIRGENVVLM 56
          L  GR + G LR  D F NLV+ + +E    G Q      G+ +IRG +++++
Sbjct: 21 LNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNI---GMVVIRGNSIIML 70


>pdb|4EMH|A Chain A, Crystal Structure Of Splsm4
 pdb|4EMH|B Chain B, Crystal Structure Of Splsm4
 pdb|4EMH|C Chain C, Crystal Structure Of Splsm4
 pdb|4EMH|D Chain D, Crystal Structure Of Splsm4
 pdb|4EMH|E Chain E, Crystal Structure Of Splsm4
 pdb|4EMH|F Chain F, Crystal Structure Of Splsm4
 pdb|4EMH|G Chain G, Crystal Structure Of Splsm4
 pdb|4EMH|H Chain H, Crystal Structure Of Splsm4
 pdb|4EMH|I Chain I, Crystal Structure Of Splsm4
 pdb|4EMH|J Chain J, Crystal Structure Of Splsm4
 pdb|4EMH|K Chain K, Crystal Structure Of Splsm4
 pdb|4EMH|L Chain L, Crystal Structure Of Splsm4
 pdb|4EMH|M Chain M, Crystal Structure Of Splsm4
 pdb|4EMH|N Chain N, Crystal Structure Of Splsm4
 pdb|4EMH|O Chain O, Crystal Structure Of Splsm4
 pdb|4EMH|P Chain P, Crystal Structure Of Splsm4
 pdb|4EMH|Q Chain Q, Crystal Structure Of Splsm4
 pdb|4EMH|R Chain R, Crystal Structure Of Splsm4
 pdb|4EMH|T Chain T, Crystal Structure Of Splsm4
 pdb|4EMH|U Chain U, Crystal Structure Of Splsm4
 pdb|4EMH|V Chain V, Crystal Structure Of Splsm4
 pdb|4EMH|W Chain W, Crystal Structure Of Splsm4
 pdb|4EMH|X Chain X, Crystal Structure Of Splsm4
 pdb|4EMH|Y Chain Y, Crystal Structure Of Splsm4
          Length = 105

 Score = 33.5 bits (75), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 1  MVLLRDGRTLIGYLRSVDQFANLVLHKTIERIHVGNQYGDIPRGIFIIRGENV 53
          +V L++G T  G+L + D + NL L + I     G+++  +P     IRG N+
Sbjct: 30 LVELKNGETFNGHLENCDNYXNLTLREVIRTXPDGDKFFRLPE--CYIRGNNI 80


>pdb|3SWN|C Chain C, Structure Of The Lsm657 Complex: An Assembly Intermediate
           Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|F Chain F, Structure Of The Lsm657 Complex: An Assembly Intermediate
           Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|O Chain O, Structure Of The Lsm657 Complex: An Assembly Intermediate
           Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|R Chain R, Structure Of The Lsm657 Complex: An Assembly Intermediate
           Of The Lsm1 7 And Lsm2 8 Rings
          Length = 117

 Score = 33.1 bits (74), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 4/62 (6%)

Query: 7   GRTLIGYLRSVDQFANLVLHKTIERIHV---GNQYGDIPR-GIFIIRGENVVLMGEVDKE 62
           GR + G L+  DQ  NLVL    E++     G   G I + G+ ++RG  +VL+  +D  
Sbjct: 47  GRQITGILKGFDQLMNLVLDDVEEQLRNPEDGKLTGAIRKLGLVVVRGTTLVLIAPMDGS 106

Query: 63  KE 64
           +E
Sbjct: 107 EE 108


>pdb|3BW1|A Chain A, Crystal Structure Of Homomeric Yeast Lsm3 Exhibiting
          Novel Octameric Ring Organisation
 pdb|3BW1|B Chain B, Crystal Structure Of Homomeric Yeast Lsm3 Exhibiting
          Novel Octameric Ring Organisation
          Length = 96

 Score = 32.7 bits (73), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 4  LRDGRTLIGYLRSVDQFANLVLHKTIERIHVGN--QYGDIPR--GIFIIRGENVVLMG 57
          LR  RTL+G L++ D   N+VL   +E I+  N  +  +  R   +  IRG+ V L+ 
Sbjct: 27 LRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLIS 84


>pdb|4EMK|C Chain C, Crystal Structure Of Splsm567
          Length = 113

 Score = 32.7 bits (73), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 4/62 (6%)

Query: 7   GRTLIGYLRSVDQFANLVLHKTIERIHV---GNQYGDIPR-GIFIIRGENVVLMGEVDKE 62
           GR + G L+  DQ  NLVL    E++     G   G I + G+ ++RG  +VL+   D  
Sbjct: 43  GRQITGILKGFDQLXNLVLDDVEEQLRNPEDGKLTGAIRKLGLVVVRGTTLVLIAPXDGS 102

Query: 63  KE 64
           +E
Sbjct: 103 EE 104


>pdb|1TH7|A Chain A, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|B Chain B, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|C Chain C, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|D Chain D, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|E Chain E, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|F Chain F, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|G Chain G, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|H Chain H, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|I Chain I, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|J Chain J, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|K Chain K, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|L Chain L, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|M Chain M, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|N Chain N, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
          Length = 81

 Score = 31.6 bits (70), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 7/58 (12%)

Query: 1  MVLLRDGRTLIGYLRSVDQFANLVLHKT--IERIHVGNQYGDIPRGIFIIRGENVVLM 56
          +V L+  + + G LRS DQ  NLVL  +  I+    G + G I     +IRG+NV+L+
Sbjct: 23 LVKLKGNKEVRGMLRSYDQHMNLVLSDSEEIQSDGSGKKLGTI-----VIRGDNVILI 75


>pdb|1D3B|B Chain B, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|D Chain D, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|F Chain F, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|H Chain H, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|J Chain J, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|L Chain L, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
          Length = 91

 Score = 30.0 bits (66), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 7/62 (11%)

Query: 2  VLLRDGRTLIGYLRSVDQFANLVLHKTIERIHVGNQYGDIPR-------GIFIIRGENVV 54
           +L+DGR  IG  ++ D+  NL+L    E   +  +             G+ ++RGEN+V
Sbjct: 19 CILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLV 78

Query: 55 LM 56
           M
Sbjct: 79 SM 80


>pdb|2Y9A|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
          Length = 95

 Score = 29.6 bits (65), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 7/62 (11%)

Query: 2  VLLRDGRTLIGYLRSVDQFANLVLHKTIERIHVGNQYGDIPR-------GIFIIRGENVV 54
           +L+DGR  IG  ++ D+  NL+L    E   +  +             G+ ++RGEN+V
Sbjct: 19 CILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLV 78

Query: 55 LM 56
           M
Sbjct: 79 SM 80


>pdb|3PGW|B Chain B, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|Q Chain Q, Crystal Structure Of Human U1 Snrnp
          Length = 231

 Score = 28.1 bits (61), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 7/62 (11%)

Query: 2  VLLRDGRTLIGYLRSVDQFANLVLHKTIERIHVGNQYGDIPR-------GIFIIRGENVV 54
           +L+DGR  IG  ++ D+  NL+L    E   +  +             G+ ++RGEN+V
Sbjct: 19 CILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLV 78

Query: 55 LM 56
           M
Sbjct: 79 SM 80


>pdb|3CW1|A Chain A, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|H Chain H, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|I Chain I, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|J Chain J, Crystal Structure Of Human Spliceosomal U1 Snrnp
          Length = 174

 Score = 27.7 bits (60), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 9/63 (14%)

Query: 2  VLLRDGRTLIGYLRSVDQFANLVLHKTIE--RIHVGNQYGDIPR------GIFIIRGENV 53
           +L+DGR  IG  ++ D+  NL+L    E  +I   N      R      G+ ++RGEN+
Sbjct: 19 CILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSK-QAEREEKRVLGLVLLRGENL 77

Query: 54 VLM 56
          V M
Sbjct: 78 VSM 80


>pdb|3CW1|F Chain F, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|Z Chain Z, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|1 Chain 1, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|2 Chain 2, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3PGW|F Chain F, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|I Chain I, Crystal Structure Of Human U1 Snrnp
 pdb|2Y9A|F Chain F, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|M Chain M, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|T Chain T, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|F Chain F, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|M Chain M, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|T Chain T, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|F Chain F, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|M Chain M, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|T Chain T, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|F Chain F, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|M Chain M, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|T Chain T, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|3S6N|F Chain F, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
          Gemin2 In Complex With Smd1D2FEG FROM HUMAN
 pdb|4F7U|F Chain F, Macromolecular Machine 6
 pdb|4F7U|I Chain I, Macromolecular Machine 6
 pdb|1VU2|D Chain D, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|L Chain L, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|T Chain T, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|BB Chain b, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|JJ Chain j, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|RR Chain r, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|ZZ Chain z, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|D Chain D, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|L Chain L, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|T Chain T, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|BB Chain b, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|JJ Chain j, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|RR Chain r, The 8s Snrnp Assembly Intermediate
 pdb|4F77|L Chain L, The 8s Snrnp Assembly Intermediate
 pdb|4F77|D Chain D, The 8s Snrnp Assembly Intermediate
 pdb|4F77|T Chain T, The 8s Snrnp Assembly Intermediate
 pdb|4F77|BB Chain b, The 8s Snrnp Assembly Intermediate
 pdb|4F77|JJ Chain j, The 8s Snrnp Assembly Intermediate
 pdb|4F77|RR Chain r, The 8s Snrnp Assembly Intermediate
 pdb|4F77|ZZ Chain z, The 8s Snrnp Assembly Intermediate
          Length = 86

 Score = 26.6 bits (57), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 18/32 (56%)

Query: 1  MVLLRDGRTLIGYLRSVDQFANLVLHKTIERI 32
          MV L+ G    GYL SVD + N+ L  T E I
Sbjct: 20 MVKLKWGMEYKGYLVSVDGYMNMQLANTEEYI 51


>pdb|1G0U|M Chain M, A Gated Channel Into The Proteasome Core Particle
 pdb|1G0U|1 Chain 1, A Gated Channel Into The Proteasome Core Particle
 pdb|2ZCY|M Chain M, Yeast 20s Proteasome:syringolin A-Complex
 pdb|2ZCY|0 Chain 0, Yeast 20s Proteasome:syringolin A-Complex
 pdb|3BDM|M Chain M, Yeast 20s Proteasome:glidobactin A-Complex
 pdb|3BDM|0 Chain 0, Yeast 20s Proteasome:glidobactin A-Complex
 pdb|3NZJ|M Chain M, Crystal Structure Of Yeast 20s Proteasome In Complex With
           Ligand 2a
 pdb|3NZJ|1 Chain 1, Crystal Structure Of Yeast 20s Proteasome In Complex With
           Ligand 2a
 pdb|3NZW|M Chain M, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With 2b
 pdb|3NZW|1 Chain 1, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With 2b
 pdb|3NZX|M Chain M, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With Ligand 2c
 pdb|3NZX|1 Chain 1, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With Ligand 2c
 pdb|3MG6|M Chain M, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           6
 pdb|3MG6|1 Chain 1, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           6
 pdb|3MG7|M Chain M, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           8
 pdb|3MG7|1 Chain 1, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           8
 pdb|3MG8|M Chain M, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           16
 pdb|3MG8|1 Chain 1, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           16
 pdb|4B4T|7 Chain 7, Near-Atomic Resolution Structural Model Of The Yeast 26s
           Proteasome
          Length = 266

 Score = 25.8 bits (55), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 52  NVVLMGEVDKEKEHCPQLQQVSVEDILNAQR--KEQEVKQERSRMLAKRLKERGLSFVPD 109
           N +L   VD+E +      QV+ E I+NA R    ++ +  R+  LA   K  GL+F  +
Sbjct: 185 NPLLRKVVDRESDIPKTTVQVAEEAIVNAMRVLYYRDARSSRNFSLAIIDKNTGLTFKKN 244

Query: 110 L 110
           L
Sbjct: 245 L 245


>pdb|1RYP|N Chain N, Crystal Structure Of The 20s Proteasome From Yeast At 2.4
           Angstroms Resolution
 pdb|1RYP|2 Chain 2, Crystal Structure Of The 20s Proteasome From Yeast At 2.4
           Angstroms Resolution
 pdb|1G65|M Chain M, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A
           Molecular Basis For Selectivity Of
           Alpha,Beta-Epoxyketone Proteasome Inhibitors
 pdb|1G65|1 Chain 1, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A
           Molecular Basis For Selectivity Of
           Alpha,Beta-Epoxyketone Proteasome Inhibitors
 pdb|1FNT|N Chain N, Crystal Structure Of The 20s Proteasome From Yeast In
           Complex With The Proteasome Activator Pa26 From
           Trypanosome Brucei At 3.2 Angstroms Resolution
 pdb|1FNT|BB Chain b, Crystal Structure Of The 20s Proteasome From Yeast In
           Complex With The Proteasome Activator Pa26 From
           Trypanosome Brucei At 3.2 Angstroms Resolution
 pdb|1JD2|M Chain M, Crystal Structure Of The Yeast 20s Proteasome:tmc-95a
           Complex: A Non- Covalent Proteasome Inhibitor
 pdb|1JD2|T Chain T, Crystal Structure Of The Yeast 20s Proteasome:tmc-95a
           Complex: A Non- Covalent Proteasome Inhibitor
 pdb|1Z7Q|N Chain N, Crystal Structure Of The 20s Proteasome From Yeast In
           Complex With The Proteasome Activator Pa26 From
           Trypanosome Brucei At 3.2 Angstroms Resolution
 pdb|1Z7Q|BB Chain b, Crystal Structure Of The 20s Proteasome From Yeast In
           Complex With The Proteasome Activator Pa26 From
           Trypanosome Brucei At 3.2 Angstroms Resolution
 pdb|2F16|M Chain M, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With Bortezomib
 pdb|2F16|1 Chain 1, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With Bortezomib
 pdb|2FAK|M Chain M, Crystal Structure Of Salinosporamide A In Complex With The
           Yeast 20s Proteasome
 pdb|2FAK|1 Chain 1, Crystal Structure Of Salinosporamide A In Complex With The
           Yeast 20s Proteasome
 pdb|2GPL|M Chain M, Tmc-95 Based Biphenyl-Ether Macrocycles: Specific
           Proteasome Inhibitors
 pdb|2GPL|1 Chain 1, Tmc-95 Based Biphenyl-Ether Macrocycles: Specific
           Proteasome Inhibitors
 pdb|3D29|M Chain M, Proteasome Inhibition By Fellutamide B
 pdb|3D29|1 Chain 1, Proteasome Inhibition By Fellutamide B
 pdb|3E47|M Chain M, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With Homobelactosin C
 pdb|3E47|1 Chain 1, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With Homobelactosin C
 pdb|3DY3|M Chain M, Crystal Structure Of Yeast 20s Proteasome In Complex With
           The Epimer Form Of Spirolactacystin
 pdb|3DY3|1 Chain 1, Crystal Structure Of Yeast 20s Proteasome In Complex With
           The Epimer Form Of Spirolactacystin
 pdb|3DY4|M Chain M, Crystal Structure Of Yeast 20s Proteasome In Complex With
           Spirolactacystin
 pdb|3DY4|1 Chain 1, Crystal Structure Of Yeast 20s Proteasome In Complex With
           Spirolactacystin
 pdb|3GPJ|M Chain M, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With Syringolin B
 pdb|3GPJ|1 Chain 1, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With Syringolin B
 pdb|3GPT|M Chain M, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With Salinosporamide Derivatives: Slow Substrate Ligand
 pdb|3GPT|1 Chain 1, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With Salinosporamide Derivatives: Slow Substrate Ligand
 pdb|3GPW|M Chain M, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With Salinosporamide Derivatives: Irreversible Inhibitor
           Ligand
 pdb|3GPW|1 Chain 1, Crystal Structure Of The Yeast 20s Proteasome In Complex
           With Salinosporamide Derivatives: Irreversible Inhibitor
           Ligand
 pdb|3HYE|M Chain M, Crystal Structure Of 20s Proteasome In Complex With
           Hydroxylated Salinosporamide
 pdb|3HYE|1 Chain 1, Crystal Structure Of 20s Proteasome In Complex With
           Hydroxylated Salinosporamide
 pdb|1VSY|N Chain N, Proteasome Activator Complex
 pdb|1VSY|2 Chain 2, Proteasome Activator Complex
 pdb|3L5Q|R Chain R, Proteasome Activator Complex
 pdb|3L5Q|4 Chain 4, Proteasome Activator Complex
 pdb|3MG4|M Chain M, Structure Of Yeast 20s Proteasome With Compound 1
 pdb|3MG4|1 Chain 1, Structure Of Yeast 20s Proteasome With Compound 1
 pdb|3MG0|M Chain M, Structure Of Yeast 20s Proteasome With Bortezomib
 pdb|3MG0|1 Chain 1, Structure Of Yeast 20s Proteasome With Bortezomib
 pdb|3OKJ|M Chain M, Alpha-Keto-Aldehyde Binding Mechanism Reveals A Novel Lead
           Structure Motif For Proteasome Inhibition
 pdb|3OKJ|1 Chain 1, Alpha-Keto-Aldehyde Binding Mechanism Reveals A Novel Lead
           Structure Motif For Proteasome Inhibition
 pdb|3OEU|M Chain M, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           24
 pdb|3OEU|1 Chain 1, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           24
 pdb|3OEV|M Chain M, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           25
 pdb|3OEV|1 Chain 1, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           25
 pdb|3TDD|M Chain M, Crystal Structure Of Yeast Cp In Complex With Belactosin C
 pdb|3TDD|1 Chain 1, Crystal Structure Of Yeast Cp In Complex With Belactosin C
 pdb|3SHJ|M Chain M, Proteasome In Complex With Hydroxyurea Derivative Hu10
 pdb|3SHJ|1 Chain 1, Proteasome In Complex With Hydroxyurea Derivative Hu10
 pdb|3UN4|M Chain M, Yeast 20s Proteasome In Complex With Pr-957 (Morpholine)
 pdb|3UN4|AA Chain a, Yeast 20s Proteasome In Complex With Pr-957 (Morpholine)
 pdb|3UN8|M Chain M, Yeast 20s Proteasome In Complex With Pr-957 (Epoxide)
 pdb|3UN8|AA Chain a, Yeast 20s Proteasome In Complex With Pr-957 (Epoxide)
 pdb|3SDI|M Chain M, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           20
 pdb|3SDI|1 Chain 1, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           20
 pdb|3SDK|M Chain M, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           34
 pdb|3SDK|1 Chain 1, Structure Of Yeast 20s Open-Gate Proteasome With Compound
           34
 pdb|4GK7|M Chain M, Yeast 20s Proteasome In Complex With The
           Syringolin-Glidobactin Chimera
 pdb|4GK7|AA Chain a, Yeast 20s Proteasome In Complex With The
           Syringolin-Glidobactin Chimera
 pdb|4G4S|N Chain N, Structure Of Proteasome-Pba1-Pba2 Complex
 pdb|4FZC|M Chain M, 20s Yeast Proteasome In Complex With Cepafungin I
 pdb|4FZC|AA Chain a, 20s Yeast Proteasome In Complex With Cepafungin I
 pdb|4FZG|M Chain M, 20s Yeast Proteasome In Complex With Glidobactin
 pdb|4FZG|AA Chain a, 20s Yeast Proteasome In Complex With Glidobactin
 pdb|4INR|M Chain M, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
           Lu102
 pdb|4INR|AA Chain a, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
           Lu102
 pdb|4INT|M Chain M, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
           Lu122
 pdb|4INT|AA Chain a, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
           Lu122
 pdb|4INU|M Chain M, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
           Lu112
 pdb|4INU|AA Chain a, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
           Lu112
          Length = 233

 Score = 25.4 bits (54), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 52  NVVLMGEVDKEKEHCPQLQQVSVEDILNAQR--KEQEVKQERSRMLAKRLKERGLSFVPD 109
           N +L   VD+E +      QV+ E I+NA R    ++ +  R+  LA   K  GL+F  +
Sbjct: 152 NPLLRKVVDRESDIPKTTVQVAEEAIVNAMRVLYYRDARSSRNFSLAIIDKNTGLTFKKN 211

Query: 110 L 110
           L
Sbjct: 212 L 212


>pdb|3CDK|A Chain A, Crystal Structure Of The Co-Expressed Succinyl-Coa
           Transferase A And B Complex From Bacillus Subtilis
 pdb|3CDK|C Chain C, Crystal Structure Of The Co-Expressed Succinyl-Coa
           Transferase A And B Complex From Bacillus Subtilis
          Length = 241

 Score = 25.4 bits (54), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 21/53 (39%), Gaps = 3/53 (5%)

Query: 17  VDQFANLVLHKTIERIHVGNQYGDIPRGIFIIRGENVVLMGEVDKEKEHCPQL 69
            D   NL+  KT       N    +   I I   E +V  GE+D +  H P +
Sbjct: 162 ADTMGNLIFRKTARNF---NPIAAMAGKITIAEAEEIVEAGELDPDHIHTPGI 211


>pdb|1M0S|A Chain A, Northeast Structural Genomics Consortium (Nesg Id Ir21)
 pdb|1M0S|B Chain B, Northeast Structural Genomics Consortium (Nesg Id Ir21)
          Length = 219

 Score = 25.4 bits (54), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 17/28 (60%)

Query: 36  NQYGDIPRGIFIIRGENVVLMGEVDKEK 63
           N  G +  GIF +RG +VV++G  +  K
Sbjct: 189 NVAGVVTNGIFALRGADVVIVGTPEGAK 216


>pdb|4EFD|A Chain A, Crystal Structure Of An M17 Aminopeptidase From
           Trypanosoma Brucei, Tb427tmp.02.4440
 pdb|4EFD|B Chain B, Crystal Structure Of An M17 Aminopeptidase From
           Trypanosoma Brucei, Tb427tmp.02.4440
 pdb|4EFD|C Chain C, Crystal Structure Of An M17 Aminopeptidase From
           Trypanosoma Brucei, Tb427tmp.02.4440
 pdb|4EFD|D Chain D, Crystal Structure Of An M17 Aminopeptidase From
           Trypanosoma Brucei, Tb427tmp.02.4440
 pdb|4EFD|E Chain E, Crystal Structure Of An M17 Aminopeptidase From
           Trypanosoma Brucei, Tb427tmp.02.4440
 pdb|4EFD|F Chain F, Crystal Structure Of An M17 Aminopeptidase From
           Trypanosoma Brucei, Tb427tmp.02.4440
          Length = 522

 Score = 25.0 bits (53), Expect = 9.6,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 4/52 (7%)

Query: 20  FANLVLHKTIERIHVGNQYGDIPRGIFIIRGENV--VLMGEVDKE--KEHCP 67
           F N  + + IER+  G  YG +  G+    G     V++GEV  +  + +CP
Sbjct: 67  FYNPAVAEAIERVKEGGTYGVLVEGLANAAGSKFVRVVVGEVPTKASRNNCP 118


>pdb|1BK6|A Chain A, Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls
 pdb|1BK6|B Chain B, Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls
          Length = 422

 Score = 25.0 bits (53), Expect = 9.9,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 7/49 (14%)

Query: 51  ENVVLMGEVDKE------KEHCPQLQQV-SVEDILNAQRKEQEVKQERS 92
           EN++ MGE DKE       E+   +++   +E I N Q+ E +   E++
Sbjct: 365 ENIIKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKA 413


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.142    0.397 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,166,613
Number of Sequences: 62578
Number of extensions: 115555
Number of successful extensions: 386
Number of sequences better than 100.0: 22
Number of HSP's better than 100.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 12
Number of HSP's that attempted gapping in prelim test: 370
Number of HSP's gapped (non-prelim): 22
length of query: 116
length of database: 14,973,337
effective HSP length: 79
effective length of query: 37
effective length of database: 10,029,675
effective search space: 371097975
effective search space used: 371097975
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)