Diaphorina citri psyllid: psy10214


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-----
MMFMGPGGPRGGGNAGPPPFPSAGPGGMGGPGNLGPGGMGPGGLLQGPLAYLEKTTSNIGLPDGRSLSPLEKDEIKLEIDQATLKFLDLARQMEAFFLQKRFLLSALKPELIVKEVNMVTKDIVDLRHDLARKEELIKRHYDKIAVWQNLLSDLQSCLQVLTKEDEVSTTLEKDEIKLEIDQATLKFLDLARQMEAFFLQKRFLLSALKPELIVKEDIVDLRHDLARKEELIKRHYDKIAVWQNLLSDLQGWAKSPAHQGSTSSASGTTPPNSTPTQSGPGISAMGGPLPGMMGGMAPIVPGSTMQPMSGMPQQQQQVQMQQQIHMQHMQQQGMGPGGPPSGPGGPSSGMMFMGPGGPRGGGNAGPPPFPSAGPGGMGGPGNLGPGGMGPGGLLQGPLAYLEKTTSNIGLPDGRR
ccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccc
********************************************LQGPLAYLEKTTSNIGLPDGR*L*PLEKDEIKLEIDQATLKFLDLARQMEAFFLQKRFLLSALKPELIVKEVNMVTKDIVDLRHDLARKEELIKRHYDKIAVWQNLLSDLQSCLQVLTKEDEVSTTLEKDEIKLEIDQATLKFLDLARQMEAFFLQKRFLLSALKPELIVKEDIVDLRHDLARKEELIKRHYDKIAVWQNLLSDLQG****************************************************************************************************************************************************YLEKTTS****P****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMFMGPGGPRGGGNAGPPPFPSAGPGGMGGPGNLGPGGMGPGGLLQGPLAYLEKTTSNIGLPDGRSLSPLEKDEIKLEIDQATLKFLDLARQMEAFFLQKRFLLSALKPELIVKEVNMVTKDIVDLRHDLARKEELIKRHYDKIAVWQNLLSDLQSCLQVLTKEDEVSTTLEKDEIKLEIDQATLKFLDLARQMEAFFLQKRFLLSALKPELIVKEDIVDLRHDLARKEELIKRHYDKIAVWQNLLSDLQGWAKSPAHQGSTSSASGTTPPNSTPTQSGPGISAMGGPLPGMMGGMAPIVPGSTMQPMSGMPQQQQQVQMQQQIHMQHMQQQGMGPGGPPSGPGGPSSGMMFMGPGGPRGGGNAGPPPFPSAGPGGMGGPGNLGPGGMGPGGLLQGPLAYLEKTTSNIGLPDGRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mediator of RNA polymerase II transcription subunit 28 Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.confidentQ9VBQ9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016592 [CC]mediator complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DEQ, chain A
Confidence level:confident
Coverage over the Query: 213-251
View the alignment between query and template
View the model in PyMOL
Template: 3PGW, chain B
Confidence level:probable
Coverage over the Query: 255-262
View the alignment between query and template
View the model in PyMOL
Template: 1S35, chain A
Confidence level:probable
Coverage over the Query: 84-206
View the alignment between query and template
View the model in PyMOL
Template: 1U4Q, chain A
Confidence level:probable
Coverage over the Query: 66-207,219-255
View the alignment between query and template
View the model in PyMOL
Template: 1YKH, chain B
Confidence level:probable
Coverage over the Query: 44-162
View the alignment between query and template
View the model in PyMOL