Query         psy10193
Match_columns 135
No_of_seqs    133 out of 1046
Neff          5.5 
Searched_HMMs 46136
Date          Fri Aug 16 20:14:09 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10193.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10193hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF00379 Chitin_bind_4:  Insect  99.7   4E-17 8.7E-22  103.4   7.3   52   32-88      1-52  (52)
  2 PF06004 DUF903:  Bacterial pro  88.3     1.4   3E-05   27.9   4.6   39   34-80      2-40  (50)
  3 PHA02698 hypothetical protein;  64.8     4.1 8.9E-05   28.4   1.4   20   86-105    19-38  (89)
  4 PF00659 POLO_box:  POLO box du  48.0      61  0.0013   20.6   4.8   61   31-112     4-67  (68)
  5 PRK15401 alpha-ketoglutarate-d  46.2      36 0.00078   27.4   4.2   49   64-112    45-104 (213)
  6 PF10902 DUF2693:  Protein of u  41.3 1.1E+02  0.0023   21.3   5.4   57   30-90      1-63  (83)
  7 PF13511 DUF4124:  Domain of un  39.7      25 0.00055   21.7   1.9   18   64-84     13-30  (60)
  8 cd07252 BphC1-RGP6_N_like N-te  35.9      51  0.0011   22.4   3.2   20   66-85    101-120 (120)
  9 cd07240 ED_TypeI_classII_N N-t  34.5      62  0.0013   21.2   3.4   20   66-85     98-117 (117)
 10 TIGR01643 YD_repeat_2x YD repe  34.2      69  0.0015   18.0   3.1   21   68-90      9-29  (42)
 11 PF05423 Mycobact_memb:  Mycoba  29.7 1.1E+02  0.0024   23.0   4.3   23   64-87     52-74  (140)
 12 COG3422 Uncharacterized conser  29.7      61  0.0013   21.3   2.5   21   23-43      6-26  (59)
 13 PRK05461 apaG CO2+/MG2+ efflux  29.3      73  0.0016   23.6   3.2   21   59-79     93-113 (127)
 14 PF03562 MltA:  MltA specific i  28.7      39 0.00084   26.1   1.7   57   58-118    79-143 (158)
 15 cd08344 MhqB_like_N N-terminal  27.7      68  0.0015   21.4   2.7   18   66-83     93-110 (112)
 16 PF09244 DUF1964:  Domain of un  26.9      76  0.0016   21.2   2.6   22   64-85      3-24  (68)
 17 PRK14818 NADH dehydrogenase su  26.9      39 0.00084   26.6   1.4   22   94-115   133-154 (173)
 18 PF05899 Cupin_3:  Protein of u  26.8 1.1E+02  0.0023   19.9   3.5   33   58-92     27-59  (74)
 19 PF12118 SprA-related:  SprA-re  26.1      84  0.0018   26.6   3.4   40   66-113   175-215 (294)
 20 COG2967 ApaG Uncharacterized p  25.9 1.3E+02  0.0029   22.5   4.1   21   59-79     92-112 (126)
 21 PHA02978 hypothetical protein;  24.5      71  0.0015   23.7   2.4   16   65-80     75-90  (135)
 22 cd07244 FosA FosA, a Fosfomyci  23.3      96  0.0021   20.9   2.8   18   66-83     94-111 (121)
 23 PF13127 DUF3955:  Protein of u  22.8      48   0.001   21.7   1.1   13   66-78     24-36  (63)
 24 cd09013 BphC-JF8_N_like N-term  22.2 1.2E+02  0.0025   20.4   3.1   16   66-81    102-117 (121)
 25 PF06486 DUF1093:  Protein of u  22.1 1.2E+02  0.0026   19.9   3.0   20   65-84     26-49  (78)
 26 PF09242 FCSD-flav_bind:  Flavo  21.1 1.2E+02  0.0027   19.9   2.9   28   64-91      8-36  (71)
 27 COG4786 FlgG Flagellar basal b  21.0 1.7E+02  0.0037   24.4   4.3   56   44-99     80-138 (265)
 28 cd07266 HPCD_N_class_II N-term  20.6 1.3E+02  0.0029   19.9   3.1   16   66-81    102-117 (121)
 29 PRK06724 hypothetical protein;  20.2 1.3E+02  0.0028   21.3   3.0   21   64-84    103-125 (128)
 30 cd09012 Glo_EDI_BRP_like_24 Th  20.1 1.4E+02   0.003   20.1   3.1   14   68-81    110-123 (124)

No 1  
>PF00379 Chitin_bind_4:  Insect cuticle protein;  InterPro: IPR000618 Insect cuticle is composed of proteins and chitin. The cuticular proteins seem to be specific to the type of cuticle (flexible or stiff) that occur at stages of the insect development. The proteins found in the flexible cuticle of larva and pupa of different insects share a conserved C-terminal section [] such a region is also found in the soft endocuticle of adults insects [] as well as in other cuticular proteins including in arachnids []. In addition, cuticular proteins share hydrophobic regions dominated by tetrapeptide repeats (A-A-P-A/V), which are presumed to be functionally important [, ]. Many insect cuticle proteins also include a 35-36 amino acid motif known as the R and R consensus. An extended form of this motif has been shown [] to bind chitin. It has no sequence similiarity to the cysteine-containing chitin-binding domain of chitinases and some peritrophic membrane proteins, suggesting that arthropods have two distinct classes of chitin-binding proteins, those with the chitin-binding domains found in lectins, chitinases and peritrophic membranes (cysCBD), and those with the type of chitin-binding domains found in cuticular proteins (non-cysCBD) []. The cuticle protein signature has been found in locust cuticle proteins 7 (LM-7), 8 (LM-8), 19 (LM-19) and endocuticle structural glycoprotein ABD-4; Hyalophora cecropia (Cecropia moth) cuticle proteins 12 and 66; Drosophila melanogaster (Fruit fly) larval cuticles proteins I, II, III and IV (LCP1 to LCP4); drosophila pupal cuticle proteins PCP, EDG-78E and EDG-84E; Manduca sexta (Tobacco hawkmoth) cuticle protein LCP-14; Tenebrio molitor (Yellow mealworm) cuticle proteins ACP-20, A1A, A2B and A3A; and Araneus diadematus (Spider) cuticle proteins ACP 11.9, ACP 12.4, ACP 12.6, ACP 15.5 and ACP 15.7.; GO: 0042302 structural constituent of cuticle
Probab=99.71  E-value=4e-17  Score=103.43  Aligned_cols=52  Identities=37%  Similarity=0.700  Sum_probs=46.3

Q ss_pred             eeeEEEcCCCceEEEeeeeecCCccccccceeeeEEEEECCCCcEEEEEEEeCCCCc
Q psy10193         32 YKFAFETGNGIAVQEQGALKNAGQKDLEAQTAQGQSSYTSPDGTPIQTQWYADETGY   88 (135)
Q Consensus        32 Y~f~Ye~~dG~~~~E~G~~k~~G~~~~~~~~v~GsYsy~~pDG~~~~V~YtADenGf   88 (135)
                      |+|+|+++|| .++|.+.   .++ ++..++|+|+|+|++|||+.++|+|+||++||
T Consensus         1 Y~f~Y~~~dg-~~~e~~~---~~~-~~~~~~v~GsY~y~~pdG~~~~V~Y~Ad~~Gf   52 (52)
T PF00379_consen    1 YSFGYETSDG-SRQEEGR---PET-EDEGGVVRGSYSYIDPDGQTRTVTYVADENGF   52 (52)
T ss_pred             CeeEeEcCCC-CEEEEEE---ccc-CCCCCEEEEEEEEECCCCCEEEEEEECCCCCC
Confidence            7899999999 8888877   222 56778999999999999999999999999998


No 2  
>PF06004 DUF903:  Bacterial protein of unknown function (DUF903);  InterPro: IPR010305 This family consists of several small bacterial proteins several of which are classified as putative lipoproteins. The function of this family is unknown.; PDB: 2RB6_B 3BDU_F 2RA2_F 2RD1_C 3FIF_H 2JN0_A 2K57_A.
Probab=88.34  E-value=1.4  Score=27.90  Aligned_cols=39  Identities=28%  Similarity=0.449  Sum_probs=28.4

Q ss_pred             eEEEcCCCceEEEeeeeecCCccccccceeeeEEEEECCCCcEEEEE
Q psy10193         34 FAFETGNGIAVQEQGALKNAGQKDLEAQTAQGQSSYTSPDGTPIQTQ   80 (135)
Q Consensus        34 f~Ye~~dG~~~~E~G~~k~~G~~~~~~~~v~GsYsy~~pDG~~~~V~   80 (135)
                      |--.+.||......|..+-.        .-.|.|+|.+.+|+.+.|+
T Consensus         2 yvi~t~dG~~i~t~gkP~~D--------~~tG~~~y~D~~G~~~qIn   40 (50)
T PF06004_consen    2 YVITTNDGRTIVTDGKPKYD--------KDTGMYSYTDADGKEQQIN   40 (50)
T ss_dssp             EEEEETTSEEEEESSEEEEE--------TTTTEEEEEBTTS-EEEEE
T ss_pred             cEEEeCCCcEEEeCCCcccc--------CCCCcEEEECCCCCEEEEc
Confidence            34467788877777766532        3589999999999998875


No 3  
>PHA02698 hypothetical protein; Provisional
Probab=64.80  E-value=4.1  Score=28.36  Aligned_cols=20  Identities=35%  Similarity=0.826  Sum_probs=16.5

Q ss_pred             CCcccccCCCCCCCCCCHHH
Q psy10193         86 TGYHASGAHLPTPPPIPDEI  105 (135)
Q Consensus        86 nGf~p~g~~lP~pPpip~~i  105 (135)
                      .|-|+.|+..|+|-|+|+++
T Consensus        19 ddvqvnGDlmPtp~p~peeV   38 (89)
T PHA02698         19 DDVQVNGDLMPTPEPTPEEV   38 (89)
T ss_pred             hccccCCcccCCCCCChhhh
Confidence            46788999999999988655


No 4  
>PF00659 POLO_box:  POLO box duplicated region;  InterPro: IPR000959 A subgroup of serine/threonine protein kinases, Polo or Polo-like kinases play multiple roles during the cell cycle. Polo kinases are required at several key points through mitosis, starting from control of the G2/M transition through phosphorylation of Cdc25C and mitotic cyclins. Polo kinases are characterised by an amino terminal catalytic domain, and a carboxy terminal non-catalytic domain consisting of three blocks of conserved sequences known as polo boxes which form one single functional domain []. The domain is named after its founding member encoded by the polo gene of Drosophila melanogaster []. This domain of around 70 amino acids has been found in species ranging from yeast to mammals. Polo boxes appear to mediate interaction with multiple proteins through protein:protein interactions; some but not all of these proteins are substrates for the kinase domain of the molecule [].  The crystal structure of the polo domain of the murine protein, Sak, is dimeric, consisting of two alpha-helices and two six-stranded beta-sheets []. The topology of one polypeptide subunit of the dimer consists of, from its N- to C terminus, an extended strand segment, five beta-strands, one alpha-helix (A) and a C-terminal beta-strand. Beta-strands from one subunit form a contiguous antiparallel beta-sheet with beta-strands from the second subunit. The two beta-sheets pack with a crossing angle of 110 degrees, orienting the hydrophobic surfaces inward and the hydrophilic surfaces outward. Helix A, which is colinear with beta-strand 6 of the same polypeptide, buries a large portion of the non-overlapping hydrophobic beta-sheet surfaces. Interactions involving helices A comprise a majority of the hydrophobic core structure and also the dimer interface. Point mutations in the Polo box of the budding yeast Cdc5 protein abolish the ability of overexpressed Cdc5 to interact with the spindle poles and to organise cytokinetic structures [].; GO: 0005515 protein binding; PDB: 1MBY_B 3P37_A 3MHN_A 1Q4K_A 3HIK_A 3Q1I_A 3P35_A 3MHQ_A 1UMW_B 3MQ8_B ....
Probab=47.95  E-value=61  Score=20.61  Aligned_cols=61  Identities=18%  Similarity=0.302  Sum_probs=31.5

Q ss_pred             CeeeEEEcCCCceEEEeeeeecCCcccccccee---eeEEEEECCCCcEEEEEEEeCCCCcccccCCCCCCCCCCHHHHH
Q psy10193         31 TYKFAFETGNGIAVQEQGALKNAGQKDLEAQTA---QGQSSYTSPDGTPIQTQWYADETGYHASGAHLPTPPPIPDEIAK  107 (135)
Q Consensus        31 ~Y~f~Ye~~dG~~~~E~G~~k~~G~~~~~~~~v---~GsYsy~~pDG~~~~V~YtADenGf~p~g~~lP~pPpip~~i~~  107 (135)
                      .|.+.|..+||..    |..-+.++    -+++   .....|++++|+..+  |...+         +...  .|+++.+
T Consensus         4 k~gi~~~LSng~v----qv~FnD~t----kivl~~~~~~v~yi~~~~~~~~--~~~~~---------~~~~--~p~~l~~   62 (68)
T PF00659_consen    4 KYGIGYQLSNGTV----QVNFNDHT----KIVLSPDGRLVTYIDRDGERQT--YSLSS---------LLED--FPEDLKK   62 (68)
T ss_dssp             CSEEEEEETTSEE----EEEETTS-----EEEEETTCCEEEEE-TTS-EEE--EECTC---------HHHH----HHHHH
T ss_pred             ceEEEEEEeCCCE----EEEEeCCC----EEEECCCCCEEEEECCCCcEEE--EEccc---------cccC--CCHHHHH
Confidence            4789999999984    44555444    1222   236667777666433  33332         1110  3577777


Q ss_pred             HHHhc
Q psy10193        108 AIATL  112 (135)
Q Consensus       108 al~~~  112 (135)
                      -|.++
T Consensus        63 kl~~~   67 (68)
T PF00659_consen   63 KLTYL   67 (68)
T ss_dssp             HHHHH
T ss_pred             Hhhcc
Confidence            77665


No 5  
>PRK15401 alpha-ketoglutarate-dependent dioxygenase AlkB; Provisional
Probab=46.19  E-value=36  Score=27.38  Aligned_cols=49  Identities=20%  Similarity=0.415  Sum_probs=33.3

Q ss_pred             eeEEEEECCCCcEEEE--------EEEeCCCCcccccCC--CCCC-CCCCHHHHHHHHhc
Q psy10193         64 QGQSSYTSPDGTPIQT--------QWYADETGYHASGAH--LPTP-PPIPDEIAKAIATL  112 (135)
Q Consensus        64 ~GsYsy~~pDG~~~~V--------~YtADenGf~p~g~~--lP~p-Ppip~~i~~al~~~  112 (135)
                      ..-+...-+.|....|        -|.+|+.||+=++.+  -+.| ||+|+.+++-.+.+
T Consensus        45 ~p~~~~~~~gg~~msv~mt~~G~~~W~~d~~~YrYs~~~~~~~~pwp~~P~~l~~L~~~~  104 (213)
T PRK15401         45 APFRHMVTPGGYTMSVAMTNCGALGWVTDRRGYRYSPIDPLTGKPWPAMPASFLALAQRA  104 (213)
T ss_pred             CCccceecCCCCcceeEEeccccceEecCCCCcccCCcCCCCCCCCCCchHHHHHHHHHH
Confidence            3346677788877666        788999999998754  3444 56777665544433


No 6  
>PF10902 DUF2693:  Protein of unknown function (DUF2693);  InterPro: IPR024401 This family of proteins is found in bacteria and bacteriophages. Its function is unknown. 
Probab=41.33  E-value=1.1e+02  Score=21.31  Aligned_cols=57  Identities=18%  Similarity=0.335  Sum_probs=35.3

Q ss_pred             CCeeeEEEcCCCceEEEeeeeecCCccccccceeeeEEEEECCCC------cEEEEEEEeCCCCccc
Q psy10193         30 GTYKFAFETGNGIAVQEQGALKNAGQKDLEAQTAQGQSSYTSPDG------TPIQTQWYADETGYHA   90 (135)
Q Consensus        30 G~Y~f~Ye~~dG~~~~E~G~~k~~G~~~~~~~~v~GsYsy~~pDG------~~~~V~YtADenGf~p   90 (135)
                      |.-.|-|+-.||+.|.-.|+++..--    .....|.+.+.-+..      ....+-|--+.+|||-
T Consensus         1 G~h~~~feK~DGtiR~a~gT~d~~li----~~~~~~~~~~~~~~~~~rkes~~s~~yfDve~~~WRS   63 (83)
T PF10902_consen    1 GEHEFVFEKVDGTIRVAKGTRDPDLI----PYEEKGKEMFPPPTKPERKESTTSVRYFDVEKKGWRS   63 (83)
T ss_pred             CcEEEEEEecCCCEEEEEEecCcccc----cceecCcccccCCCCccccCCcceEEEEEeccCceee
Confidence            45678999999999999999874321    123445544433322      2334456666778774


No 7  
>PF13511 DUF4124:  Domain of unknown function (DUF4124)
Probab=39.72  E-value=25  Score=21.73  Aligned_cols=18  Identities=6%  Similarity=0.185  Sum_probs=14.2

Q ss_pred             eeEEEEECCCCcEEEEEEEeC
Q psy10193         64 QGQSSYTSPDGTPIQTQWYAD   84 (135)
Q Consensus        64 ~GsYsy~~pDG~~~~V~YtAD   84 (135)
                      ..-|+|+|.+|+.   +|+-.
T Consensus        13 a~vYk~~D~~G~v---~ysd~   30 (60)
T PF13511_consen   13 AEVYKWVDENGVV---HYSDT   30 (60)
T ss_pred             ccEEEEECCCCCE---EECcc
Confidence            4679999999984   66665


No 8  
>cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1.13.11.39) 1 from Rhodococcus globerulus P6 (BphC1-RGP6) and similar proteins. This subfamily contains the N-terminal, non-catalytic, domain of BphC1-RGP6 and similar proteins. BphC catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, the third step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). This subfamily of BphCs belongs to the type I extradiol dioxygenase family, which require a metal in the active site in its catalytic mechanism. Polychlorinated biphenyl degrading bacteria demonstrate a multiplicity of 2,3-dihydroxybiphenyl 1,2-dioxygenases. For example, three types of BphC enzymes have been found in Rhodococcus globerulus (BphC1-RGP6 - BphC3-RGP6), all three enzymes are type I extradiol dioxygenases. BphC1-RGP6 has an internal duplication, it is a two-domain dioxygenase which forms octamers, and has Fe(II) at the catalytic site. Its N-
Probab=35.89  E-value=51  Score=22.38  Aligned_cols=20  Identities=25%  Similarity=0.523  Sum_probs=16.5

Q ss_pred             EEEEECCCCcEEEEEEEeCC
Q psy10193         66 QSSYTSPDGTPIQTQWYADE   85 (135)
Q Consensus        66 sYsy~~pDG~~~~V~YtADe   85 (135)
                      ++.+.||||..+++.|..+|
T Consensus       101 ~~~~~DPdG~~iE~~~~~~~  120 (120)
T cd07252         101 LIRFADPDGNRHELFWGPKE  120 (120)
T ss_pred             EEEEECCCCCEEEEEecccC
Confidence            67899999999998886543


No 9  
>cd07240 ED_TypeI_classII_N N-terminal domain of type I, class II extradiol dioxygenases; non-catalytic domain. This family contains the N-terminal, non-catalytic, domain of type I, class II extradiol dioxygenases. Dioxygenases catalyze the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms, resulting in the cleavage of aromatic rings. Two major groups of dioxygenases have been identified according to the cleavage site; extradiol enzymes cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon, whereas intradiol enzymes cleave the aromatic ring between two hydroxyl groups. Extradiol dioxygenases are classified into type I and type II enzymes. Type I extradiol dioxygenases include class I and class II enzymes. These two classes of enzymes show sequence similarity; the two-domain class II enzymes evolved from a class I enzyme through gene duplication. The extradiol dioxygenases represented in this fa
Probab=34.46  E-value=62  Score=21.21  Aligned_cols=20  Identities=25%  Similarity=0.371  Sum_probs=16.0

Q ss_pred             EEEEECCCCcEEEEEEEeCC
Q psy10193         66 QSSYTSPDGTPIQTQWYADE   85 (135)
Q Consensus        66 sYsy~~pDG~~~~V~YtADe   85 (135)
                      ++.+.||||..+++.+..|+
T Consensus        98 ~~~~~DP~G~~ie~~~~~~~  117 (117)
T cd07240          98 GLRFQDPDGHLLELFVEADK  117 (117)
T ss_pred             EEEEECCCCCEEEEEEccCC
Confidence            55688999999999877553


No 10 
>TIGR01643 YD_repeat_2x YD repeat (two copies). This model describes two tandem copies of a 21-residue extracellular repeat found in Gram-negative, Gram-positive, and animal proteins. The repeat is named for a YD dipeptide, the most strongly conserved motif of the repeat. These repeats appear in general to be involved in binding carbohydrate; the chicken teneurin-1 YD-repeat region has been shown to bind heparin.
Probab=34.21  E-value=69  Score=18.04  Aligned_cols=21  Identities=29%  Similarity=0.431  Sum_probs=13.3

Q ss_pred             EEECCCCcEEEEEEEeCCCCccc
Q psy10193         68 SYTSPDGTPIQTQWYADETGYHA   90 (135)
Q Consensus        68 sy~~pDG~~~~V~YtADenGf~p   90 (135)
                      +.++|+|...+..|  |..|-..
T Consensus         9 ~~~~p~G~~~~~~Y--D~~Grl~   29 (42)
T TIGR01643         9 GSTDADGTTTRYTY--DAAGRLV   29 (42)
T ss_pred             EEECCCCCEEEEEE--CCCCCEE
Confidence            45778888766666  5555443


No 11 
>PF05423 Mycobact_memb:  Mycobacterium membrane protein;  InterPro: IPR008693 This family contains several membrane proteins from Mycobacterium species [].
Probab=29.72  E-value=1.1e+02  Score=22.98  Aligned_cols=23  Identities=22%  Similarity=0.380  Sum_probs=17.6

Q ss_pred             eeEEEEECCCCcEEEEEEEeCCCC
Q psy10193         64 QGQSSYTSPDGTPIQTQWYADETG   87 (135)
Q Consensus        64 ~GsYsy~~pDG~~~~V~YtADenG   87 (135)
                      +=.|.-.++.|...+|+|. |++|
T Consensus        52 ~V~YEV~G~~G~~~~I~Y~-D~~~   74 (140)
T PF05423_consen   52 TVTYEVTGPPGSTATISYL-DADG   74 (140)
T ss_pred             EEEEEEEcCCCCeEEEEEE-cCCC
Confidence            4468888888999999997 5554


No 12 
>COG3422 Uncharacterized conserved protein [Function unknown]
Probab=29.68  E-value=61  Score=21.29  Aligned_cols=21  Identities=24%  Similarity=0.381  Sum_probs=16.5

Q ss_pred             eccCCCCCCeeeEEEcCCCce
Q psy10193         23 VNEPPVDGTYKFAFETGNGIA   43 (135)
Q Consensus        23 ~~~~~~dG~Y~f~Ye~~dG~~   43 (135)
                      +--.+.+|.|.|.+...||..
T Consensus         6 ei~kdk~Ge~rfrlkA~N~ei   26 (59)
T COG3422           6 EIYKDKAGEYRFRLKAANGEI   26 (59)
T ss_pred             EEEEcCCCcEEEEEEccCccE
Confidence            344678899999999988765


No 13 
>PRK05461 apaG CO2+/MG2+ efflux protein ApaG; Reviewed
Probab=29.28  E-value=73  Score=23.57  Aligned_cols=21  Identities=24%  Similarity=0.366  Sum_probs=16.8

Q ss_pred             ccceeeeEEEEECCCCcEEEE
Q psy10193         59 EAQTAQGQSSYTSPDGTPIQT   79 (135)
Q Consensus        59 ~~~~v~GsYsy~~pDG~~~~V   79 (135)
                      ....++|+|.+++++|....|
T Consensus        93 p~G~M~G~y~~~~~~G~~F~v  113 (127)
T PRK05461         93 PSGTMQGHYQMVDEDGERFEV  113 (127)
T ss_pred             CCEEEEEEEEEEeCCCCEEEE
Confidence            345799999999999987553


No 14 
>PF03562 MltA:  MltA specific insert domain;  InterPro: IPR005300 This group of proteins includes MltA; a membrane-bound, murein degrading transglycosylase enzyme which plays an important role in the controlled growth of the stress-bearing sacculus of Escherichia coli [, ].; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds; PDB: 2PI8_D 2AE0_X 2PIC_A 2GAE_A 2PJJ_A 3CZB_A 2G6G_A 2PNW_A 2G5D_A.
Probab=28.73  E-value=39  Score=26.07  Aligned_cols=57  Identities=23%  Similarity=0.332  Sum_probs=35.0

Q ss_pred             cccceeeeEEEEECCCCcEEEEEEEeCCCC--cccccC------CCCCCCCCCHHHHHHHHhcccccCC
Q psy10193         58 LEAQTAQGQSSYTSPDGTPIQTQWYADETG--YHASGA------HLPTPPPIPDEIAKAIATLPKLVEE  118 (135)
Q Consensus        58 ~~~~~v~GsYsy~~pDG~~~~V~YtADenG--f~p~g~------~lP~pPpip~~i~~al~~~~~~p~~  118 (135)
                      -..+.|+||=.-.-+||..+.|.|-+ .||  |+..|.      .|+..-   -..+.--+|+.+||..
T Consensus        79 ~fflqIQGSGrl~l~DG~~~rvgYAg-~NG~pY~sIGr~Li~~G~i~~~~---~Smq~Ir~wl~~~P~~  143 (158)
T PF03562_consen   79 AFFLQIQGSGRLRLPDGSTVRVGYAG-QNGHPYTSIGRLLIDRGEIPREQ---MSMQAIRAWLRAHPEE  143 (158)
T ss_dssp             HHHHHHHSEEEEE-TTSSEEEEEEEE-E-SS----HHHHHHHTTSS-TTS----SHHHHHHHHHHTGGG
T ss_pred             hHHeeecCcEEEEcCCCCEEEEEEcc-cCCCccccHHHHHHHcCCcChhh---CCHHHHHHHHHHCHHH
Confidence            34678999999999999999999955 555  555442      354211   2244455688888863


No 15 
>cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins. This subfamily contains the N-terminal, non-catalytic, domain of Burkholderia sp. NF100 MhqB and similar proteins. MhqB is a type I extradiol dioxygenase involved in the catabolism of methylhydroquinone, an intermediate in the degradation of fenitrothion. The purified enzyme has shown extradiol ring cleavage activity toward 3-methylcatechol. Fe2+ was suggested as a cofactor, the same as most other enzymes in the family. Burkholderia sp. NF100 MhqB is encoded on the plasmid pNF1. The type I family of extradiol dioxygenases contains two structurally homologous barrel-shaped domains at the N- and C-terminal. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism.
Probab=27.68  E-value=68  Score=21.40  Aligned_cols=18  Identities=22%  Similarity=0.360  Sum_probs=14.7

Q ss_pred             EEEEECCCCcEEEEEEEe
Q psy10193         66 QSSYTSPDGTPIQTQWYA   83 (135)
Q Consensus        66 sYsy~~pDG~~~~V~YtA   83 (135)
                      ++.+.||||..+++.+-+
T Consensus        93 ~~~~~DP~Gn~iel~~~~  110 (112)
T cd08344          93 GVWFRDPDGNLLQVKVAE  110 (112)
T ss_pred             EEEEECCCCCEEEEecCC
Confidence            577999999999988543


No 16 
>PF09244 DUF1964:  Domain of unknown function (DUF1964);  InterPro: IPR015325 This domain is C-terminal to the catalytic sucrose phosphorylase beta/alpha barrel domain. It adopts a beta-sandwich fold, with Greek-key topology and is functionally uncharacterised []. ; PDB: 1R7A_B 2GDU_A 2GDV_A.
Probab=26.93  E-value=76  Score=21.23  Aligned_cols=22  Identities=27%  Similarity=0.516  Sum_probs=16.1

Q ss_pred             eeEEEEECCCCcEEEEEEEeCC
Q psy10193         64 QGQSSYTSPDGTPIQTQWYADE   85 (135)
Q Consensus        64 ~GsYsy~~pDG~~~~V~YtADe   85 (135)
                      -|.|||-..++.-++.+|++.+
T Consensus         3 dG~FSy~~dgdtSitf~W~g~~   24 (68)
T PF09244_consen    3 DGEFSYEADGDTSITFTWTGAT   24 (68)
T ss_dssp             GSEEEEEEETTTEEEEEEE-SS
T ss_pred             cceeeEecCCCcEEEEEEeccc
Confidence            4778888777778888888764


No 17 
>PRK14818 NADH dehydrogenase subunit B; Provisional
Probab=26.87  E-value=39  Score=26.63  Aligned_cols=22  Identities=23%  Similarity=0.612  Sum_probs=16.9

Q ss_pred             CCCCCCCCCHHHHHHHHhcccc
Q psy10193         94 HLPTPPPIPDEIAKAIATLPKL  115 (135)
Q Consensus        94 ~lP~pPpip~~i~~al~~~~~~  115 (135)
                      .||-=||.|++|+.+|-.+.+.
T Consensus       133 yIPGCPP~PeaIl~gil~L~~~  154 (173)
T PRK14818        133 YVPGCPPRPEALTEGLLRLQEI  154 (173)
T ss_pred             EccCCCCCHHHHHHHHHHHHHH
Confidence            5677799999999988755443


No 18 
>PF05899 Cupin_3:  Protein of unknown function (DUF861);  InterPro: IPR008579 The function of the proteins in this entry are unknown. They contain the conserved barrel domain of the 'cupin' superfamily and members are specific to plants and bacteria.; PDB: 1RC6_A 3MYX_A 1O5U_A 2K9Z_A 1LKN_A 3ES4_A 1SFN_B 3BCW_A.
Probab=26.84  E-value=1.1e+02  Score=19.93  Aligned_cols=33  Identities=18%  Similarity=0.244  Sum_probs=23.8

Q ss_pred             cccceeeeEEEEECCCCcEEEEEEEeCCCCccccc
Q psy10193         58 LEAQTAQGQSSYTSPDGTPIQTQWYADETGYHASG   92 (135)
Q Consensus        58 ~~~~~v~GsYsy~~pDG~~~~V~YtADenGf~p~g   92 (135)
                      +-..++.|+-..++++|..  +++.|.+-=|-|.|
T Consensus        27 E~~~vleG~v~it~~~G~~--~~~~aGD~~~~p~G   59 (74)
T PF05899_consen   27 EFFYVLEGEVTITDEDGET--VTFKAGDAFFLPKG   59 (74)
T ss_dssp             EEEEEEEEEEEEEETTTEE--EEEETTEEEEE-TT
T ss_pred             EEEEEEEeEEEEEECCCCE--EEEcCCcEEEECCC
Confidence            3457999999999999997  56777764444443


No 19 
>PF12118 SprA-related:  SprA-related family;  InterPro: IPR021973  Most members of this uncharacterised protein family are annotated as being SprA-related. 
Probab=26.13  E-value=84  Score=26.62  Aligned_cols=40  Identities=25%  Similarity=0.394  Sum_probs=22.6

Q ss_pred             EEEEE-CCCCcEEEEEEEeCCCCcccccCCCCCCCCCCHHHHHHHHhcc
Q psy10193         66 QSSYT-SPDGTPIQTQWYADETGYHASGAHLPTPPPIPDEIAKAIATLP  113 (135)
Q Consensus        66 sYsy~-~pDG~~~~V~YtADenGf~p~g~~lP~pPpip~~i~~al~~~~  113 (135)
                      +|+|. +|||+.|-   +.+|    +..+.-|+ |-.|++.++=+..|+
T Consensus       175 sy~y~~GpDg~~Ya---vgGe----V~id~s~v-~~~P~ati~k~~~v~  215 (294)
T PF12118_consen  175 SYSYQRGPDGKRYA---VGGE----VSIDTSPV-PGDPEATIQKMQQVR  215 (294)
T ss_pred             ceeeeeCCCCceee---ccce----eeeeecCC-CCCHHHHHHHHHHHH
Confidence            67775 89999887   5566    44343332 234555444444443


No 20 
>COG2967 ApaG Uncharacterized protein affecting Mg2+/Co2+ transport [Inorganic ion transport and metabolism]
Probab=25.91  E-value=1.3e+02  Score=22.50  Aligned_cols=21  Identities=24%  Similarity=0.360  Sum_probs=18.0

Q ss_pred             ccceeeeEEEEECCCCcEEEE
Q psy10193         59 EAQTAQGQSSYTSPDGTPIQT   79 (135)
Q Consensus        59 ~~~~v~GsYsy~~pDG~~~~V   79 (135)
                      ...+.+|.|..++.||....|
T Consensus        92 p~G~M~GhY~M~~e~G~~F~v  112 (126)
T COG2967          92 PSGTMQGHYEMIDEDGETFDV  112 (126)
T ss_pred             CcceEEEEEEEecCCCcEEEe
Confidence            456899999999999998765


No 21 
>PHA02978 hypothetical protein; Provisional
Probab=24.54  E-value=71  Score=23.71  Aligned_cols=16  Identities=44%  Similarity=0.578  Sum_probs=12.8

Q ss_pred             eEEEEECCCCcEEEEE
Q psy10193         65 GQSSYTSPDGTPIQTQ   80 (135)
Q Consensus        65 GsYsy~~pDG~~~~V~   80 (135)
                      =.+||.+|||..++|+
T Consensus        75 iy~sy~~~~gisiqvs   90 (135)
T PHA02978         75 IYFSYADPDGISIQVS   90 (135)
T ss_pred             EEEEecCCCceEEEEe
Confidence            3567899999988875


No 22 
>cd07244 FosA FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive. This subfamily family contains FosA, a fosfomycin resistant protein. Fosfomycin inhibits the enzyme UDP-N-acetylglucosamine-3-enolpyruvyltransferase (MurA), which catalyzes the first committed step in bacterial cell wall biosynthesis. FosA, catalyzes the addition of glutathione to the antibiotic fosfomycin, (1R,2S)-epoxypropylphosphonic acid, making it inactive. FosA is a Mn(II) dependent enzyme. It is evolutionarily related to glyoxalase I and type I extradiol dioxygenases.
Probab=23.30  E-value=96  Score=20.95  Aligned_cols=18  Identities=17%  Similarity=0.311  Sum_probs=14.2

Q ss_pred             EEEEECCCCcEEEEEEEe
Q psy10193         66 QSSYTSPDGTPIQTQWYA   83 (135)
Q Consensus        66 sYsy~~pDG~~~~V~YtA   83 (135)
                      ++.+.||||..+++.+-|
T Consensus        94 ~~~f~DPdG~~ie~~~~~  111 (121)
T cd07244          94 SFYFLDPDGHKLELHVGS  111 (121)
T ss_pred             EEEEECCCCCEEEEEeCC
Confidence            556889999999988654


No 23 
>PF13127 DUF3955:  Protein of unknown function (DUF3955)
Probab=22.81  E-value=48  Score=21.66  Aligned_cols=13  Identities=31%  Similarity=0.437  Sum_probs=9.8

Q ss_pred             EEEEECCCCcEEE
Q psy10193         66 QSSYTSPDGTPIQ   78 (135)
Q Consensus        66 sYsy~~pDG~~~~   78 (135)
                      ++||+|+||...+
T Consensus        24 ~~syVd~~G~L~E   36 (63)
T PF13127_consen   24 IGSYVDEDGVLHE   36 (63)
T ss_pred             ccceECCCCeEec
Confidence            3579999998754


No 24 
>cd09013 BphC-JF8_N_like N-terminal, non-catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp. JF8 and similar proteins. 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC) catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, a key step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). BphC belongs to the type I extradiol dioxygenase family, which requires a metal ion in the active site in its catalytic mechanism. Polychlorinated biphenyl degrading bacteria demonstrate a multiplicity of BphCs. This subfamily of BphC is represented by the enzyme purified from the thermophilic biphenyl and naphthalene degrader, Bacillus sp. JF8. The members in this family of BphC enzymes may use either Mn(II) or Fe(II) as cofactors. The enzyme purified from Bacillus sp. JF8 is Mn(II)-dependent, however, the enzyme from Rhodococcus jostii RHAI has Fe(II) bound to it. BphC_JF8 is thermostable and its optimum activity is at 85 degrees C
Probab=22.18  E-value=1.2e+02  Score=20.40  Aligned_cols=16  Identities=38%  Similarity=0.966  Sum_probs=13.7

Q ss_pred             EEEEECCCCcEEEEEE
Q psy10193         66 QSSYTSPDGTPIQTQW   81 (135)
Q Consensus        66 sYsy~~pDG~~~~V~Y   81 (135)
                      ++.+.||||..+++.|
T Consensus       102 ~~~~~DPdG~~iEl~~  117 (121)
T cd09013         102 AYRFRSPDGHPMELYW  117 (121)
T ss_pred             eEEEECCCCCEEEEEE
Confidence            5678999999999876


No 25 
>PF06486 DUF1093:  Protein of unknown function (DUF1093);  InterPro: IPR006542 These are a family of small (about 115 amino acids) uncharacterised proteins with N-terminal signal sequences, found exclusively in Gram-positive organisms. Most genomes that have any members of this family have at least two members.; PDB: 3NPP_B 2K5Q_A 2K5W_A.
Probab=22.12  E-value=1.2e+02  Score=19.85  Aligned_cols=20  Identities=25%  Similarity=0.311  Sum_probs=15.1

Q ss_pred             eEEEEE----CCCCcEEEEEEEeC
Q psy10193         65 GQSSYT----SPDGTPIQTQWYAD   84 (135)
Q Consensus        65 GsYsy~----~pDG~~~~V~YtAD   84 (135)
                      +.|.|.    +.+|+..+|+|+|+
T Consensus        26 ~~Y~Y~l~~yd~~G~~k~l~f~~~   49 (78)
T PF06486_consen   26 KGYEYTLKGYDEDGKEKTLTFTAS   49 (78)
T ss_dssp             CEEEEEEEEEETT--EEEEEEEES
T ss_pred             ceEEEEEEEECCCCCEEEEEEEec
Confidence            677775    67999999999998


No 26 
>PF09242 FCSD-flav_bind:  Flavocytochrome c sulphide dehydrogenase, flavin-binding;  InterPro: IPR015323 This entry represents the flavin-binding domain of flavocytochrome c sulphide dehydrogenase (FCSD), enzymes found in sulphur-oxidising bacteria such as the purple phototrophic bacteria Chromatium vinosum [, ]. These enzymes are complexes of flavoprotein and a dihaem cytochrome that carry out hydrogen sulphide-dependent cytochrome C reduction. The dihaem cytochrome folds into two domains, each of which resembles mitochondrial cytochrome c, with the two haem groups bound to the interior of the subunit. The flavoprotein subunit has a glutathione reductase-like fold consisting of a beta(3,4)-alpha(3) core, and an alpha+beta sandwich. The active site of the flavoprotein subunit contains a catalytically important disulphide bridge located above the pyrimidine portion of the flavin ring []. Electrons are transferred from the flavin to one of the haem groups in the cytochrome. This entry represents a flavoprotein domain required for binding to flavin, and subsequent electron transfer. ; PDB: 1FCD_A.
Probab=21.08  E-value=1.2e+02  Score=19.94  Aligned_cols=28  Identities=14%  Similarity=0.158  Sum_probs=18.3

Q ss_pred             eeEEEEECCC-CcEEEEEEEeCCCCcccc
Q psy10193         64 QGQSSYTSPD-GTPIQTQWYADETGYHAS   91 (135)
Q Consensus        64 ~GsYsy~~pD-G~~~~V~YtADenGf~p~   91 (135)
                      .==||+++|| |..+...|..++.++...
T Consensus         8 NtCYSlv~p~~aIsVa~vy~~~~~~i~~v   36 (71)
T PF09242_consen    8 NTCYSLVAPDYAISVAGVYRYDDGKIVEV   36 (71)
T ss_dssp             EEEEEEEETTEEEEEEEEEEE-TTTEEE-
T ss_pred             eeEEEEeCCCceEEEEEEEEECCCeEEEe
Confidence            3358888775 777777788887776443


No 27 
>COG4786 FlgG Flagellar basal body rod protein [Cell motility and secretion]
Probab=20.97  E-value=1.7e+02  Score=24.43  Aligned_cols=56  Identities=27%  Similarity=0.316  Sum_probs=36.0

Q ss_pred             EEEeeeeecCCccccccceeeeEEEEECCCCc-EEEE--EEEeCCCCcccccCCCCCCC
Q psy10193         44 VQEQGALKNAGQKDLEAQTAQGQSSYTSPDGT-PIQT--QWYADETGYHASGAHLPTPP   99 (135)
Q Consensus        44 ~~E~G~~k~~G~~~~~~~~v~GsYsy~~pDG~-~~~V--~YtADenGf~p~g~~lP~pP   99 (135)
                      ..+.|.++..+..-+-.+.-.|.|....|||. .|+=  +++-|++||-+..+-.|+-|
T Consensus        80 ~~tqGsl~~T~n~lD~AI~g~gfF~I~~~dG~~~YTR~G~F~~d~~G~LVT~~G~~vl~  138 (265)
T COG4786          80 VFTQGSLQKTDNPLDLAITGDGFFQIQTPDGTIAYTRDGSFTVDEEGQLVTSNGYPVLD  138 (265)
T ss_pred             eccccCceecCCccceEEcCCceEEEEcCCCCEEEeeCCceeECCCCCEEeCCCCCccC
Confidence            34566666555422344556888988899994 3332  26667888888877666655


No 28 
>cd07266 HPCD_N_class_II N-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD); belongs to the type I class II family of extradiol dioxygenases. This subfamily contains the N-terminal, non-catalytic, domain of HPCD. HPCD catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate. The aromatic ring of 4-hydroxyphenylacetate is opened by this dioxygenase to yield the 3,4-diol product, 2-hydroxy-5-carboxymethylmuconate semialdehyde. HPCD is a homotetramer and each monomer contains two structurally homologous barrel-shaped domains at the N- and C-terminus. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism. Most extradiol dioxygenases contain Fe(II) in their active site, but HPCD can be activated by either Mn(II) or Fe(II). These enzymes belong to the type I class II family of extradiol dioxygenases. The class III 3,4-dihydroxyphenylacetate 2,3-dioxygenases belong to a differ
Probab=20.59  E-value=1.3e+02  Score=19.90  Aligned_cols=16  Identities=25%  Similarity=0.223  Sum_probs=13.0

Q ss_pred             EEEEECCCCcEEEEEE
Q psy10193         66 QSSYTSPDGTPIQTQW   81 (135)
Q Consensus        66 sYsy~~pDG~~~~V~Y   81 (135)
                      ++.+.||||..+++.|
T Consensus       102 ~~~~~DPdG~~ve~~~  117 (121)
T cd07266         102 ALRVEDPLGFPIEFYA  117 (121)
T ss_pred             EEEEECCCCCEEEEEe
Confidence            5678899999988765


No 29 
>PRK06724 hypothetical protein; Provisional
Probab=20.18  E-value=1.3e+02  Score=21.34  Aligned_cols=21  Identities=19%  Similarity=0.504  Sum_probs=15.9

Q ss_pred             eeEEE--EECCCCcEEEEEEEeC
Q psy10193         64 QGQSS--YTSPDGTPIQTQWYAD   84 (135)
Q Consensus        64 ~GsYs--y~~pDG~~~~V~YtAD   84 (135)
                      .|.|+  +.||||..+++.|.++
T Consensus       103 ~g~~~~~f~DPdG~~iEl~~~~~  125 (128)
T PRK06724        103 EGYYTIDFYDPNGFIIEVAYTPN  125 (128)
T ss_pred             CCEEEEEEECCCCCEEEEEeCCC
Confidence            45454  6799999999988754


No 30 
>cd09012 Glo_EDI_BRP_like_24 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II).  The protein superfamily contains members with or without domain swapping.
Probab=20.12  E-value=1.4e+02  Score=20.10  Aligned_cols=14  Identities=29%  Similarity=0.650  Sum_probs=12.2

Q ss_pred             EEECCCCcEEEEEE
Q psy10193         68 SYTSPDGTPIQTQW   81 (135)
Q Consensus        68 sy~~pDG~~~~V~Y   81 (135)
                      .+.||||...++.|
T Consensus       110 ~~~DPdG~~ie~~~  123 (124)
T cd09012         110 SFADLDGHLWEVLW  123 (124)
T ss_pred             EEECCCCCEEEEEE
Confidence            48899999999887


Done!