BLAST Results

Query Summary

Your job contains 1 sequence.

Parameters
Threshold: 0.001
Maximum number of alignments shown: 100
BLAST filter: on

Query Sequence

>psy10215
MIFITWSITLLEYTPSSRISPLQACAHDFFDELRNPATTLPNGNPLPPLFNFTEQELAIQ
PNLNAALLPKRPGSTEDGPNPSSSSAPPPAGPTTSTDLSETTSLHPPGANDMA

High Scoring Gene Products

Symbol, full name Information P value
GSK3A
Uncharacterized protein
protein from Sus scrofa 3.9e-10
Gsk3a
glycogen synthase kinase 3 alpha
gene from Rattus norvegicus 4.8e-10
Gsk3a
Glycogen synthase kinase-3 alpha
protein from Rattus norvegicus 4.8e-10
GSK3A
Glycogen synthase kinase-3 alpha
protein from Homo sapiens 5.5e-10
Gsk3a
glycogen synthase kinase 3 alpha
protein from Mus musculus 6.3e-10
GSK3A
Glycogen synthase kinase-3 alpha
protein from Homo sapiens 7.9e-10
GSK3A
Uncharacterized protein
protein from Canis lupus familiaris 8.1e-10
GSK3A
Uncharacterized protein
protein from Bos taurus 1.3e-09
gsk3aa
glycogen synthase kinase 3 alpha a
gene_product from Danio rerio 1.1e-08
sgg
shaggy
protein from Drosophila melanogaster 1.7e-08
gsk3ab
glycogen synthase kinase 3 alpha b
gene_product from Danio rerio 2.2e-08
F1MIC3
Uncharacterized protein
protein from Bos taurus 5.3e-08
gsk3b
Glycogen synthase kinase-3 beta
protein from Xenopus laevis 7.0e-08
GSK3B
Uncharacterized protein
protein from Gallus gallus 1.7e-07
gsk3b
glycogen synthase kinase 3 beta
gene_product from Danio rerio 2.5e-07
GSK3B
Uncharacterized protein
protein from Sus scrofa 2.5e-07
GSK3B
Uncharacterized protein
protein from Sus scrofa 2.7e-07
si:dkeyp-80c12.7 gene_product from Danio rerio 3.1e-07
GSK3B
Uncharacterized protein
protein from Sus scrofa 3.6e-07
GSK3B
Uncharacterized protein
protein from Canis lupus familiaris 4.0e-07
GSK3B
Glycogen synthase kinase-3 beta
protein from Homo sapiens 4.0e-07
GSK3B
Glycogen synthase kinase-3 beta
protein from Spermophilus citellus 4.0e-07
Gsk3b
glycogen synthase kinase 3 beta
protein from Mus musculus 4.0e-07
Gsk3b
glycogen synthase kinase 3 beta
gene from Rattus norvegicus 4.0e-07
GSK3B
Uncharacterized protein
protein from Canis lupus familiaris 4.2e-07
gskt
gasket
protein from Drosophila melanogaster 5.9e-05
BIN2
AT4G18710
protein from Arabidopsis thaliana 0.00048

Back to top

Raw Blast Data

BLASTP 2.0MP-WashU [04-May-2006] [linux26-i686-ILP32F64 2006-05-09T11:47:08]

Copyright (C) 1996-2006 Washington University, Saint Louis, Missouri USA.
All Rights Reserved.

Reference:  Gish, W. (1996-2006) http://blast.wustl.edu

Query=  psy10215
        (113 letters)

Database:  go_20130330-seqdb.fasta
           368,745 sequences; 169,044,731 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                              High  Probability
Sequences producing High-scoring Segment Pairs:              Score  P(N)      N

UNIPROTKB|F1RGH8 - symbol:GSK3A "Uncharacterized protein"...   153  3.9e-10   1
RGD|620351 - symbol:Gsk3a "glycogen synthase kinase 3 alp...   152  4.8e-10   1
UNIPROTKB|P18265 - symbol:Gsk3a "Glycogen synthase kinase...   152  4.8e-10   1
UNIPROTKB|A8MT37 - symbol:GSK3A "Glycogen synthase kinase...   150  5.5e-10   1
MGI|MGI:2152453 - symbol:Gsk3a "glycogen synthase kinase ...   151  6.3e-10   1
UNIPROTKB|P49840 - symbol:GSK3A "Glycogen synthase kinase...   150  7.9e-10   1
UNIPROTKB|F1PAE3 - symbol:GSK3A "Uncharacterized protein"...   150  8.1e-10   1
UNIPROTKB|A6QLB8 - symbol:GSK3A "GSK3A protein" species:9...   148  1.3e-09   1
ZFIN|ZDB-GENE-060503-796 - symbol:gsk3aa "glycogen syntha...   139  1.1e-08   1
FB|FBgn0003371 - symbol:sgg "shaggy" species:7227 "Drosop...   138  1.7e-08   1
ZFIN|ZDB-GENE-990714-3 - symbol:gsk3ab "glycogen synthase...   136  2.2e-08   1
UNIPROTKB|F1MIC3 - symbol:F1MIC3 "Uncharacterized protein...   124  5.3e-08   1
UNIPROTKB|Q91757 - symbol:gsk3b "Glycogen synthase kinase...   131  7.0e-08   1
UNIPROTKB|F1NPL8 - symbol:GSK3B "Uncharacterized protein"...   127  1.7e-07   1
ZFIN|ZDB-GENE-990714-4 - symbol:gsk3b "glycogen synthase ...   126  2.5e-07   1
UNIPROTKB|K7GSV4 - symbol:GSK3B "Uncharacterized protein"...   124  2.5e-07   1
UNIPROTKB|K7GSS4 - symbol:GSK3B "Uncharacterized protein"...   124  2.7e-07   1
ZFIN|ZDB-GENE-090312-2 - symbol:si:dkeyp-80c12.7 "si:dkey...   125  3.1e-07   1
UNIPROTKB|F1SPD2 - symbol:GSK3B "Uncharacterized protein"...   124  3.6e-07   1
UNIPROTKB|E2R4Y4 - symbol:GSK3B "Uncharacterized protein"...   124  4.0e-07   1
UNIPROTKB|P49841 - symbol:GSK3B "Glycogen synthase kinase...   124  4.0e-07   1
UNIPROTKB|Q5YJC2 - symbol:GSK3B "Glycogen synthase kinase...   124  4.0e-07   1
MGI|MGI:1861437 - symbol:Gsk3b "glycogen synthase kinase ...   124  4.0e-07   1
RGD|70982 - symbol:Gsk3b "glycogen synthase kinase 3 beta...   124  4.0e-07   1
UNIPROTKB|E2RB53 - symbol:GSK3B "Uncharacterized protein"...   124  4.2e-07   1
FB|FBgn0046332 - symbol:gskt "gasket" species:7227 "Droso...   105  5.9e-05   1
TAIR|locus:2124082 - symbol:BIN2 "BRASSINOSTEROID-INSENSI...    95  0.00048   1
ASPGD|ASPL0000007962 - symbol:AN6508 species:162425 "Emer...    93  0.00082   1


>UNIPROTKB|F1RGH8 [details] [associations]
            symbol:GSK3A "Uncharacterized protein" species:9823 "Sus
            scrofa" [GO:2000467 "positive regulation of glycogen (starch)
            synthase activity" evidence=IEA] [GO:0071879 "positive regulation
            of adrenergic receptor signaling pathway" evidence=IEA] [GO:0071407
            "cellular response to organic cyclic compound" evidence=IEA]
            [GO:0071285 "cellular response to lithium ion" evidence=IEA]
            [GO:0061052 "negative regulation of cell growth involved in cardiac
            muscle cell development" evidence=IEA] [GO:0051348 "negative
            regulation of transferase activity" evidence=IEA] [GO:0046627
            "negative regulation of insulin receptor signaling pathway"
            evidence=IEA] [GO:0046325 "negative regulation of glucose import"
            evidence=IEA] [GO:0045944 "positive regulation of transcription
            from RNA polymerase II promoter" evidence=IEA] [GO:0045823
            "positive regulation of heart contraction" evidence=IEA]
            [GO:0044027 "hypermethylation of CpG island" evidence=IEA]
            [GO:0034236 "protein kinase A catalytic subunit binding"
            evidence=IEA] [GO:0033138 "positive regulation of peptidyl-serine
            phosphorylation" evidence=IEA] [GO:0032007 "negative regulation of
            TOR signaling cascade" evidence=IEA] [GO:0030819 "positive
            regulation of cAMP biosynthetic process" evidence=IEA] [GO:0016477
            "cell migration" evidence=IEA] [GO:0010800 "positive regulation of
            peptidyl-threonine phosphorylation" evidence=IEA] [GO:0008286
            "insulin receptor signaling pathway" evidence=IEA] [GO:0006349
            "regulation of gene expression by genetic imprinting" evidence=IEA]
            [GO:0004674 "protein serine/threonine kinase activity"
            evidence=IEA] [GO:0003214 "cardiac left ventricle morphogenesis"
            evidence=IEA] [GO:0003073 "regulation of systemic arterial blood
            pressure" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA]
            InterPro:IPR000719 InterPro:IPR002290 InterPro:IPR008271
            InterPro:IPR011009 InterPro:IPR017441 Pfam:PF00069 PROSITE:PS00107
            PROSITE:PS00108 PROSITE:PS50011 SMART:SM00220 GO:GO:0005524
            GO:GO:0008286 GO:GO:0016477 SUPFAM:SSF56112 GO:GO:0004674
            GO:GO:0045944 GO:GO:0030819 GO:GO:0010800 GO:GO:0032007
            GO:GO:2000467 GO:GO:0033138 GO:GO:0003073 GO:GO:0071407
            GO:GO:0006349 GO:GO:0046627 GO:GO:0071879 GO:GO:0045823
            GO:GO:0071285 GO:GO:0061052 GO:GO:0003214 GO:GO:0051348
            GO:GO:0044027 GO:GO:0046325 OMA:FDELRCP
            GeneTree:ENSGT00520000055635 EMBL:FP565696
            Ensembl:ENSSSCT00000003371 Uniprot:F1RGH8
        Length = 495

 Score = 153 (58.9 bits), Expect = 3.9e-10, P = 3.9e-10
 Identities = 34/66 (51%), Positives = 40/66 (60%)

Query:     4 ITWSITLLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXXXEQELAIQPNL 63
             IT   +LLEYTPSSR+SPL+ACAH+FFDELR                     EL IQP+L
Sbjct:   377 ITLCSSLLEYTPSSRLSPLEACAHNFFDELRCPGTQLPNNRPLPPLFNFSPGELTIQPSL 436

Query:    64 NAALLP 69
             NA L+P
Sbjct:   437 NAILIP 442


>RGD|620351 [details] [associations]
            symbol:Gsk3a "glycogen synthase kinase 3 alpha" species:10116
            "Rattus norvegicus" [GO:0003073 "regulation of systemic arterial
            blood pressure" evidence=IEA;ISO] [GO:0003214 "cardiac left
            ventricle morphogenesis" evidence=IEA;ISO] [GO:0004672 "protein
            kinase activity" evidence=ISO] [GO:0004674 "protein
            serine/threonine kinase activity" evidence=IEA;ISO;NAS;IDA]
            [GO:0005524 "ATP binding" evidence=IEA] [GO:0005829 "cytosol"
            evidence=TAS] [GO:0005977 "glycogen metabolic process"
            evidence=IEA] [GO:0006349 "regulation of gene expression by genetic
            imprinting" evidence=IEA;ISO] [GO:0006468 "protein phosphorylation"
            evidence=ISO;IDA] [GO:0007165 "signal transduction" evidence=NAS]
            [GO:0007399 "nervous system development" evidence=IEA] [GO:0008286
            "insulin receptor signaling pathway" evidence=IEA;ISO] [GO:0010800
            "positive regulation of peptidyl-threonine phosphorylation"
            evidence=IEA;ISO] [GO:0016055 "Wnt receptor signaling pathway"
            evidence=IEA] [GO:0016477 "cell migration" evidence=IEA;ISO]
            [GO:0030819 "positive regulation of cAMP biosynthetic process"
            evidence=IEA;ISO] [GO:0032007 "negative regulation of TOR signaling
            cascade" evidence=IEA;ISO] [GO:0032869 "cellular response to
            insulin stimulus" evidence=ISO] [GO:0033138 "positive regulation of
            peptidyl-serine phosphorylation" evidence=IEA;ISO] [GO:0034236
            "protein kinase A catalytic subunit binding" evidence=ISO;IPI]
            [GO:0044027 "hypermethylation of CpG island" evidence=IEA;ISO]
            [GO:0045823 "positive regulation of heart contraction"
            evidence=IEA;ISO] [GO:0045944 "positive regulation of transcription
            from RNA polymerase II promoter" evidence=IEA;ISO] [GO:0046325
            "negative regulation of glucose import" evidence=ISO] [GO:0046627
            "negative regulation of insulin receptor signaling pathway"
            evidence=ISO] [GO:0050321 "tau-protein kinase activity"
            evidence=IEA] [GO:0051348 "negative regulation of transferase
            activity" evidence=ISO] [GO:0061052 "negative regulation of cell
            growth involved in cardiac muscle cell development"
            evidence=IEA;ISO] [GO:0071285 "cellular response to lithium ion"
            evidence=IEA;ISO] [GO:0071407 "cellular response to organic cyclic
            compound" evidence=IEA;ISO] [GO:0071879 "positive regulation of
            adrenergic receptor signaling pathway" evidence=IEA;ISO]
            [GO:2000467 "positive regulation of glycogen (starch) synthase
            activity" evidence=IEA;ISO] Reactome:REACT_110573
            InterPro:IPR000719 InterPro:IPR002290 InterPro:IPR008271
            InterPro:IPR011009 InterPro:IPR017441 Pfam:PF00069 PROSITE:PS00107
            PROSITE:PS00108 PROSITE:PS50011 SMART:SM00220 RGD:620351
            GO:GO:0005829 GO:GO:0005524 GO:GO:0008286 Reactome:REACT_111984
            GO:GO:0007165 GO:GO:0007399 GO:GO:0016477 GO:GO:0016055
            eggNOG:COG0515 SUPFAM:SSF56112 GO:GO:0004674 GO:GO:0045944
            GO:GO:0030819 GO:GO:0005977 GO:GO:0010800 GO:GO:0050321
            GO:GO:0032007 GO:GO:2000467 GO:GO:0033138 Reactome:REACT_109781
            GO:GO:0003073 GO:GO:0071407 GO:GO:0006349 GO:GO:0046627
            GO:GO:0071879 GO:GO:0045823 GO:GO:0071285 GO:GO:0061052
            GO:GO:0003214 HOVERGEN:HBG014652 GO:GO:0051348 GO:GO:0044027
            GO:GO:0046325 HOGENOM:HOG000233017 CTD:2931 KO:K08822
            OrthoDB:EOG4WH8KZ EMBL:X53427 IPI:IPI00189904 PIR:S14707
            RefSeq:NP_059040.1 UniGene:Rn.36807 ProteinModelPortal:P18265
            SMR:P18265 DIP:DIP-1072N STRING:P18265 PhosphoSite:P18265
            PRIDE:P18265 DNASU:50686 GeneID:50686 KEGG:rno:50686
            UCSC:RGD:620351 InParanoid:P18265 BRENDA:2.7.11.26
            ChEMBL:CHEMBL1075224 NextBio:610536 ArrayExpress:P18265
            Genevestigator:P18265 Uniprot:P18265
        Length = 483

 Score = 152 (58.6 bits), Expect = 4.8e-10, P = 4.8e-10
 Identities = 32/61 (52%), Positives = 38/61 (62%)

Query:     9 TLLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXXXEQELAIQPNLNAALL 68
             +LLEYTPSSR+SPL+ACAH FFDELR                     EL+IQP+LNA L+
Sbjct:   382 SLLEYTPSSRLSPLEACAHSFFDELRSLGTQLPNNRPLPPLFNFSPGELSIQPSLNAILI 441

Query:    69 P 69
             P
Sbjct:   442 P 442


>UNIPROTKB|P18265 [details] [associations]
            symbol:Gsk3a "Glycogen synthase kinase-3 alpha"
            species:10116 "Rattus norvegicus" [GO:0003073 "regulation of
            systemic arterial blood pressure" evidence=IEA] [GO:0003214
            "cardiac left ventricle morphogenesis" evidence=IEA] [GO:0005524
            "ATP binding" evidence=IEA] [GO:0006349 "regulation of gene
            expression by genetic imprinting" evidence=IEA] [GO:0008286
            "insulin receptor signaling pathway" evidence=IEA] [GO:0010800
            "positive regulation of peptidyl-threonine phosphorylation"
            evidence=IEA] [GO:0016477 "cell migration" evidence=IEA]
            [GO:0030819 "positive regulation of cAMP biosynthetic process"
            evidence=IEA] [GO:0032007 "negative regulation of TOR signaling
            cascade" evidence=IEA] [GO:0033138 "positive regulation of
            peptidyl-serine phosphorylation" evidence=IEA] [GO:0044027
            "hypermethylation of CpG island" evidence=IEA] [GO:0045823
            "positive regulation of heart contraction" evidence=IEA]
            [GO:0045944 "positive regulation of transcription from RNA
            polymerase II promoter" evidence=IEA] [GO:0061052 "negative
            regulation of cell growth involved in cardiac muscle cell
            development" evidence=IEA] [GO:0071285 "cellular response to
            lithium ion" evidence=IEA] [GO:0071407 "cellular response to
            organic cyclic compound" evidence=IEA] [GO:0071879 "positive
            regulation of adrenergic receptor signaling pathway" evidence=IEA]
            [GO:2000467 "positive regulation of glycogen (starch) synthase
            activity" evidence=IEA] Reactome:REACT_110573 InterPro:IPR000719
            InterPro:IPR002290 InterPro:IPR008271 InterPro:IPR011009
            InterPro:IPR017441 Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108
            PROSITE:PS50011 SMART:SM00220 RGD:620351 GO:GO:0005829
            GO:GO:0005524 GO:GO:0008286 Reactome:REACT_111984 GO:GO:0007165
            GO:GO:0007399 GO:GO:0016477 GO:GO:0016055 eggNOG:COG0515
            SUPFAM:SSF56112 GO:GO:0004674 GO:GO:0045944 GO:GO:0030819
            GO:GO:0005977 GO:GO:0010800 GO:GO:0050321 GO:GO:0032007
            GO:GO:2000467 GO:GO:0033138 Reactome:REACT_109781 GO:GO:0003073
            GO:GO:0071407 GO:GO:0006349 GO:GO:0046627 GO:GO:0071879
            GO:GO:0045823 GO:GO:0071285 GO:GO:0061052 GO:GO:0003214
            HOVERGEN:HBG014652 GO:GO:0051348 GO:GO:0044027 GO:GO:0046325
            HOGENOM:HOG000233017 CTD:2931 KO:K08822 OrthoDB:EOG4WH8KZ
            EMBL:X53427 IPI:IPI00189904 PIR:S14707 RefSeq:NP_059040.1
            UniGene:Rn.36807 ProteinModelPortal:P18265 SMR:P18265 DIP:DIP-1072N
            STRING:P18265 PhosphoSite:P18265 PRIDE:P18265 DNASU:50686
            GeneID:50686 KEGG:rno:50686 UCSC:RGD:620351 InParanoid:P18265
            BRENDA:2.7.11.26 ChEMBL:CHEMBL1075224 NextBio:610536
            ArrayExpress:P18265 Genevestigator:P18265 Uniprot:P18265
        Length = 483

 Score = 152 (58.6 bits), Expect = 4.8e-10, P = 4.8e-10
 Identities = 32/61 (52%), Positives = 38/61 (62%)

Query:     9 TLLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXXXEQELAIQPNLNAALL 68
             +LLEYTPSSR+SPL+ACAH FFDELR                     EL+IQP+LNA L+
Sbjct:   382 SLLEYTPSSRLSPLEACAHSFFDELRSLGTQLPNNRPLPPLFNFSPGELSIQPSLNAILI 441

Query:    69 P 69
             P
Sbjct:   442 P 442


>UNIPROTKB|A8MT37 [details] [associations]
            symbol:GSK3A "Glycogen synthase kinase-3 alpha"
            species:9606 "Homo sapiens" [GO:0004674 "protein serine/threonine
            kinase activity" evidence=IEA] [GO:0005524 "ATP binding"
            evidence=IEA] InterPro:IPR000719 InterPro:IPR002290
            InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR017441
            Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108 PROSITE:PS50011
            SMART:SM00220 GO:GO:0005524 SUPFAM:SSF56112 GO:GO:0004674
            HOVERGEN:HBG014652 EMBL:AC006486 HOGENOM:HOG000233017
            HGNC:HGNC:4616 ChiTaRS:GSK3A IPI:IPI00880060
            ProteinModelPortal:A8MT37 SMR:A8MT37 STRING:A8MT37 PRIDE:A8MT37
            Ensembl:ENST00000398249 UCSC:uc002ota.1 BindingDB:A8MT37
            ArrayExpress:A8MT37 Bgee:A8MT37 Uniprot:A8MT37
        Length = 401

 Score = 150 (57.9 bits), Expect = 5.5e-10, P = 5.5e-10
 Identities = 32/61 (52%), Positives = 38/61 (62%)

Query:     9 TLLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXXXEQELAIQPNLNAALL 68
             +LLEYTPSSR+SPL+ACAH FFDELR                     EL+IQP+LNA L+
Sbjct:   300 SLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLPPLFNFSAGELSIQPSLNAILI 359

Query:    69 P 69
             P
Sbjct:   360 P 360


>MGI|MGI:2152453 [details] [associations]
            symbol:Gsk3a "glycogen synthase kinase 3 alpha"
            species:10090 "Mus musculus" [GO:0000166 "nucleotide binding"
            evidence=IEA] [GO:0003073 "regulation of systemic arterial blood
            pressure" evidence=IMP] [GO:0003214 "cardiac left ventricle
            morphogenesis" evidence=IMP] [GO:0004672 "protein kinase activity"
            evidence=IDA] [GO:0004674 "protein serine/threonine kinase
            activity" evidence=ISO;IDA] [GO:0005515 "protein binding"
            evidence=IPI] [GO:0005524 "ATP binding" evidence=IEA] [GO:0005975
            "carbohydrate metabolic process" evidence=IEA] [GO:0005977
            "glycogen metabolic process" evidence=IEA] [GO:0006349 "regulation
            of gene expression by genetic imprinting" evidence=IMP] [GO:0006468
            "protein phosphorylation" evidence=IEA;ISO;IDA] [GO:0007399
            "nervous system development" evidence=IEA] [GO:0008286 "insulin
            receptor signaling pathway" evidence=IDA] [GO:0009968 "negative
            regulation of signal transduction" evidence=IEA] [GO:0010800
            "positive regulation of peptidyl-threonine phosphorylation"
            evidence=IDA] [GO:0016055 "Wnt receptor signaling pathway"
            evidence=IEA] [GO:0016301 "kinase activity" evidence=IEA]
            [GO:0016310 "phosphorylation" evidence=IEA] [GO:0016477 "cell
            migration" evidence=IGI] [GO:0016740 "transferase activity"
            evidence=IEA] [GO:0016772 "transferase activity, transferring
            phosphorus-containing groups" evidence=IEA] [GO:0030819 "positive
            regulation of cAMP biosynthetic process" evidence=IMP] [GO:0032007
            "negative regulation of TOR signaling cascade" evidence=IMP]
            [GO:0032869 "cellular response to insulin stimulus" evidence=ISO]
            [GO:0033138 "positive regulation of peptidyl-serine
            phosphorylation" evidence=IDA] [GO:0034236 "protein kinase A
            catalytic subunit binding" evidence=ISO] [GO:0044027
            "hypermethylation of CpG island" evidence=IMP] [GO:0045823
            "positive regulation of heart contraction" evidence=IMP]
            [GO:0045944 "positive regulation of transcription from RNA
            polymerase II promoter" evidence=IMP] [GO:0046325 "negative
            regulation of glucose import" evidence=ISO] [GO:0046627 "negative
            regulation of insulin receptor signaling pathway" evidence=ISO]
            [GO:0050321 "tau-protein kinase activity" evidence=IEA] [GO:0051348
            "negative regulation of transferase activity" evidence=ISO]
            [GO:0061052 "negative regulation of cell growth involved in cardiac
            muscle cell development" evidence=IMP] [GO:0071285 "cellular
            response to lithium ion" evidence=IDA] [GO:0071407 "cellular
            response to organic cyclic compound" evidence=IDA] [GO:0071879
            "positive regulation of adrenergic receptor signaling pathway"
            evidence=IMP] [GO:2000467 "positive regulation of glycogen (starch)
            synthase activity" evidence=IMP] InterPro:IPR000719
            InterPro:IPR002290 InterPro:IPR008271 InterPro:IPR011009
            InterPro:IPR017441 Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108
            PROSITE:PS50011 SMART:SM00220 MGI:MGI:2152453 GO:GO:0005829
            GO:GO:0005524 GO:GO:0008286 GO:GO:0007399 GO:GO:0016477
            GO:GO:0016055 eggNOG:COG0515 SUPFAM:SSF56112 GO:GO:0004674
            GO:GO:0045944 GO:GO:0030819 GO:GO:0005977 GO:GO:0010800
            GO:GO:0050321 GO:GO:0032007 GO:GO:2000467 GO:GO:0033138
            GO:GO:0003073 GO:GO:0071407 GO:GO:0006349 GO:GO:0046627
            GO:GO:0071879 GO:GO:0045823 GO:GO:0071285 GO:GO:0061052
            GO:GO:0003214 HOVERGEN:HBG014652 EMBL:AC156992 GO:GO:0051348
            GO:GO:0044027 GO:GO:0046325 HOGENOM:HOG000233017 CTD:2931 KO:K08822
            OMA:FDELRCP OrthoDB:EOG4WH8KZ EMBL:BC111032 IPI:IPI00648141
            RefSeq:NP_001026837.1 UniGene:Mm.294664 ProteinModelPortal:Q2NL51
            SMR:Q2NL51 IntAct:Q2NL51 STRING:Q2NL51 PhosphoSite:Q2NL51
            PaxDb:Q2NL51 PRIDE:Q2NL51 Ensembl:ENSMUST00000071739 GeneID:606496
            KEGG:mmu:606496 UCSC:uc009frx.1 GeneTree:ENSGT00520000055635
            InParanoid:Q2NL51 NextBio:414454 PMAP-CutDB:Q2NL51 Bgee:Q2NL51
            CleanEx:MM_GSK3A Genevestigator:Q2NL51 Uniprot:Q2NL51
        Length = 490

 Score = 151 (58.2 bits), Expect = 6.3e-10, P = 6.3e-10
 Identities = 32/61 (52%), Positives = 38/61 (62%)

Query:     9 TLLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXXXEQELAIQPNLNAALL 68
             +LLEYTPSSR+SPL+ACAH FFDELR                     EL+IQP+LNA L+
Sbjct:   383 SLLEYTPSSRLSPLEACAHSFFDELRRLGAQLPNDRPLPPLFNFSPGELSIQPSLNAILI 442

Query:    69 P 69
             P
Sbjct:   443 P 443


>UNIPROTKB|P49840 [details] [associations]
            symbol:GSK3A "Glycogen synthase kinase-3 alpha"
            species:9606 "Homo sapiens" [GO:0005524 "ATP binding" evidence=IEA]
            [GO:0005977 "glycogen metabolic process" evidence=IEA] [GO:0007399
            "nervous system development" evidence=IEA] [GO:0016055 "Wnt
            receptor signaling pathway" evidence=IEA] [GO:0010905 "negative
            regulation of UDP-glucose catabolic process" evidence=IC]
            [GO:0050321 "tau-protein kinase activity" evidence=TAS] [GO:2000466
            "negative regulation of glycogen (starch) synthase activity"
            evidence=TAS] [GO:0045719 "negative regulation of glycogen
            biosynthetic process" evidence=TAS] [GO:2000077 "negative
            regulation of type B pancreatic cell development" evidence=TAS]
            [GO:0030877 "beta-catenin destruction complex" evidence=NAS;TAS]
            [GO:0090090 "negative regulation of canonical Wnt receptor
            signaling pathway" evidence=TAS] [GO:0005829 "cytosol"
            evidence=TAS] [GO:0006987 "activation of signaling protein activity
            involved in unfolded protein response" evidence=TAS] [GO:0007173
            "epidermal growth factor receptor signaling pathway" evidence=TAS]
            [GO:0008543 "fibroblast growth factor receptor signaling pathway"
            evidence=TAS] [GO:0030968 "endoplasmic reticulum unfolded protein
            response" evidence=TAS] [GO:0048011 "neurotrophin TRK receptor
            signaling pathway" evidence=TAS] [GO:0048015
            "phosphatidylinositol-mediated signaling" evidence=TAS] [GO:0005515
            "protein binding" evidence=IPI] [GO:0008286 "insulin receptor
            signaling pathway" evidence=ISS] [GO:0046627 "negative regulation
            of insulin receptor signaling pathway" evidence=IMP] [GO:0046325
            "negative regulation of glucose import" evidence=IMP] [GO:0032869
            "cellular response to insulin stimulus" evidence=IMP] [GO:0051348
            "negative regulation of transferase activity" evidence=IMP]
            [GO:0034236 "protein kinase A catalytic subunit binding"
            evidence=IPI] [GO:0006468 "protein phosphorylation" evidence=IDA]
            [GO:0004674 "protein serine/threonine kinase activity"
            evidence=IDA] [GO:0045732 "positive regulation of protein catabolic
            process" evidence=NAS] [GO:0003073 "regulation of systemic arterial
            blood pressure" evidence=ISS] [GO:0003214 "cardiac left ventricle
            morphogenesis" evidence=ISS] [GO:0030819 "positive regulation of
            cAMP biosynthetic process" evidence=ISS] [GO:0032007 "negative
            regulation of TOR signaling cascade" evidence=ISS] [GO:0045823
            "positive regulation of heart contraction" evidence=ISS]
            [GO:0061052 "negative regulation of cell growth involved in cardiac
            muscle cell development" evidence=ISS] [GO:0071879 "positive
            regulation of adrenergic receptor signaling pathway" evidence=ISS]
            [GO:2000467 "positive regulation of glycogen (starch) synthase
            activity" evidence=ISS] InterPro:IPR000719 InterPro:IPR002290
            InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR017441
            Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108 PROSITE:PS50011
            SMART:SM00220 GO:GO:0005829 GO:GO:0005524
            Pathway_Interaction_DB:pi3kciaktpathway Reactome:REACT_111102
            Reactome:REACT_116125 Reactome:REACT_6900 GO:GO:0007173
            GO:GO:0008543 GO:GO:0008286 GO:GO:0048011 GO:GO:0007399
            GO:GO:0006987 Pathway_Interaction_DB:wnt_canonical_pathway
            GO:GO:0016477 GO:GO:0016055 eggNOG:COG0515 SUPFAM:SSF56112
            GO:GO:0004674 GO:GO:0045944 GO:GO:0030819 GO:GO:0005977
            GO:GO:0010800 GO:GO:0050321 GO:GO:0032007 GO:GO:2000467
            GO:GO:0090090 GO:GO:0048015 GO:GO:0033138 GO:GO:0045732
            GO:GO:0003073 GO:GO:0071407 GO:GO:0006349 GO:GO:0046627
            GO:GO:0030877 GO:GO:0071879 GO:GO:0045823
            Pathway_Interaction_DB:foxm1pathway GO:GO:0071285 GO:GO:0061052
            GO:GO:0003214 HOVERGEN:HBG014652 EMBL:AC006486 GO:GO:0044027
            GO:GO:0046325 GO:GO:0045719 HOGENOM:HOG000233017 EMBL:L40027
            EMBL:D63424 EMBL:BC027984 EMBL:BC051865 IPI:IPI00292228
            RefSeq:NP_063937.2 UniGene:Hs.466828 PDB:2DFM PDBsum:2DFM
            ProteinModelPortal:P49840 SMR:P49840 IntAct:P49840
            MINT:MINT-1688290 STRING:P49840 PhosphoSite:P49840 DMDM:12644292
            PaxDb:P49840 PeptideAtlas:P49840 PRIDE:P49840 DNASU:2931
            Ensembl:ENST00000222330 Ensembl:ENST00000453535 GeneID:2931
            KEGG:hsa:2931 UCSC:uc002otb.1 CTD:2931 GeneCards:GC19M042734
            HGNC:HGNC:4616 HPA:CAB004422 HPA:HPA028423 MIM:606784
            neXtProt:NX_P49840 PharmGKB:PA29008 InParanoid:P49840 KO:K08822
            OMA:FDELRCP OrthoDB:EOG4WH8KZ PhylomeDB:P49840 BindingDB:P49840
            ChEMBL:CHEMBL2850 ChiTaRS:GSK3A GenomeRNAi:2931 NextBio:11615
            ArrayExpress:P49840 Bgee:P49840 CleanEx:HS_GSK3A
            Genevestigator:P49840 GermOnline:ENSG00000105723 GO:GO:2000466
            GO:GO:2000077 GO:GO:0010905 Uniprot:P49840
        Length = 483

 Score = 150 (57.9 bits), Expect = 7.9e-10, P = 7.9e-10
 Identities = 32/61 (52%), Positives = 38/61 (62%)

Query:     9 TLLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXXXEQELAIQPNLNAALL 68
             +LLEYTPSSR+SPL+ACAH FFDELR                     EL+IQP+LNA L+
Sbjct:   382 SLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLPPLFNFSAGELSIQPSLNAILI 441

Query:    69 P 69
             P
Sbjct:   442 P 442


>UNIPROTKB|F1PAE3 [details] [associations]
            symbol:GSK3A "Uncharacterized protein" species:9615 "Canis
            lupus familiaris" [GO:0005524 "ATP binding" evidence=IEA]
            [GO:0004674 "protein serine/threonine kinase activity"
            evidence=IEA] InterPro:IPR000719 InterPro:IPR002290
            InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR017441
            Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108 PROSITE:PS50011
            SMART:SM00220 GO:GO:0005524 SUPFAM:SSF56112 GO:GO:0004674
            OMA:FDELRCP GeneTree:ENSGT00520000055635 EMBL:AAEX03000918
            EMBL:AAEX03000919 Ensembl:ENSCAFT00000007861 Uniprot:F1PAE3
        Length = 490

 Score = 150 (57.9 bits), Expect = 8.1e-10, P = 8.1e-10
 Identities = 32/61 (52%), Positives = 38/61 (62%)

Query:     9 TLLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXXXEQELAIQPNLNAALL 68
             +LLEYTPSSR+SPL+ACAH FFDELR                     EL+IQP+LNA L+
Sbjct:   381 SLLEYTPSSRLSPLEACAHSFFDELRCHGTQLPNNRPLPPLFNFSPGELSIQPSLNAILI 440

Query:    69 P 69
             P
Sbjct:   441 P 441


>UNIPROTKB|A6QLB8 [details] [associations]
            symbol:GSK3A "GSK3A protein" species:9913 "Bos taurus"
            [GO:2000467 "positive regulation of glycogen (starch) synthase
            activity" evidence=IEA] [GO:0071879 "positive regulation of
            adrenergic receptor signaling pathway" evidence=IEA] [GO:0071407
            "cellular response to organic cyclic compound" evidence=IEA]
            [GO:0071285 "cellular response to lithium ion" evidence=IEA]
            [GO:0061052 "negative regulation of cell growth involved in cardiac
            muscle cell development" evidence=IEA] [GO:0051348 "negative
            regulation of transferase activity" evidence=IEA] [GO:0046627
            "negative regulation of insulin receptor signaling pathway"
            evidence=IEA] [GO:0046325 "negative regulation of glucose import"
            evidence=IEA] [GO:0045944 "positive regulation of transcription
            from RNA polymerase II promoter" evidence=IEA] [GO:0045823
            "positive regulation of heart contraction" evidence=IEA]
            [GO:0044027 "hypermethylation of CpG island" evidence=IEA]
            [GO:0034236 "protein kinase A catalytic subunit binding"
            evidence=IEA] [GO:0033138 "positive regulation of peptidyl-serine
            phosphorylation" evidence=IEA] [GO:0032007 "negative regulation of
            TOR signaling cascade" evidence=IEA] [GO:0030819 "positive
            regulation of cAMP biosynthetic process" evidence=IEA] [GO:0016477
            "cell migration" evidence=IEA] [GO:0010800 "positive regulation of
            peptidyl-threonine phosphorylation" evidence=IEA] [GO:0008286
            "insulin receptor signaling pathway" evidence=IEA] [GO:0006349
            "regulation of gene expression by genetic imprinting" evidence=IEA]
            [GO:0004674 "protein serine/threonine kinase activity"
            evidence=IEA] [GO:0003214 "cardiac left ventricle morphogenesis"
            evidence=IEA] [GO:0003073 "regulation of systemic arterial blood
            pressure" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA]
            InterPro:IPR000719 InterPro:IPR002290 InterPro:IPR008271
            InterPro:IPR011009 InterPro:IPR017441 Pfam:PF00069 PROSITE:PS00107
            PROSITE:PS00108 PROSITE:PS50011 SMART:SM00220 GO:GO:0005524
            GO:GO:0008286 GO:GO:0016477 eggNOG:COG0515 SUPFAM:SSF56112
            GO:GO:0004674 GO:GO:0045944 GO:GO:0030819 GO:GO:0010800
            GO:GO:0032007 GO:GO:2000467 GO:GO:0033138 GO:GO:0003073
            GO:GO:0071407 GO:GO:0006349 GO:GO:0046627 GO:GO:0071879
            GO:GO:0045823 GO:GO:0071285 GO:GO:0061052 GO:GO:0003214
            HOVERGEN:HBG014652 GO:GO:0051348 GO:GO:0044027 GO:GO:0046325
            HOGENOM:HOG000233017 CTD:2931 KO:K08822 OMA:FDELRCP
            OrthoDB:EOG4WH8KZ GeneTree:ENSGT00520000055635 EMBL:DAAA02047214
            EMBL:DAAA02047215 EMBL:BC147908 IPI:IPI00866989
            RefSeq:NP_001095662.1 UniGene:Bt.33944 SMR:A6QLB8 STRING:A6QLB8
            Ensembl:ENSBTAT00000027660 GeneID:536561 KEGG:bta:536561
            InParanoid:A6QLB8 NextBio:20876974 Uniprot:A6QLB8
        Length = 495

 Score = 148 (57.2 bits), Expect = 1.3e-09, P = 1.3e-09
 Identities = 32/61 (52%), Positives = 37/61 (60%)

Query:     9 TLLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXXXEQELAIQPNLNAALL 68
             +LLEYTPSSR+SPL+ACAH FFDELR                     EL IQP+LNA L+
Sbjct:   382 SLLEYTPSSRLSPLEACAHSFFDELRCPGTQLPNNRPLPPLFNFSPGELTIQPSLNAILI 441

Query:    69 P 69
             P
Sbjct:   442 P 442


>ZFIN|ZDB-GENE-060503-796 [details] [associations]
            symbol:gsk3aa "glycogen synthase kinase 3 alpha a"
            species:7955 "Danio rerio" [GO:0004672 "protein kinase activity"
            evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0006468
            "protein phosphorylation" evidence=IEA] [GO:0016772 "transferase
            activity, transferring phosphorus-containing groups" evidence=IEA]
            [GO:0004674 "protein serine/threonine kinase activity"
            evidence=IEA] [GO:0005575 "cellular_component" evidence=ND]
            [GO:0000166 "nucleotide binding" evidence=IEA] InterPro:IPR000719
            InterPro:IPR002290 InterPro:IPR008271 InterPro:IPR011009
            InterPro:IPR017441 Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108
            PROSITE:PS50011 SMART:SM00220 ZFIN:ZDB-GENE-060503-796
            GO:GO:0005524 eggNOG:COG0515 SUPFAM:SSF56112 GO:GO:0004674
            HOVERGEN:HBG014652 HOGENOM:HOG000233017
            GeneTree:ENSGT00520000055635 KO:K03083 OMA:GCSNLKL EMBL:BX004874
            IPI:IPI00507546 RefSeq:NP_001038386.2 UniGene:Dr.82778 SMR:Q1LYN4
            Ensembl:ENSDART00000049707 Ensembl:ENSDART00000143941 GeneID:560194
            KEGG:dre:560194 CTD:560194 InParanoid:Q1LYN4 NextBio:20883324
            Uniprot:Q1LYN4
        Length = 462

 Score = 139 (54.0 bits), Expect = 1.1e-08, P = 1.1e-08
 Identities = 30/60 (50%), Positives = 34/60 (56%)

Query:    10 LLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXXXEQELAIQPNLNAALLP 69
             LLEYTP +R+SPLQACAH FFDELR                     EL IQP LN+ L+P
Sbjct:   374 LLEYTPVTRLSPLQACAHAFFDELRQPGTRLPSGRELPPLFNFTTTELMIQPQLNSTLIP 433


>FB|FBgn0003371 [details] [associations]
            symbol:sgg "shaggy" species:7227 "Drosophila melanogaster"
            [GO:0007367 "segment polarity determination" evidence=IMP]
            [GO:0004674 "protein serine/threonine kinase activity"
            evidence=IEA;ISS;NAS] [GO:0030178 "negative regulation of Wnt
            receptor signaling pathway" evidence=TAS] [GO:0006355 "regulation
            of transcription, DNA-dependent" evidence=NAS] [GO:0007350
            "blastoderm segmentation" evidence=NAS] [GO:0006468 "protein
            phosphorylation" evidence=IDA;NAS] [GO:0007507 "heart development"
            evidence=NAS;TAS] [GO:0016055 "Wnt receptor signaling pathway"
            evidence=TAS] [GO:0007623 "circadian rhythm" evidence=NAS;IMP;TAS]
            [GO:0008407 "chaeta morphogenesis" evidence=NAS] [GO:0045475
            "locomotor rhythm" evidence=NAS] [GO:0045879 "negative regulation
            of smoothened signaling pathway" evidence=IMP;IDA] [GO:0030162
            "regulation of proteolysis" evidence=IDA] [GO:0004672 "protein
            kinase activity" evidence=IDA] [GO:0007476 "imaginal disc-derived
            wing morphogenesis" evidence=IMP] [GO:0007219 "Notch signaling
            pathway" evidence=TAS] [GO:0007622 "rhythmic behavior"
            evidence=TAS] [GO:0042306 "regulation of protein import into
            nucleus" evidence=TAS] [GO:0048477 "oogenesis" evidence=IMP]
            [GO:0035019 "somatic stem cell maintenance" evidence=IMP]
            [GO:0005524 "ATP binding" evidence=IEA] [GO:0051124 "synaptic
            growth at neuromuscular junction" evidence=IMP] [GO:0045610
            "regulation of hemocyte differentiation" evidence=IMP] [GO:0005515
            "protein binding" evidence=IPI] [GO:0005634 "nucleus" evidence=IDA]
            [GO:0005737 "cytoplasm" evidence=IDA] [GO:0009649 "entrainment of
            circadian clock" evidence=IMP] [GO:0030707 "ovarian follicle cell
            development" evidence=IMP] [GO:0035309 "wing and notum subfield
            formation" evidence=IMP] [GO:0016301 "kinase activity"
            evidence=IDA] [GO:0007423 "sensory organ development" evidence=IMP]
            [GO:0005813 "centrosome" evidence=IDA] [GO:0072686 "mitotic
            spindle" evidence=IDA] [GO:0035324 "female germline ring canal"
            evidence=IDA] [GO:0042752 "regulation of circadian rhythm"
            evidence=IMP] [GO:0008355 "olfactory learning" evidence=IMP]
            [GO:0046959 "habituation" evidence=IMP] [GO:0045842 "positive
            regulation of mitotic metaphase/anaphase transition" evidence=IMP]
            [GO:0007051 "spindle organization" evidence=IMP] [GO:0005654
            "nucleoplasm" evidence=IDA] [GO:0043508 "negative regulation of JUN
            kinase activity" evidence=IMP] [GO:0045886 "negative regulation of
            synaptic growth at neuromuscular junction" evidence=IMP]
            [GO:0072347 "response to anesthetic" evidence=IMP] [GO:0045169
            "fusome" evidence=IDA] [GO:0090163 "establishment of epithelial
            cell planar polarity" evidence=IGI;IMP] [GO:0003382 "epithelial
            cell morphogenesis" evidence=IGI;IMP] [GO:0035293 "chitin-based
            larval cuticle pattern formation" evidence=IMP] [GO:0007143 "female
            meiosis" evidence=IMP] InterPro:IPR000719 InterPro:IPR002290
            InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR017441
            Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108 PROSITE:PS50011
            SMART:SM00220 GO:GO:0005524 GO:GO:0005938 GO:GO:0005634
            GO:GO:0005813 GO:GO:0008355 GO:GO:0007507 GO:GO:0016055
            eggNOG:COG0515 GO:GO:0009649 GO:GO:0030054 GO:GO:0030424
            GO:GO:0030707 EMBL:AE014298 SUPFAM:SSF56112 GO:GO:0004674
            GO:GO:0030162 GO:GO:0031594 GO:GO:0051124 GO:GO:0007219
            GO:GO:0003382 GO:GO:0045886 GO:GO:0045475 GO:GO:0007143
            GO:GO:0035019 GO:GO:0007367 GO:GO:0043508 GO:GO:0042306
            GO:GO:0030178 GO:GO:0035293 GO:GO:0030589 GO:GO:0072686
            GO:GO:0008407 GO:GO:0070507 GO:GO:0045169 GO:GO:0072347
            EMBL:AL121804 EMBL:AL024485 GO:GO:0045879 GO:GO:0045610
            GO:GO:0035309 GO:GO:0090163 GO:GO:0046959 BRENDA:2.7.11.26
            KO:K03083 OrthoDB:EOG4H70SQ EMBL:X70862 EMBL:X70863 EMBL:X70864
            EMBL:X70865 EMBL:X70866 EMBL:X53332 EMBL:AL034544 EMBL:AY122193
            EMBL:AY119664 EMBL:X54005 EMBL:X54006 PIR:S35325 PIR:S35327
            PIR:S35328 RefSeq:NP_476714.1 RefSeq:NP_476715.1 RefSeq:NP_476716.2
            RefSeq:NP_599105.1 RefSeq:NP_726822.1 RefSeq:NP_726823.1
            RefSeq:NP_996335.1 RefSeq:NP_996336.1 RefSeq:NP_996337.1
            RefSeq:NP_996338.1 UniGene:Dm.7795 ProteinModelPortal:P18431
            SMR:P18431 IntAct:P18431 MINT:MINT-277898 STRING:P18431
            PaxDb:P18431 GeneID:31248 KEGG:dme:Dmel_CG2621 CTD:31248
            FlyBase:FBgn0003371 InParanoid:P18431 OMA:KTCSRDG GenomeRNAi:31248
            NextBio:772634 Bgee:P18431 GermOnline:CG2621 GO:GO:0035324
            Uniprot:P18431
        Length = 514

 Score = 138 (53.6 bits), Expect = 1.7e-08, P = 1.7e-08
 Identities = 32/62 (51%), Positives = 37/62 (59%)

Query:    10 LLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXX-XXXXXEQELAIQPNLNAALL 68
             LLEYTPS+RI+PL+ACAH FFDELR                    E EL+IQP+L   LL
Sbjct:   318 LLEYTPSARITPLKACAHPFFDELRMEGNHTLPNGRDMPPLFNFTEHELSIQPSLVPQLL 377

Query:    69 PK 70
             PK
Sbjct:   378 PK 379


>ZFIN|ZDB-GENE-990714-3 [details] [associations]
            symbol:gsk3ab "glycogen synthase kinase 3 alpha b"
            species:7955 "Danio rerio" [GO:0004672 "protein kinase activity"
            evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0006468
            "protein phosphorylation" evidence=IEA] [GO:0016772 "transferase
            activity, transferring phosphorus-containing groups" evidence=IEA]
            [GO:0004674 "protein serine/threonine kinase activity"
            evidence=IEA] [GO:0055013 "cardiac muscle cell development"
            evidence=IMP] [GO:0001947 "heart looping" evidence=IMP] [GO:0009953
            "dorsal/ventral pattern formation" evidence=IGI] [GO:0000166
            "nucleotide binding" evidence=IEA] [GO:0016301 "kinase activity"
            evidence=IEA] [GO:0016310 "phosphorylation" evidence=IEA]
            InterPro:IPR000719 InterPro:IPR002290 InterPro:IPR008271
            InterPro:IPR011009 InterPro:IPR017441 Pfam:PF00069 PROSITE:PS00107
            PROSITE:PS00108 PROSITE:PS50011 SMART:SM00220
            ZFIN:ZDB-GENE-990714-3 GO:GO:0005524 SUPFAM:SSF56112 GO:GO:0004674
            GO:GO:0001947 GO:GO:0009953 GO:GO:0055013 HOVERGEN:HBG014652
            HSSP:P49841 HOGENOM:HOG000233017 KO:K08822 OrthoDB:EOG4WH8KZ
            GeneTree:ENSGT00520000055635 OMA:FGNLKLP EMBL:CR848744
            EMBL:BC056332 EMBL:BC065952 EMBL:AJ223501 IPI:IPI00507619
            RefSeq:NP_571465.1 UniGene:Dr.75529 SMR:Q9YH61
            Ensembl:ENSDART00000024935 Ensembl:ENSDART00000111481 GeneID:30664
            KEGG:dre:30664 CTD:30664 InParanoid:Q9YH61 NextBio:20807019
            Uniprot:Q9YH61
        Length = 440

 Score = 136 (52.9 bits), Expect = 2.2e-08, P = 2.2e-08
 Identities = 29/60 (48%), Positives = 35/60 (58%)

Query:    10 LLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXXXEQELAIQPNLNAALLP 69
             LLEYTP +R+SPL+ACAH FFDELR                     EL+IQP LN+ L+P
Sbjct:   347 LLEYTPVTRLSPLEACAHAFFDELRQPNARLPNGRELPQLFNFSPVELSIQPQLNSILIP 406


>UNIPROTKB|F1MIC3 [details] [associations]
            symbol:F1MIC3 "Uncharacterized protein" species:9913 "Bos
            taurus" [GO:0016772 "transferase activity, transferring
            phosphorus-containing groups" evidence=IEA] InterPro:IPR011009
            GO:GO:0005886 GO:GO:0005634 GO:GO:0005813 GO:GO:0021766
            GO:GO:0043066 GO:GO:0046827 GO:GO:0031334 GO:GO:0035556
            GO:GO:0031333 SUPFAM:SSF56112 GO:GO:0005977 GO:GO:0050321
            GO:GO:0018105 GO:GO:0032091 GO:GO:0051534 GO:GO:0032855
            GO:GO:0001837 GO:GO:0030877 GO:GO:0060070 GO:GO:0006983
            GO:GO:0001954 GO:GO:0032886 GO:GO:0071109
            GeneTree:ENSGT00520000055635 EMBL:DAAA02001549 IPI:IPI00823493
            Ensembl:ENSBTAT00000056446 OMA:TEYELGI Uniprot:F1MIC3
        Length = 150

 Score = 124 (48.7 bits), Expect = 5.3e-08, P = 5.3e-08
 Identities = 26/60 (43%), Positives = 33/60 (55%)

Query:    10 LLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXXXEQELAIQPNLNAALLP 69
             LLEYTP++R++PL+ACAH FFDELR                    QEL+  P L   L+P
Sbjct:    64 LLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIP 123


>UNIPROTKB|Q91757 [details] [associations]
            symbol:gsk3b "Glycogen synthase kinase-3 beta" species:8355
            "Xenopus laevis" [GO:0004674 "protein serine/threonine kinase
            activity" evidence=ISS] [GO:0045892 "negative regulation of
            transcription, DNA-dependent" evidence=IDA] [GO:0060070 "canonical
            Wnt receptor signaling pathway" evidence=IDA] InterPro:IPR000719
            InterPro:IPR002290 InterPro:IPR008271 InterPro:IPR011009
            InterPro:IPR017441 Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108
            PROSITE:PS50011 SMART:SM00220 GO:GO:0005886 GO:GO:0005524
            GO:GO:0005634 GO:GO:0005737 GO:GO:0045892 GO:GO:0007399
            GO:GO:0030154 SUPFAM:SSF56112 GO:GO:0004674 GO:GO:0050321
            GO:GO:0060070 HOVERGEN:HBG014652 HSSP:P49841 CTD:2932 KO:K03083
            EMBL:L38492 EMBL:U31862 EMBL:BC108581 PIR:I51425 PIR:I51692
            RefSeq:NP_001083752.1 UniGene:Xl.324 ProteinModelPortal:Q91757
            SMR:Q91757 GeneID:399097 KEGG:xla:399097 Xenbase:XB-GENE-865674
            Uniprot:Q91757
        Length = 420

 Score = 131 (51.2 bits), Expect = 7.0e-08, P = 7.0e-08
 Identities = 27/60 (45%), Positives = 35/60 (58%)

Query:    10 LLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXXXEQELAIQPNLNAALLP 69
             LLEYTP+SR++PL ACAH FFDELR                    QEL+  P+L++ L+P
Sbjct:   320 LLEYTPTSRLTPLDACAHSFFDELRDPNLKLPNGREFPALFNFTTQELSSNPSLSSILIP 379


>UNIPROTKB|F1NPL8 [details] [associations]
            symbol:GSK3B "Uncharacterized protein" species:9031 "Gallus
            gallus" [GO:0004674 "protein serine/threonine kinase activity"
            evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0000320
            "re-entry into mitotic cell cycle" evidence=IEA] [GO:0001085 "RNA
            polymerase II transcription factor binding" evidence=IEA]
            [GO:0001837 "epithelial to mesenchymal transition" evidence=IEA]
            [GO:0001954 "positive regulation of cell-matrix adhesion"
            evidence=IEA] [GO:0002039 "p53 binding" evidence=IEA] [GO:0005634
            "nucleus" evidence=IEA] [GO:0005813 "centrosome" evidence=IEA]
            [GO:0005829 "cytosol" evidence=IEA] [GO:0005886 "plasma membrane"
            evidence=IEA] [GO:0005977 "glycogen metabolic process"
            evidence=IEA] [GO:0006349 "regulation of gene expression by genetic
            imprinting" evidence=IEA] [GO:0006611 "protein export from nucleus"
            evidence=IEA] [GO:0006983 "ER overload response" evidence=IEA]
            [GO:0007409 "axonogenesis" evidence=IEA] [GO:0007520 "myoblast
            fusion" evidence=IEA] [GO:0008013 "beta-catenin binding"
            evidence=IEA] [GO:0009887 "organ morphogenesis" evidence=IEA]
            [GO:0010800 "positive regulation of peptidyl-threonine
            phosphorylation" evidence=IEA] [GO:0016477 "cell migration"
            evidence=IEA] [GO:0018105 "peptidyl-serine phosphorylation"
            evidence=IEA] [GO:0021766 "hippocampus development" evidence=IEA]
            [GO:0030426 "growth cone" evidence=IEA] [GO:0030529
            "ribonucleoprotein complex" evidence=IEA] [GO:0030877 "beta-catenin
            destruction complex" evidence=IEA] [GO:0031333 "negative regulation
            of protein complex assembly" evidence=IEA] [GO:0031334 "positive
            regulation of protein complex assembly" evidence=IEA] [GO:0031625
            "ubiquitin protein ligase binding" evidence=IEA] [GO:0032091
            "negative regulation of protein binding" evidence=IEA] [GO:0032092
            "positive regulation of protein binding" evidence=IEA] [GO:0032855
            "positive regulation of Rac GTPase activity" evidence=IEA]
            [GO:0032886 "regulation of microtubule-based process" evidence=IEA]
            [GO:0033138 "positive regulation of peptidyl-serine
            phosphorylation" evidence=IEA] [GO:0034236 "protein kinase A
            catalytic subunit binding" evidence=IEA] [GO:0035372 "protein
            localization to microtubule" evidence=IEA] [GO:0035556
            "intracellular signal transduction" evidence=IEA] [GO:0043025
            "neuronal cell body" evidence=IEA] [GO:0043066 "negative regulation
            of apoptotic process" evidence=IEA] [GO:0043198 "dendritic shaft"
            evidence=IEA] [GO:0044027 "hypermethylation of CpG island"
            evidence=IEA] [GO:0044337 "canonical Wnt receptor signaling pathway
            involved in positive regulation of apoptotic process" evidence=IEA]
            [GO:0045444 "fat cell differentiation" evidence=IEA] [GO:0045944
            "positive regulation of transcription from RNA polymerase II
            promoter" evidence=IEA] [GO:0046827 "positive regulation of protein
            export from nucleus" evidence=IEA] [GO:0048471 "perinuclear region
            of cytoplasm" evidence=IEA] [GO:0050321 "tau-protein kinase
            activity" evidence=IEA] [GO:0051059 "NF-kappaB binding"
            evidence=IEA] [GO:0051534 "negative regulation of NFAT protein
            import into nucleus" evidence=IEA] [GO:0071109 "superior temporal
            gyrus development" evidence=IEA] [GO:2000738 "positive regulation
            of stem cell differentiation" evidence=IEA] [GO:0005515 "protein
            binding" evidence=IPI] InterPro:IPR000719 InterPro:IPR002290
            InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR017441
            Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108 PROSITE:PS50011
            SMART:SM00220 GO:GO:0005829 GO:GO:0005886 GO:GO:0005524
            GO:GO:0005634 GO:GO:0005813 GO:GO:0043066 GO:GO:0046827
            GO:GO:0031334 GO:GO:0016477 GO:GO:0035556 GO:GO:0032092
            GO:GO:0031333 GO:GO:0043198 GO:GO:0043025 SUPFAM:SSF56112
            GO:GO:0004674 GO:GO:0045944 GO:GO:0005977 GO:GO:0010800
            GO:GO:0050321 GO:GO:0018105 GO:GO:0030426 GO:GO:0030529
            GO:GO:0032091 GO:GO:0051534 GO:GO:0033138 GO:GO:0045444
            GO:GO:0032855 GO:GO:0006349 GO:GO:0030877 GO:GO:0006611
            GO:GO:0006983 GO:GO:0001954 GO:GO:0000320 GO:GO:0032886
            GO:GO:0035372 GO:GO:0044027 GeneTree:ENSGT00520000055635
            OMA:PSLFNFT GO:GO:0044337 EMBL:AADN02037941 IPI:IPI00591968
            IntAct:F1NPL8 Ensembl:ENSGALT00000030475 Uniprot:F1NPL8
        Length = 390

 Score = 127 (49.8 bits), Expect = 1.7e-07, P = 1.7e-07
 Identities = 26/60 (43%), Positives = 35/60 (58%)

Query:    10 LLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXXXEQELAIQPNLNAALLP 69
             LLEYTP++R++PL+ACAH FFDELR                    QEL+  P+L + L+P
Sbjct:   290 LLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGREKPALFNFTTQELSSNPSLASILIP 349


>ZFIN|ZDB-GENE-990714-4 [details] [associations]
            symbol:gsk3b "glycogen synthase kinase 3 beta"
            species:7955 "Danio rerio" [GO:0004672 "protein kinase activity"
            evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0006468
            "protein phosphorylation" evidence=IEA] [GO:0016772 "transferase
            activity, transferring phosphorus-containing groups" evidence=IEA]
            [GO:0004674 "protein serine/threonine kinase activity"
            evidence=IEA] [GO:0001947 "heart looping" evidence=IMP] [GO:0003146
            "heart jogging" evidence=IMP] [GO:0016310 "phosphorylation"
            evidence=IEA] [GO:0000166 "nucleotide binding" evidence=IEA]
            [GO:0016301 "kinase activity" evidence=IEA] InterPro:IPR000719
            InterPro:IPR002290 InterPro:IPR008271 InterPro:IPR011009
            InterPro:IPR017441 Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108
            PROSITE:PS50011 SMART:SM00220 ZFIN:ZDB-GENE-990714-4 GO:GO:0005524
            SUPFAM:SSF56112 GO:GO:0004674 GO:GO:0001947 GO:GO:0003146
            HOVERGEN:HBG014652 HSSP:P49841 GeneTree:ENSGT00520000055635
            CTD:2932 KO:K03083 OMA:PSLFNFT EMBL:CR759880 EMBL:BC162371
            EMBL:AJ223502 IPI:IPI00508241 RefSeq:NP_571456.1 UniGene:Dr.107139
            SMR:Q9YH60 STRING:Q9YH60 Ensembl:ENSDART00000018228 GeneID:30654
            KEGG:dre:30654 InParanoid:Q9YH60 NextBio:20807010 Uniprot:Q9YH60
        Length = 421

 Score = 126 (49.4 bits), Expect = 2.5e-07, P = 2.5e-07
 Identities = 26/60 (43%), Positives = 34/60 (56%)

Query:    10 LLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXXXEQELAIQPNLNAALLP 69
             LLEYTP++R++PL+ACAH FFDELR                    QEL+  P L + L+P
Sbjct:   320 LLEYTPTARLTPLEACAHSFFDELREPNVKLPNGREKPSLFNFTTQELSSNPTLASILIP 379


>UNIPROTKB|K7GSV4 [details] [associations]
            symbol:GSK3B "Uncharacterized protein" species:9823 "Sus
            scrofa" [GO:0005524 "ATP binding" evidence=IEA] [GO:0004674
            "protein serine/threonine kinase activity" evidence=IEA]
            InterPro:IPR000719 InterPro:IPR008271 InterPro:IPR011009
            Pfam:PF00069 PROSITE:PS00108 PROSITE:PS50011 SUPFAM:SSF56112
            GeneTree:ENSGT00520000055635 EMBL:CU464166 EMBL:CU464151
            EMBL:CU633672 Ensembl:ENSSSCT00000036443 Uniprot:K7GSV4
        Length = 326

 Score = 124 (48.7 bits), Expect = 2.5e-07, P = 2.5e-07
 Identities = 26/60 (43%), Positives = 33/60 (55%)

Query:    10 LLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXXXEQELAIQPNLNAALLP 69
             LLEYTP++R++PL+ACAH FFDELR                    QEL+  P L   L+P
Sbjct:   226 LLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIP 285


>UNIPROTKB|K7GSS4 [details] [associations]
            symbol:GSK3B "Uncharacterized protein" species:9823 "Sus
            scrofa" [GO:0005524 "ATP binding" evidence=IEA] [GO:0004674
            "protein serine/threonine kinase activity" evidence=IEA]
            InterPro:IPR000719 InterPro:IPR008271 InterPro:IPR011009
            Pfam:PF00069 PROSITE:PS00108 PROSITE:PS50011 SUPFAM:SSF56112
            GeneTree:ENSGT00520000055635 EMBL:CU464166 EMBL:CU464151
            EMBL:CU633672 Ensembl:ENSSSCT00000035981 Uniprot:K7GSS4
        Length = 339

 Score = 124 (48.7 bits), Expect = 2.7e-07, P = 2.7e-07
 Identities = 26/60 (43%), Positives = 33/60 (55%)

Query:    10 LLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXXXEQELAIQPNLNAALLP 69
             LLEYTP++R++PL+ACAH FFDELR                    QEL+  P L   L+P
Sbjct:   239 LLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIP 298


>ZFIN|ZDB-GENE-090312-2 [details] [associations]
            symbol:si:dkeyp-80c12.7 "si:dkeyp-80c12.7"
            species:7955 "Danio rerio" [GO:0016772 "transferase activity,
            transferring phosphorus-containing groups" evidence=IEA]
            [GO:0004674 "protein serine/threonine kinase activity"
            evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0006468
            "protein phosphorylation" evidence=IEA] [GO:0004672 "protein kinase
            activity" evidence=IEA] InterPro:IPR000719 InterPro:IPR002290
            InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR017441
            Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108 PROSITE:PS50011
            SMART:SM00220 ZFIN:ZDB-GENE-090312-2 GO:GO:0005524 eggNOG:COG0515
            SUPFAM:SSF56112 GO:GO:0004674 HOVERGEN:HBG014652
            HOGENOM:HOG000233017 OrthoDB:EOG4WH8KZ GeneTree:ENSGT00520000055635
            OMA:LAYIHTA EMBL:CR812943 IPI:IPI00923756 RefSeq:NP_001139160.1
            UniGene:Dr.113689 ProteinModelPortal:B8JIQ1
            Ensembl:ENSDART00000074317 GeneID:557882 NextBio:20882207
            Bgee:B8JIQ1 Uniprot:B8JIQ1
        Length = 419

 Score = 125 (49.1 bits), Expect = 3.1e-07, P = 3.1e-07
 Identities = 26/60 (43%), Positives = 35/60 (58%)

Query:    10 LLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXXXEQELAIQPNLNAALLP 69
             LLEYTP++R++PL+ACAH FFDELR                    QEL+  P+L + L+P
Sbjct:   320 LLEYTPTARLTPLEACAHTFFDELREPNLKLPNGRERPVLFNFTTQELSNNPSLASVLIP 379


>UNIPROTKB|F1SPD2 [details] [associations]
            symbol:GSK3B "Uncharacterized protein" species:9823 "Sus
            scrofa" [GO:2000738 "positive regulation of stem cell
            differentiation" evidence=IEA] [GO:0071109 "superior temporal gyrus
            development" evidence=IEA] [GO:0051534 "negative regulation of NFAT
            protein import into nucleus" evidence=IEA] [GO:0051059 "NF-kappaB
            binding" evidence=IEA] [GO:0050321 "tau-protein kinase activity"
            evidence=IEA] [GO:0048471 "perinuclear region of cytoplasm"
            evidence=IEA] [GO:0046827 "positive regulation of protein export
            from nucleus" evidence=IEA] [GO:0045944 "positive regulation of
            transcription from RNA polymerase II promoter" evidence=IEA]
            [GO:0045444 "fat cell differentiation" evidence=IEA] [GO:0044337
            "canonical Wnt receptor signaling pathway involved in positive
            regulation of apoptotic process" evidence=IEA] [GO:0044027
            "hypermethylation of CpG island" evidence=IEA] [GO:0043198
            "dendritic shaft" evidence=IEA] [GO:0043066 "negative regulation of
            apoptotic process" evidence=IEA] [GO:0043025 "neuronal cell body"
            evidence=IEA] [GO:0035556 "intracellular signal transduction"
            evidence=IEA] [GO:0035372 "protein localization to microtubule"
            evidence=IEA] [GO:0034236 "protein kinase A catalytic subunit
            binding" evidence=IEA] [GO:0033138 "positive regulation of
            peptidyl-serine phosphorylation" evidence=IEA] [GO:0032886
            "regulation of microtubule-based process" evidence=IEA] [GO:0032855
            "positive regulation of Rac GTPase activity" evidence=IEA]
            [GO:0032092 "positive regulation of protein binding" evidence=IEA]
            [GO:0032091 "negative regulation of protein binding" evidence=IEA]
            [GO:0031625 "ubiquitin protein ligase binding" evidence=IEA]
            [GO:0031334 "positive regulation of protein complex assembly"
            evidence=IEA] [GO:0031333 "negative regulation of protein complex
            assembly" evidence=IEA] [GO:0030877 "beta-catenin destruction
            complex" evidence=IEA] [GO:0030529 "ribonucleoprotein complex"
            evidence=IEA] [GO:0030426 "growth cone" evidence=IEA] [GO:0021766
            "hippocampus development" evidence=IEA] [GO:0018105
            "peptidyl-serine phosphorylation" evidence=IEA] [GO:0016477 "cell
            migration" evidence=IEA] [GO:0010800 "positive regulation of
            peptidyl-threonine phosphorylation" evidence=IEA] [GO:0009887
            "organ morphogenesis" evidence=IEA] [GO:0008013 "beta-catenin
            binding" evidence=IEA] [GO:0007520 "myoblast fusion" evidence=IEA]
            [GO:0007409 "axonogenesis" evidence=IEA] [GO:0006983 "ER overload
            response" evidence=IEA] [GO:0006611 "protein export from nucleus"
            evidence=IEA] [GO:0006349 "regulation of gene expression by genetic
            imprinting" evidence=IEA] [GO:0005977 "glycogen metabolic process"
            evidence=IEA] [GO:0005886 "plasma membrane" evidence=IEA]
            [GO:0005829 "cytosol" evidence=IEA] [GO:0005813 "centrosome"
            evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0002039 "p53
            binding" evidence=IEA] [GO:0001954 "positive regulation of
            cell-matrix adhesion" evidence=IEA] [GO:0001837 "epithelial to
            mesenchymal transition" evidence=IEA] [GO:0001085 "RNA polymerase
            II transcription factor binding" evidence=IEA] [GO:0000320
            "re-entry into mitotic cell cycle" evidence=IEA] [GO:0005524 "ATP
            binding" evidence=IEA] [GO:0004674 "protein serine/threonine kinase
            activity" evidence=IEA] InterPro:IPR000719 InterPro:IPR002290
            InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR017441
            Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108 PROSITE:PS50011
            SMART:SM00220 GO:GO:0005829 GO:GO:0005886 GO:GO:0005524
            GO:GO:0005634 GO:GO:0005813 GO:GO:0021766 GO:GO:0043066
            GO:GO:0046827 GO:GO:0031334 GO:GO:0016477 GO:GO:0035556
            GO:GO:0032092 GO:GO:0031333 GO:GO:0043198 GO:GO:0043025
            SUPFAM:SSF56112 GO:GO:0004674 GO:GO:0045944 GO:GO:0005977
            GO:GO:0010800 GO:GO:0050321 GO:GO:0018105 GO:GO:0030426
            GO:GO:0009887 GO:GO:0030529 GO:GO:0007409 GO:GO:0007520
            GO:GO:0032091 GO:GO:0051534 GO:GO:0033138 GO:GO:0045444
            GO:GO:0032855 GO:GO:0001837 GO:GO:0006349 GO:GO:0030877
            GO:GO:0006611 GO:GO:0006983 GO:GO:0001954 GO:GO:0000320
            GO:GO:0032886 GO:GO:0035372 GO:GO:0071109 GO:GO:0044027
            GeneTree:ENSGT00520000055635 OMA:PSLFNFT GO:GO:0044337
            EMBL:CU464166 EMBL:CU464151 EMBL:CU633672
            Ensembl:ENSSSCT00000013006 Uniprot:F1SPD2
        Length = 395

 Score = 124 (48.7 bits), Expect = 3.6e-07, P = 3.6e-07
 Identities = 26/60 (43%), Positives = 33/60 (55%)

Query:    10 LLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXXXEQELAIQPNLNAALLP 69
             LLEYTP++R++PL+ACAH FFDELR                    QEL+  P L   L+P
Sbjct:   295 LLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIP 354


>UNIPROTKB|E2R4Y4 [details] [associations]
            symbol:GSK3B "Uncharacterized protein" species:9615 "Canis
            lupus familiaris" [GO:0005524 "ATP binding" evidence=IEA]
            [GO:0004674 "protein serine/threonine kinase activity"
            evidence=IEA] InterPro:IPR000719 InterPro:IPR002290
            InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR017441
            Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108 PROSITE:PS50011
            SMART:SM00220 GO:GO:0005524 SUPFAM:SSF56112 GO:GO:0004674
            GeneTree:ENSGT00520000055635 CTD:2932 KO:K03083 EMBL:AAEX03017018
            RefSeq:XP_856611.1 ProteinModelPortal:E2R4Y4
            Ensembl:ENSCAFT00000017704 GeneID:478575 KEGG:cfa:478575
            NextBio:20853894 Uniprot:E2R4Y4
        Length = 420

 Score = 124 (48.7 bits), Expect = 4.0e-07, P = 4.0e-07
 Identities = 26/60 (43%), Positives = 33/60 (55%)

Query:    10 LLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXXXEQELAIQPNLNAALLP 69
             LLEYTP++R++PL+ACAH FFDELR                    QEL+  P L   L+P
Sbjct:   320 LLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIP 379


>UNIPROTKB|P49841 [details] [associations]
            symbol:GSK3B "Glycogen synthase kinase-3 beta" species:9606
            "Homo sapiens" [GO:0010226 "response to lithium ion" evidence=IEA]
            [GO:0010800 "positive regulation of peptidyl-threonine
            phosphorylation" evidence=IEA] [GO:0016477 "cell migration"
            evidence=IEA] [GO:0030010 "establishment of cell polarity"
            evidence=IEA] [GO:0030426 "growth cone" evidence=IEA] [GO:0030529
            "ribonucleoprotein complex" evidence=IEA] [GO:0033138 "positive
            regulation of peptidyl-serine phosphorylation" evidence=IEA]
            [GO:0035255 "ionotropic glutamate receptor binding" evidence=IEA]
            [GO:0035372 "protein localization to microtubule" evidence=IEA]
            [GO:0042493 "response to drug" evidence=IEA] [GO:0043025 "neuronal
            cell body" evidence=IEA] [GO:0043197 "dendritic spine"
            evidence=IEA] [GO:0043198 "dendritic shaft" evidence=IEA]
            [GO:0043407 "negative regulation of MAP kinase activity"
            evidence=IEA] [GO:0044027 "hypermethylation of CpG island"
            evidence=IEA] [GO:0044337 "canonical Wnt receptor signaling pathway
            involved in positive regulation of apoptotic process" evidence=IEA]
            [GO:0045121 "membrane raft" evidence=IEA] [GO:0045444 "fat cell
            differentiation" evidence=IEA] [GO:0045892 "negative regulation of
            transcription, DNA-dependent" evidence=IEA] [GO:0045944 "positive
            regulation of transcription from RNA polymerase II promoter"
            evidence=IEA] [GO:0048156 "tau protein binding" evidence=IEA]
            [GO:0048168 "regulation of neuronal synaptic plasticity"
            evidence=IEA] [GO:0048471 "perinuclear region of cytoplasm"
            evidence=IEA] [GO:0050774 "negative regulation of dendrite
            morphogenesis" evidence=IEA] [GO:2000738 "positive regulation of
            stem cell differentiation" evidence=IEA] [GO:0000320 "re-entry into
            mitotic cell cycle" evidence=IEA] [GO:0005178 "integrin binding"
            evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0006349
            "regulation of gene expression by genetic imprinting" evidence=IEA]
            [GO:0006611 "protein export from nucleus" evidence=IEA] [GO:0007520
            "myoblast fusion" evidence=IEA] [GO:0009887 "organ morphogenesis"
            evidence=IEA] [GO:0051059 "NF-kappaB binding" evidence=IPI]
            [GO:0030877 "beta-catenin destruction complex" evidence=IDA;TAS]
            [GO:0060070 "canonical Wnt receptor signaling pathway"
            evidence=IC;IDA] [GO:0001085 "RNA polymerase II transcription
            factor binding" evidence=IPI] [GO:0005515 "protein binding"
            evidence=IPI] [GO:0016301 "kinase activity" evidence=IDA;TAS]
            [GO:0005634 "nucleus" evidence=IDA] [GO:0005737 "cytoplasm"
            evidence=IDA] [GO:0001837 "epithelial to mesenchymal transition"
            evidence=IMP] [GO:0045719 "negative regulation of glycogen
            biosynthetic process" evidence=TAS] [GO:0090090 "negative
            regulation of canonical Wnt receptor signaling pathway"
            evidence=TAS] [GO:2000077 "negative regulation of type B pancreatic
            cell development" evidence=TAS] [GO:2000466 "negative regulation of
            glycogen (starch) synthase activity" evidence=TAS] [GO:0051534
            "negative regulation of NFAT protein import into nucleus"
            evidence=IMP] [GO:0004674 "protein serine/threonine kinase
            activity" evidence=ISS;IDA] [GO:0050321 "tau-protein kinase
            activity" evidence=IDA] [GO:0005813 "centrosome" evidence=IDA]
            [GO:0032886 "regulation of microtubule-based process" evidence=IMP]
            [GO:0019901 "protein kinase binding" evidence=IPI] [GO:0005886
            "plasma membrane" evidence=IDA] [GO:0006468 "protein
            phosphorylation" evidence=IDA] [GO:0032092 "positive regulation of
            protein binding" evidence=ISS] [GO:0007623 "circadian rhythm"
            evidence=ISS] [GO:0002039 "p53 binding" evidence=IDA] [GO:0006983
            "ER overload response" evidence=IDA] [GO:0018105 "peptidyl-serine
            phosphorylation" evidence=IDA] [GO:0035556 "intracellular signal
            transduction" evidence=IDA] [GO:0043066 "negative regulation of
            apoptotic process" evidence=IDA] [GO:0046827 "positive regulation
            of protein export from nucleus" evidence=IDA] [GO:0005829 "cytosol"
            evidence=TAS] [GO:0007173 "epidermal growth factor receptor
            signaling pathway" evidence=TAS] [GO:0007411 "axon guidance"
            evidence=TAS] [GO:0008543 "fibroblast growth factor receptor
            signaling pathway" evidence=TAS] [GO:0048011 "neurotrophin TRK
            receptor signaling pathway" evidence=TAS] [GO:0048015
            "phosphatidylinositol-mediated signaling" evidence=TAS] [GO:0034236
            "protein kinase A catalytic subunit binding" evidence=IPI]
            [GO:0031334 "positive regulation of protein complex assembly"
            evidence=IDA] [GO:0005977 "glycogen metabolic process"
            evidence=IDA] [GO:0008013 "beta-catenin binding" evidence=IPI]
            [GO:0031625 "ubiquitin protein ligase binding" evidence=IPI]
            [GO:0032091 "negative regulation of protein binding" evidence=IDA]
            [GO:0045732 "positive regulation of protein catabolic process"
            evidence=IC] [GO:0031333 "negative regulation of protein complex
            assembly" evidence=IMP] [GO:0001954 "positive regulation of
            cell-matrix adhesion" evidence=IMP] [GO:0032855 "positive
            regulation of Rac GTPase activity" evidence=IMP] [GO:0021766
            "hippocampus development" evidence=IMP] [GO:0071109 "superior
            temporal gyrus development" evidence=IMP] [GO:0005730 "nucleolus"
            evidence=IDA] InterPro:IPR000719 InterPro:IPR002290
            InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR017441
            Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108 PROSITE:PS50011
            SMART:SM00220 GO:GO:0005829 GO:GO:0005886 GO:GO:0005524
            GO:GO:0005634 GO:GO:0005813 Pathway_Interaction_DB:pi3kciaktpathway
            Pathway_Interaction_DB:insulin_glucose_pathway
            Pathway_Interaction_DB:nfat_3pathway
            Pathway_Interaction_DB:pi3kplctrkpathway Reactome:REACT_111045
            Reactome:REACT_111102 Reactome:REACT_116125 Reactome:REACT_6900
            GO:GO:0007411 GO:GO:0007173 GO:GO:0008543 GO:GO:0045892
            GO:GO:0048011 GO:GO:0021766 GO:GO:0050774 GO:GO:0043066
            GO:GO:0046827 GO:GO:0031334 Pathway_Interaction_DB:aurora_a_pathway
            Pathway_Interaction_DB:wnt_canonical_pathway
            Pathway_Interaction_DB:ps1pathway GO:GO:0016477 GO:GO:0042493
            GO:GO:0010226 GO:GO:0032092 GO:GO:0031333 eggNOG:COG0515
            GO:GO:0043198 GO:GO:0043025 EMBL:CH471052 SUPFAM:SSF56112
            GO:GO:0004674 GO:GO:0045944 GO:GO:0043197 GO:GO:0005977
            GO:GO:0010800 GO:GO:0050321 GO:GO:0018105 GO:GO:0045121
            GO:GO:0030426 GO:GO:0009887 GO:GO:0030529 GO:GO:0007520
            Pathway_Interaction_DB:lysophospholipid_pathway GO:GO:0043407
            GO:GO:0032091 GO:GO:0090090 GO:GO:0048015 GO:GO:0051534 PDB:3CQU
            PDB:3CQW PDB:4EKK PDBsum:3CQU PDBsum:3CQW PDBsum:4EKK
            Pathway_Interaction_DB:hedgehog_glipathway
            Pathway_Interaction_DB:reelinpathway
            Pathway_Interaction_DB:kitpathway GO:GO:0033138 PDB:2JDO PDB:2JDR
            PDB:2UW9 PDB:2X39 PDB:2XH5 PDB:3E87 PDB:3E88 PDB:3E8D PDBsum:2JDO
            PDBsum:2JDR PDBsum:2UW9 PDBsum:2X39 PDBsum:2XH5 PDBsum:3E87
            PDBsum:3E88 PDBsum:3E8D GO:GO:0045444 GO:GO:0032855 GO:GO:0045732
            GO:GO:0001837 Pathway_Interaction_DB:ar_tf_pathway GO:GO:0006349
            GO:GO:0030877 GO:GO:0060070 GO:GO:0048168 GO:GO:0006611
            GO:GO:0030010 PDB:1O9U PDB:3ZDI PDBsum:1O9U PDBsum:3ZDI
            GO:GO:0002039 Pathway_Interaction_DB:bmppathway GO:GO:0006983
            GO:GO:0001954 GO:GO:0000320 HOVERGEN:HBG014652 GO:GO:0032886
            GO:GO:0035372 GO:GO:0071109 DrugBank:DB01356 GO:GO:0044027
            GO:GO:0045719 PDB:1GNG PDB:3ZRK PDB:3ZRL PDB:3ZRM PDB:4AFJ
            PDBsum:1GNG PDBsum:3ZRK PDBsum:3ZRL PDBsum:3ZRM PDBsum:4AFJ
            HOGENOM:HOG000233017 OrthoDB:EOG4WH8KZ GO:GO:2000466 GO:GO:2000077
            BRENDA:2.7.11.26 EMBL:L33801 EMBL:BC000251 EMBL:BC012760
            EMBL:AF074333 EMBL:AF098789 IPI:IPI00028570 IPI:IPI00216190
            PIR:S53324 RefSeq:NP_001139628.1 RefSeq:NP_002084.2
            UniGene:Hs.445733 PDB:1H8F PDB:1I09 PDB:1J1B PDB:1J1C PDB:1PYX
            PDB:1Q3D PDB:1Q3W PDB:1Q41 PDB:1Q4L PDB:1Q5K PDB:1R0E PDB:1UV5
            PDB:2JLD PDB:2O5K PDB:2OW3 PDB:3DU8 PDB:3F7Z PDB:3F88 PDB:3GB2
            PDB:3I4B PDB:3L1S PDB:3M1S PDB:3PUP PDB:3Q3B PDB:3SAY PDB:3SD0
            PDB:4ACC PDB:4ACD PDB:4ACG PDB:4ACH PDB:4DIT PDBsum:1H8F
            PDBsum:1I09 PDBsum:1J1B PDBsum:1J1C PDBsum:1PYX PDBsum:1Q3D
            PDBsum:1Q3W PDBsum:1Q41 PDBsum:1Q4L PDBsum:1Q5K PDBsum:1R0E
            PDBsum:1UV5 PDBsum:2JLD PDBsum:2O5K PDBsum:2OW3 PDBsum:3DU8
            PDBsum:3F7Z PDBsum:3F88 PDBsum:3GB2 PDBsum:3I4B PDBsum:3L1S
            PDBsum:3M1S PDBsum:3PUP PDBsum:3Q3B PDBsum:3SAY PDBsum:3SD0
            PDBsum:4ACC PDBsum:4ACD PDBsum:4ACG PDBsum:4ACH PDBsum:4DIT
            DisProt:DP00385 ProteinModelPortal:P49841 SMR:P49841 DIP:DIP-878N
            IntAct:P49841 MINT:MINT-105006 STRING:P49841 PhosphoSite:P49841
            DMDM:20455502 PaxDb:P49841 PRIDE:P49841 DNASU:2932
            Ensembl:ENST00000264235 Ensembl:ENST00000316626 GeneID:2932
            KEGG:hsa:2932 UCSC:uc003edn.3 UCSC:uc003edo.3 CTD:2932
            GeneCards:GC03M119540 HGNC:HGNC:4617 HPA:CAB016263 HPA:HPA028017
            MIM:605004 neXtProt:NX_P49841 PharmGKB:PA29009 KO:K03083
            OMA:PSLFNFT BindingDB:P49841 ChEMBL:CHEMBL262 ChiTaRS:GSK3B
            EvolutionaryTrace:P49841 GenomeRNAi:2932 NextBio:11619
            ArrayExpress:P49841 Bgee:P49841 CleanEx:HS_GSK3B
            Genevestigator:P49841 GermOnline:ENSG00000082701 GO:GO:0044337
            Uniprot:P49841
        Length = 420

 Score = 124 (48.7 bits), Expect = 4.0e-07, P = 4.0e-07
 Identities = 26/60 (43%), Positives = 33/60 (55%)

Query:    10 LLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXXXEQELAIQPNLNAALLP 69
             LLEYTP++R++PL+ACAH FFDELR                    QEL+  P L   L+P
Sbjct:   320 LLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIP 379


>UNIPROTKB|Q5YJC2 [details] [associations]
            symbol:GSK3B "Glycogen synthase kinase-3 beta" species:9997
            "Spermophilus citellus" [GO:0001837 "epithelial to mesenchymal
            transition" evidence=ISS] [GO:0004674 "protein serine/threonine
            kinase activity" evidence=ISS] [GO:0005634 "nucleus" evidence=ISS]
            [GO:0005737 "cytoplasm" evidence=ISS] [GO:0005886 "plasma membrane"
            evidence=ISS] [GO:0006468 "protein phosphorylation" evidence=ISS]
            [GO:0016020 "membrane" evidence=ISS] [GO:0016301 "kinase activity"
            evidence=ISS] [GO:0032092 "positive regulation of protein binding"
            evidence=ISS] [GO:0032886 "regulation of microtubule-based process"
            evidence=ISS] [GO:0050321 "tau-protein kinase activity"
            evidence=ISS] [GO:0051534 "negative regulation of NFAT protein
            import into nucleus" evidence=ISS] InterPro:IPR000719
            InterPro:IPR002290 InterPro:IPR008271 InterPro:IPR011009
            InterPro:IPR017441 Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108
            PROSITE:PS50011 SMART:SM00220 GO:GO:0005886 GO:GO:0005524
            GO:GO:0005634 GO:GO:0005737 GO:GO:0007399 GO:GO:0016055
            GO:GO:0032092 SUPFAM:SSF56112 GO:GO:0004674 GO:GO:0005977
            GO:GO:0050321 GO:GO:0051534 GO:GO:0001837 GO:GO:0009968
            HOVERGEN:HBG014652 GO:GO:0032886 HSSP:P49841 EMBL:AY392021
            ProteinModelPortal:Q5YJC2 SMR:Q5YJC2 Uniprot:Q5YJC2
        Length = 420

 Score = 124 (48.7 bits), Expect = 4.0e-07, P = 4.0e-07
 Identities = 26/60 (43%), Positives = 33/60 (55%)

Query:    10 LLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXXXEQELAIQPNLNAALLP 69
             LLEYTP++R++PL+ACAH FFDELR                    QEL+  P L   L+P
Sbjct:   320 LLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIP 379


>MGI|MGI:1861437 [details] [associations]
            symbol:Gsk3b "glycogen synthase kinase 3 beta" species:10090
            "Mus musculus" [GO:0000166 "nucleotide binding" evidence=IEA]
            [GO:0000320 "re-entry into mitotic cell cycle" evidence=IDA]
            [GO:0001085 "RNA polymerase II transcription factor binding"
            evidence=ISO] [GO:0001837 "epithelial to mesenchymal transition"
            evidence=ISO] [GO:0001954 "positive regulation of cell-matrix
            adhesion" evidence=ISO] [GO:0002039 "p53 binding" evidence=ISO]
            [GO:0004672 "protein kinase activity" evidence=IDA] [GO:0004674
            "protein serine/threonine kinase activity" evidence=ISO;ISS;IDA]
            [GO:0005178 "integrin binding" evidence=ISO] [GO:0005515 "protein
            binding" evidence=IPI] [GO:0005524 "ATP binding" evidence=ISO]
            [GO:0005634 "nucleus" evidence=ISO;IDA] [GO:0005737 "cytoplasm"
            evidence=ISO] [GO:0005813 "centrosome" evidence=ISO] [GO:0005829
            "cytosol" evidence=ISO;IDA] [GO:0005886 "plasma membrane"
            evidence=ISO] [GO:0005975 "carbohydrate metabolic process"
            evidence=IEA] [GO:0005977 "glycogen metabolic process"
            evidence=ISO] [GO:0006349 "regulation of gene expression by genetic
            imprinting" evidence=IMP] [GO:0006468 "protein phosphorylation"
            evidence=ISO;IGI;ISS;IDA] [GO:0006611 "protein export from nucleus"
            evidence=IDA] [GO:0006917 "induction of apoptosis" evidence=ISO]
            [GO:0006950 "response to stress" evidence=IDA] [GO:0006983 "ER
            overload response" evidence=ISO;IDA] [GO:0007010 "cytoskeleton
            organization" evidence=TAS] [GO:0007163 "establishment or
            maintenance of cell polarity" evidence=ISO] [GO:0007275
            "multicellular organismal development" evidence=IEA] [GO:0007399
            "nervous system development" evidence=IEA] [GO:0007409
            "axonogenesis" evidence=IGI] [GO:0007520 "myoblast fusion"
            evidence=IGI;IDA] [GO:0008013 "beta-catenin binding"
            evidence=ISO;IPI] [GO:0008283 "cell proliferation" evidence=TAS]
            [GO:0009887 "organ morphogenesis" evidence=IMP] [GO:0009968
            "negative regulation of signal transduction" evidence=IEA]
            [GO:0010800 "positive regulation of peptidyl-threonine
            phosphorylation" evidence=IDA] [GO:0014902 "myotube
            differentiation" evidence=IGI] [GO:0016020 "membrane" evidence=ISO]
            [GO:0016055 "Wnt receptor signaling pathway" evidence=IGI]
            [GO:0016301 "kinase activity" evidence=ISO] [GO:0016310
            "phosphorylation" evidence=IMP] [GO:0016477 "cell migration"
            evidence=IGI] [GO:0016740 "transferase activity" evidence=IEA]
            [GO:0016772 "transferase activity, transferring
            phosphorus-containing groups" evidence=IEA] [GO:0018105
            "peptidyl-serine phosphorylation" evidence=ISO;IDA] [GO:0019901
            "protein kinase binding" evidence=ISO] [GO:0021766 "hippocampus
            development" evidence=ISO] [GO:0030010 "establishment of cell
            polarity" evidence=ISO] [GO:0030154 "cell differentiation"
            evidence=IEA] [GO:0030426 "growth cone" evidence=IDA] [GO:0030529
            "ribonucleoprotein complex" evidence=IDA] [GO:0030877 "beta-catenin
            destruction complex" evidence=ISO;IDA] [GO:0031333 "negative
            regulation of protein complex assembly" evidence=ISO] [GO:0031334
            "positive regulation of protein complex assembly" evidence=ISO]
            [GO:0031625 "ubiquitin protein ligase binding" evidence=ISO]
            [GO:0032091 "negative regulation of protein binding" evidence=ISO]
            [GO:0032092 "positive regulation of protein binding" evidence=IDA]
            [GO:0032855 "positive regulation of Rac GTPase activity"
            evidence=ISO] [GO:0032886 "regulation of microtubule-based process"
            evidence=ISO;IDA] [GO:0033138 "positive regulation of
            peptidyl-serine phosphorylation" evidence=IDA] [GO:0034236 "protein
            kinase A catalytic subunit binding" evidence=ISO] [GO:0035255
            "ionotropic glutamate receptor binding" evidence=ISO] [GO:0035372
            "protein localization to microtubule" evidence=IGI] [GO:0035556
            "intracellular signal transduction" evidence=ISO] [GO:0043025
            "neuronal cell body" evidence=IDA] [GO:0043066 "negative regulation
            of apoptotic process" evidence=ISO;IMP] [GO:0043197 "dendritic
            spine" evidence=ISO] [GO:0043198 "dendritic shaft" evidence=IDA]
            [GO:0043227 "membrane-bounded organelle" evidence=IDA] [GO:0043234
            "protein complex" evidence=ISO] [GO:0043407 "negative regulation of
            MAP kinase activity" evidence=ISO] [GO:0044027 "hypermethylation of
            CpG island" evidence=IMP] [GO:0044337 "canonical Wnt receptor
            signaling pathway involved in positive regulation of apoptotic
            process" evidence=IMP] [GO:0045121 "membrane raft" evidence=ISO]
            [GO:0045444 "fat cell differentiation" evidence=IDA] [GO:0045892
            "negative regulation of transcription, DNA-dependent" evidence=ISO]
            [GO:0045944 "positive regulation of transcription from RNA
            polymerase II promoter" evidence=IMP] [GO:0046827 "positive
            regulation of protein export from nucleus" evidence=ISO]
            [GO:0048156 "tau protein binding" evidence=ISO] [GO:0048168
            "regulation of neuronal synaptic plasticity" evidence=ISO]
            [GO:0048471 "perinuclear region of cytoplasm" evidence=IDA]
            [GO:0050321 "tau-protein kinase activity" evidence=ISO;IDA]
            [GO:0050774 "negative regulation of dendrite morphogenesis"
            evidence=ISO] [GO:0051059 "NF-kappaB binding" evidence=ISO]
            [GO:0051534 "negative regulation of NFAT protein import into
            nucleus" evidence=ISO] [GO:0060070 "canonical Wnt receptor
            signaling pathway" evidence=ISO;IDA] [GO:0071109 "superior temporal
            gyrus development" evidence=ISO] [GO:2000738 "positive regulation
            of stem cell differentiation" evidence=IMP] InterPro:IPR000719
            InterPro:IPR002290 InterPro:IPR008271 InterPro:IPR011009
            InterPro:IPR017441 Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108
            PROSITE:PS50011 SMART:SM00220 MGI:MGI:1861437 GO:GO:0005829
            GO:GO:0005886 GO:GO:0005524 GO:GO:0005813 GO:GO:0048471
            GO:GO:0045892 GO:GO:0021766 GO:GO:0050774 GO:GO:0007010
            GO:GO:0043066 GO:GO:0046827 GO:GO:0005654 GO:GO:0031334
            GO:GO:0016477 GO:GO:0042493 GO:GO:0010226 GO:GO:0035556
            GO:GO:0032092 GO:GO:0031333 eggNOG:COG0515 GO:GO:0008283
            GO:GO:0043198 GO:GO:0043025 SUPFAM:SSF56112 GO:GO:0004674
            GO:GO:0045944 GO:GO:0043197 GO:GO:0005977 GO:GO:0010800
            GO:GO:0050321 GO:GO:0018105 GO:GO:0045121 GO:GO:0030426
            GO:GO:0009887 Reactome:REACT_118161 GO:GO:0030529 GO:GO:0007409
            GO:GO:0007520 GO:GO:0043407 GO:GO:0032091 GO:GO:0051534
            GO:GO:0033138 GO:GO:0045444 GO:GO:0032855 GO:GO:0001837
            GO:GO:0006349 GO:GO:0030877 GO:GO:0048168 GO:GO:0006611
            GO:GO:0030010 GO:GO:0006983 GO:GO:0001954 GO:GO:0000320
            HOVERGEN:HBG014652 GO:GO:0032886 GO:GO:0035372 GO:GO:0071109
            GO:GO:0044027 HOGENOM:HOG000233017 OrthoDB:EOG4WH8KZ
            GeneTree:ENSGT00520000055635 CTD:2932 KO:K03083 ChiTaRS:GSK3B
            GO:GO:0044337 EMBL:AF156099 EMBL:BC006936 EMBL:BC060743
            IPI:IPI00125319 RefSeq:NP_062801.1 UniGene:Mm.394930
            ProteinModelPortal:Q9WV60 SMR:Q9WV60 IntAct:Q9WV60 STRING:Q9WV60
            PhosphoSite:Q9WV60 PaxDb:Q9WV60 PRIDE:Q9WV60
            Ensembl:ENSMUST00000023507 GeneID:56637 KEGG:mmu:56637
            BindingDB:Q9WV60 ChEMBL:CHEMBL1075321 NextBio:313081
            PMAP-CutDB:Q9WV60 Bgee:Q9WV60 CleanEx:MM_GSK3B
            Genevestigator:Q9WV60 GermOnline:ENSMUSG00000022812 GO:GO:2000738
            Uniprot:Q9WV60
        Length = 420

 Score = 124 (48.7 bits), Expect = 4.0e-07, P = 4.0e-07
 Identities = 26/60 (43%), Positives = 33/60 (55%)

Query:    10 LLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXXXEQELAIQPNLNAALLP 69
             LLEYTP++R++PL+ACAH FFDELR                    QEL+  P L   L+P
Sbjct:   320 LLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIP 379


>RGD|70982 [details] [associations]
            symbol:Gsk3b "glycogen synthase kinase 3 beta" species:10116
           "Rattus norvegicus" [GO:0000320 "re-entry into mitotic cell cycle"
           evidence=IEA;ISO] [GO:0001085 "RNA polymerase II transcription
           factor binding" evidence=IEA;ISO] [GO:0001837 "epithelial to
           mesenchymal transition" evidence=ISO;ISS] [GO:0001954 "positive
           regulation of cell-matrix adhesion" evidence=IEA;ISO] [GO:0002039
           "p53 binding" evidence=IEA;ISO] [GO:0004672 "protein kinase
           activity" evidence=ISO] [GO:0004674 "protein serine/threonine kinase
           activity" evidence=ISO;IDA;TAS] [GO:0005178 "integrin binding"
           evidence=IPI] [GO:0005515 "protein binding" evidence=IPI]
           [GO:0005524 "ATP binding" evidence=IDA] [GO:0005634 "nucleus"
           evidence=ISO;ISS;IDA] [GO:0005737 "cytoplasm"
           evidence=ISO;ISS;IDA;TAS] [GO:0005813 "centrosome" evidence=IEA;ISO]
           [GO:0005829 "cytosol" evidence=ISO;IDA;TAS] [GO:0005886 "plasma
           membrane" evidence=IEA;ISO] [GO:0005977 "glycogen metabolic process"
           evidence=IEA;ISO] [GO:0006349 "regulation of gene expression by
           genetic imprinting" evidence=IEA;ISO] [GO:0006468 "protein
           phosphorylation" evidence=ISO;IDA] [GO:0006611 "protein export from
           nucleus" evidence=IEA;ISO] [GO:0006917 "induction of apoptosis"
           evidence=IDA;TAS] [GO:0006950 "response to stress" evidence=ISO]
           [GO:0006983 "ER overload response" evidence=IEA;ISO] [GO:0007163
           "establishment or maintenance of cell polarity" evidence=IDA]
           [GO:0007409 "axonogenesis" evidence=IEA;ISO] [GO:0007520 "myoblast
           fusion" evidence=IEA;ISO] [GO:0008013 "beta-catenin binding"
           evidence=IEA;ISO] [GO:0009887 "organ morphogenesis"
           evidence=IEA;ISO] [GO:0010226 "response to lithium ion"
           evidence=IEP] [GO:0010800 "positive regulation of peptidyl-threonine
           phosphorylation" evidence=IEA;ISO] [GO:0014902 "myotube
           differentiation" evidence=ISO] [GO:0016020 "membrane" evidence=IDA]
           [GO:0016055 "Wnt receptor signaling pathway" evidence=ISO]
           [GO:0016301 "kinase activity" evidence=ISO;ISS] [GO:0016310
           "phosphorylation" evidence=ISO] [GO:0016477 "cell migration"
           evidence=IEA;ISO] [GO:0018105 "peptidyl-serine phosphorylation"
           evidence=IEA;ISO] [GO:0019901 "protein kinase binding"
           evidence=ISO;IPI] [GO:0021766 "hippocampus development"
           evidence=IEA;ISO] [GO:0030010 "establishment of cell polarity"
           evidence=IDA] [GO:0030426 "growth cone" evidence=IEA;ISO]
           [GO:0030529 "ribonucleoprotein complex" evidence=IEA;ISO]
           [GO:0030877 "beta-catenin destruction complex" evidence=ISO;IDA]
           [GO:0031333 "negative regulation of protein complex assembly"
           evidence=IEA;ISO] [GO:0031334 "positive regulation of protein
           complex assembly" evidence=IEA;ISO] [GO:0031625 "ubiquitin protein
           ligase binding" evidence=IEA;ISO] [GO:0032091 "negative regulation
           of protein binding" evidence=IEA;ISO] [GO:0032092 "positive
           regulation of protein binding" evidence=ISO;ISS] [GO:0032855
           "positive regulation of Rac GTPase activity" evidence=IEA;ISO]
           [GO:0032886 "regulation of microtubule-based process"
           evidence=ISO;ISS] [GO:0033138 "positive regulation of
           peptidyl-serine phosphorylation" evidence=IEA;ISO] [GO:0034236
           "protein kinase A catalytic subunit binding" evidence=IEA;ISO]
           [GO:0035255 "ionotropic glutamate receptor binding" evidence=IPI]
           [GO:0035372 "protein localization to microtubule" evidence=IEA;ISO]
           [GO:0035556 "intracellular signal transduction" evidence=IEA;ISO]
           [GO:0042493 "response to drug" evidence=IEP] [GO:0043025 "neuronal
           cell body" evidence=IEA;ISO] [GO:0043066 "negative regulation of
           apoptotic process" evidence=IEA;ISO] [GO:0043197 "dendritic spine"
           evidence=IDA] [GO:0043198 "dendritic shaft" evidence=IEA;ISO]
           [GO:0043227 "membrane-bounded organelle" evidence=ISO] [GO:0043234
           "protein complex" evidence=IDA] [GO:0043407 "negative regulation of
           MAP kinase activity" evidence=IMP] [GO:0044027 "hypermethylation of
           CpG island" evidence=IEA;ISO] [GO:0044337 "canonical Wnt receptor
           signaling pathway involved in positive regulation of apoptotic
           process" evidence=IEA;ISO] [GO:0045121 "membrane raft" evidence=IDA]
           [GO:0045444 "fat cell differentiation" evidence=IEA;ISO] [GO:0045892
           "negative regulation of transcription, DNA-dependent" evidence=IDA]
           [GO:0045944 "positive regulation of transcription from RNA
           polymerase II promoter" evidence=IEA;ISO] [GO:0046827 "positive
           regulation of protein export from nucleus" evidence=IEA;ISO]
           [GO:0048156 "tau protein binding" evidence=IDA] [GO:0048168
           "regulation of neuronal synaptic plasticity" evidence=IMP]
           [GO:0048471 "perinuclear region of cytoplasm" evidence=IEA;ISO]
           [GO:0050321 "tau-protein kinase activity" evidence=ISO;IDA]
           [GO:0050774 "negative regulation of dendrite morphogenesis"
           evidence=IMP] [GO:0051059 "NF-kappaB binding" evidence=IEA;ISO]
           [GO:0051534 "negative regulation of NFAT protein import into
           nucleus" evidence=ISO;ISS] [GO:0060070 "canonical Wnt receptor
           signaling pathway" evidence=ISO] [GO:0071109 "superior temporal
           gyrus development" evidence=IEA;ISO] [GO:2000738 "positive
           regulation of stem cell differentiation" evidence=IEA;ISO]
           [GO:0005730 "nucleolus" evidence=ISO] Reactome:REACT_110573
           InterPro:IPR000719 InterPro:IPR002290 InterPro:IPR008271
           InterPro:IPR011009 InterPro:IPR017441 Pfam:PF00069 PROSITE:PS00107
           PROSITE:PS00108 PROSITE:PS50011 SMART:SM00220 RGD:70982
           GO:GO:0005829 GO:GO:0005886 GO:GO:0005524 GO:GO:0005634
           GO:GO:0005813 GO:GO:0045892 Reactome:REACT_111984 GO:GO:0021766
           GO:GO:0050774 GO:GO:0043066 GO:GO:0046827 GO:GO:0031334
           GO:GO:0016477 GO:GO:0006917 GO:GO:0042493 GO:GO:0010226
           GO:GO:0035556 GO:GO:0032092 GO:GO:0031333 eggNOG:COG0515
           GO:GO:0043198 GO:GO:0043025 SUPFAM:SSF56112 GO:GO:0004674
           GO:GO:0045944 GO:GO:0043197 GO:GO:0005977 GO:GO:0010800
           GO:GO:0050321 GO:GO:0018105 GO:GO:0045121 GO:GO:0030426
           GO:GO:0009887 GO:GO:0030529 GO:GO:0007409 GO:GO:0007520
           GO:GO:0043407 GO:GO:0032091 GO:GO:0051534 GO:GO:0033138
           Reactome:REACT_109781 GO:GO:0045444 GO:GO:0032855 GO:GO:0001837
           GO:GO:0006349 GO:GO:0030877 GO:GO:0048168 GO:GO:0006611
           GO:GO:0030010 GO:GO:0006983 GO:GO:0001954 GO:GO:0000320
           HOVERGEN:HBG014652 GO:GO:0032886 GO:GO:0035372 GO:GO:0071109
           GO:GO:0044027 GO:GO:0048156 HOGENOM:HOG000233017 OrthoDB:EOG4WH8KZ
           GeneTree:ENSGT00520000055635 BRENDA:2.7.11.26 CTD:2932 KO:K03083
           GO:GO:0044337 EMBL:X53428 EMBL:X73653 IPI:IPI00324168 PIR:S14708
           RefSeq:NP_114469.1 UniGene:Rn.10426 ProteinModelPortal:P18266
           SMR:P18266 DIP:DIP-40957N MINT:MINT-121872 STRING:P18266
           PhosphoSite:P18266 PRIDE:P18266 Ensembl:ENSRNOT00000003867
           GeneID:84027 KEGG:rno:84027 UCSC:RGD:70982 InParanoid:P18266
           BindingDB:P18266 ChEMBL:CHEMBL3669 NextBio:616603
           Genevestigator:P18266 GermOnline:ENSRNOG00000002833 Uniprot:P18266
        Length = 420

 Score = 124 (48.7 bits), Expect = 4.0e-07, P = 4.0e-07
 Identities = 26/60 (43%), Positives = 33/60 (55%)

Query:    10 LLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXXXEQELAIQPNLNAALLP 69
             LLEYTP++R++PL+ACAH FFDELR                    QEL+  P L   L+P
Sbjct:   320 LLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIP 379


>UNIPROTKB|E2RB53 [details] [associations]
            symbol:GSK3B "Uncharacterized protein" species:9615 "Canis
            lupus familiaris" [GO:2000738 "positive regulation of stem cell
            differentiation" evidence=IEA] [GO:0071109 "superior temporal gyrus
            development" evidence=IEA] [GO:0051534 "negative regulation of NFAT
            protein import into nucleus" evidence=IEA] [GO:0051059 "NF-kappaB
            binding" evidence=IEA] [GO:0050321 "tau-protein kinase activity"
            evidence=IEA] [GO:0048471 "perinuclear region of cytoplasm"
            evidence=IEA] [GO:0046827 "positive regulation of protein export
            from nucleus" evidence=IEA] [GO:0045944 "positive regulation of
            transcription from RNA polymerase II promoter" evidence=IEA]
            [GO:0045444 "fat cell differentiation" evidence=IEA] [GO:0044337
            "canonical Wnt receptor signaling pathway involved in positive
            regulation of apoptotic process" evidence=IEA] [GO:0044027
            "hypermethylation of CpG island" evidence=IEA] [GO:0043198
            "dendritic shaft" evidence=IEA] [GO:0043066 "negative regulation of
            apoptotic process" evidence=IEA] [GO:0043025 "neuronal cell body"
            evidence=IEA] [GO:0035556 "intracellular signal transduction"
            evidence=IEA] [GO:0035372 "protein localization to microtubule"
            evidence=IEA] [GO:0034236 "protein kinase A catalytic subunit
            binding" evidence=IEA] [GO:0033138 "positive regulation of
            peptidyl-serine phosphorylation" evidence=IEA] [GO:0032886
            "regulation of microtubule-based process" evidence=IEA] [GO:0032855
            "positive regulation of Rac GTPase activity" evidence=IEA]
            [GO:0032092 "positive regulation of protein binding" evidence=IEA]
            [GO:0032091 "negative regulation of protein binding" evidence=IEA]
            [GO:0031625 "ubiquitin protein ligase binding" evidence=IEA]
            [GO:0031334 "positive regulation of protein complex assembly"
            evidence=IEA] [GO:0031333 "negative regulation of protein complex
            assembly" evidence=IEA] [GO:0030877 "beta-catenin destruction
            complex" evidence=IEA] [GO:0030529 "ribonucleoprotein complex"
            evidence=IEA] [GO:0030426 "growth cone" evidence=IEA] [GO:0021766
            "hippocampus development" evidence=IEA] [GO:0018105
            "peptidyl-serine phosphorylation" evidence=IEA] [GO:0016477 "cell
            migration" evidence=IEA] [GO:0010800 "positive regulation of
            peptidyl-threonine phosphorylation" evidence=IEA] [GO:0009887
            "organ morphogenesis" evidence=IEA] [GO:0008013 "beta-catenin
            binding" evidence=IEA] [GO:0007520 "myoblast fusion" evidence=IEA]
            [GO:0007409 "axonogenesis" evidence=IEA] [GO:0006983 "ER overload
            response" evidence=IEA] [GO:0006611 "protein export from nucleus"
            evidence=IEA] [GO:0006349 "regulation of gene expression by genetic
            imprinting" evidence=IEA] [GO:0005977 "glycogen metabolic process"
            evidence=IEA] [GO:0005886 "plasma membrane" evidence=IEA]
            [GO:0005829 "cytosol" evidence=IEA] [GO:0005813 "centrosome"
            evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0002039 "p53
            binding" evidence=IEA] [GO:0001954 "positive regulation of
            cell-matrix adhesion" evidence=IEA] [GO:0001837 "epithelial to
            mesenchymal transition" evidence=IEA] [GO:0001085 "RNA polymerase
            II transcription factor binding" evidence=IEA] [GO:0000320
            "re-entry into mitotic cell cycle" evidence=IEA] [GO:0005524 "ATP
            binding" evidence=IEA] [GO:0004674 "protein serine/threonine kinase
            activity" evidence=IEA] InterPro:IPR000719 InterPro:IPR002290
            InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR017441
            Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108 PROSITE:PS50011
            SMART:SM00220 GO:GO:0005829 GO:GO:0005886 GO:GO:0005524
            GO:GO:0005634 GO:GO:0005813 GO:GO:0021766 GO:GO:0043066
            GO:GO:0046827 GO:GO:0031334 GO:GO:0016477 GO:GO:0035556
            GO:GO:0032092 GO:GO:0031333 GO:GO:0043198 GO:GO:0043025
            SUPFAM:SSF56112 GO:GO:0004674 GO:GO:0045944 GO:GO:0005977
            GO:GO:0010800 GO:GO:0050321 GO:GO:0018105 GO:GO:0030426
            GO:GO:0009887 GO:GO:0030529 GO:GO:0007409 GO:GO:0007520
            GO:GO:0032091 GO:GO:0051534 GO:GO:0033138 GO:GO:0045444
            GO:GO:0032855 GO:GO:0001837 GO:GO:0006349 GO:GO:0030877
            GO:GO:0006611 GO:GO:0006983 GO:GO:0001954 GO:GO:0000320
            GO:GO:0032886 GO:GO:0035372 GO:GO:0071109 GO:GO:0044027
            GeneTree:ENSGT00520000055635 CTD:2932 KO:K03083 OMA:PSLFNFT
            GO:GO:0044337 EMBL:AAEX03017018 GeneID:478575 KEGG:cfa:478575
            NextBio:20853894 RefSeq:XP_535751.2 ProteinModelPortal:E2RB53
            Ensembl:ENSCAFT00000038668 Uniprot:E2RB53
        Length = 433

 Score = 124 (48.7 bits), Expect = 4.2e-07, P = 4.2e-07
 Identities = 26/60 (43%), Positives = 33/60 (55%)

Query:    10 LLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXXXEQELAIQPNLNAALLP 69
             LLEYTP++R++PL+ACAH FFDELR                    QEL+  P L   L+P
Sbjct:   333 LLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIP 392


>FB|FBgn0046332 [details] [associations]
            symbol:gskt "gasket" species:7227 "Drosophila melanogaster"
            [GO:0004674 "protein serine/threonine kinase activity"
            evidence=IEA;NAS] [GO:0006468 "protein phosphorylation"
            evidence=IEA;NAS] [GO:0005524 "ATP binding" evidence=IEA]
            [GO:0008584 "male gonad development" evidence=IMP] [GO:0048232
            "male gamete generation" evidence=IMP] InterPro:IPR000719
            InterPro:IPR002290 InterPro:IPR008271 InterPro:IPR011009
            InterPro:IPR017441 Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108
            PROSITE:PS50011 SMART:SM00220 EMBL:AE014297 GO:GO:0005524
            eggNOG:COG0515 SUPFAM:SSF56112 GO:GO:0004674 GO:GO:0050321
            GeneTree:ENSGT00520000055635 EMBL:BT001338 RefSeq:NP_733426.1
            UniGene:Dm.14965 ProteinModelPortal:P83101 SMR:P83101 IntAct:P83101
            STRING:P83101 PRIDE:P83101 EnsemblMetazoa:FBtr0085784 GeneID:318552
            KEGG:dme:Dmel_CG31003 UCSC:CG31003-RA CTD:318552
            FlyBase:FBgn0046332 InParanoid:P83101 OMA:THEVKIC OrthoDB:EOG4H70SQ
            PhylomeDB:P83101 GenomeRNAi:318552 NextBio:845394 Bgee:P83101
            GermOnline:CG31003 GO:GO:0048232 Uniprot:P83101
        Length = 501

 Score = 105 (42.0 bits), Expect = 5.9e-05, P = 5.9e-05
 Identities = 24/67 (35%), Positives = 34/67 (50%)

Query:    10 LLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXX-XXXXXEQELAIQPNLNAALL 68
             +L Y+P++R+SPL  CAH FFDELR                    + E  I+P+    LL
Sbjct:   297 MLIYSPNARVSPLMGCAHPFFDELRQDPHQQLPNGRSLPPLFNFTDYEKTIEPDTMPLLL 356

Query:    69 PKRPGST 75
             P+  GS+
Sbjct:   357 PRAQGSS 363


>TAIR|locus:2124082 [details] [associations]
            symbol:BIN2 "BRASSINOSTEROID-INSENSITIVE 2" species:3702
            "Arabidopsis thaliana" [GO:0004672 "protein kinase activity"
            evidence=IEA;TAS] [GO:0004674 "protein serine/threonine kinase
            activity" evidence=IEA;ISS;IDA] [GO:0004713 "protein tyrosine
            kinase activity" evidence=IEA] [GO:0005524 "ATP binding"
            evidence=IEA] [GO:0006468 "protein phosphorylation"
            evidence=IEA;IPI] [GO:0016301 "kinase activity" evidence=ISS]
            [GO:0016772 "transferase activity, transferring
            phosphorus-containing groups" evidence=IEA] [GO:0009729 "detection
            of brassinosteroid stimulus" evidence=IMP] [GO:0009742
            "brassinosteroid mediated signaling pathway" evidence=IMP]
            [GO:0009733 "response to auxin stimulus" evidence=IMP] [GO:0009825
            "multidimensional cell growth" evidence=IMP] [GO:0009965 "leaf
            morphogenesis" evidence=IMP] [GO:0005515 "protein binding"
            evidence=IPI] [GO:0005886 "plasma membrane" evidence=IDA]
            [GO:0046827 "positive regulation of protein export from nucleus"
            evidence=IDA] [GO:0046777 "protein autophosphorylation"
            evidence=IDA] [GO:0006096 "glycolysis" evidence=RCA] [GO:0006833
            "water transport" evidence=RCA] [GO:0006972 "hyperosmotic response"
            evidence=RCA] [GO:0007030 "Golgi organization" evidence=RCA]
            [GO:0009266 "response to temperature stimulus" evidence=RCA]
            [GO:0009651 "response to salt stress" evidence=RCA] [GO:0046686
            "response to cadmium ion" evidence=RCA] [GO:0048767 "root hair
            elongation" evidence=RCA] InterPro:IPR000719 InterPro:IPR002290
            InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR017441
            Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108 PROSITE:PS50011
            SMART:SM00220 GO:GO:0005886 GO:GO:0005524 GO:GO:0009742
            GO:GO:0019048 GO:GO:0046827 EMBL:CP002687 GenomeReviews:CT486007_GR
            GO:GO:0009733 EMBL:AL161549 eggNOG:COG0515 SUPFAM:SSF56112
            GO:GO:0004674 GO:GO:0046777 GO:GO:0009965 GO:GO:0009825
            GO:GO:0009729 EMBL:AL035526 HOGENOM:HOG000233017 BRENDA:2.7.11.26
            ProtClustDB:CLSN2679358 EMBL:X94939 EMBL:Y08947 EMBL:AY157149
            EMBL:AY075699 EMBL:BT026031 EMBL:AY086529 IPI:IPI00531869
            PIR:T04863 RefSeq:NP_193606.1 UniGene:At.22875
            ProteinModelPortal:Q39011 SMR:Q39011 DIP:DIP-46010N IntAct:Q39011
            STRING:Q39011 PRIDE:Q39011 EnsemblPlants:AT4G18710.1 GeneID:827605
            KEGG:ath:AT4G18710 GeneFarm:589 TAIR:At4g18710 InParanoid:Q39011
            KO:K14502 OMA:NKLIPDH PhylomeDB:Q39011 Genevestigator:Q39011
            GermOnline:AT4G18710 Uniprot:Q39011
        Length = 380

 Score = 95 (38.5 bits), Expect = 0.00048, P = 0.00048
 Identities = 18/31 (58%), Positives = 24/31 (77%)

Query:     4 ITWSITLLEYTPSSRISPLQACAHDFFDELR 34
             I ++  LL+Y+PS R + L+ACAH FFDELR
Sbjct:   298 IDFASRLLQYSPSLRCTALEACAHPFFDELR 328


>ASPGD|ASPL0000007962 [details] [associations]
            symbol:AN6508 species:162425 "Emericella nidulans"
            [GO:0005524 "ATP binding" evidence=IEA] [GO:0004713 "protein
            tyrosine kinase activity" evidence=IEA] [GO:0006468 "protein
            phosphorylation" evidence=IEA] [GO:0051984 "positive regulation of
            chromosome segregation" evidence=IEA] [GO:0051519 "activation of
            bipolar cell growth" evidence=IEA] [GO:0071775 "regulation of cell
            cycle cytokinesis" evidence=IEA] [GO:0033047 "regulation of mitotic
            sister chromatid segregation" evidence=IEA] [GO:0004712 "protein
            serine/threonine/tyrosine kinase activity" evidence=IEA]
            [GO:0004674 "protein serine/threonine kinase activity"
            evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0005829
            "cytosol" evidence=IEA] InterPro:IPR000719 InterPro:IPR002290
            InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR017441
            Pfam:PF00069 PROSITE:PS00107 PROSITE:PS00108 PROSITE:PS50011
            SMART:SM00220 GO:GO:0005524 eggNOG:COG0515 SUPFAM:SSF56112
            GO:GO:0004674 EMBL:BN001301 EMBL:AACD01000109 HOGENOM:HOG000233017
            KO:K03083 OMA:MLEVKLY OrthoDB:EOG4DV8W1 RefSeq:XP_664112.1
            ProteinModelPortal:Q5AYX2 SMR:Q5AYX2 EnsemblFungi:CADANIAT00007277
            GeneID:2870675 KEGG:ani:AN6508.2 Uniprot:Q5AYX2
        Length = 394

 Score = 93 (37.8 bits), Expect = 0.00082, P = 0.00082
 Identities = 25/72 (34%), Positives = 34/72 (47%)

Query:    10 LLEYTPSSRISPLQACAHDFFDELRXXXXXXXXXXXXXXXXXX-------XEQELAIQPN 62
             LLEYTP+ R+S ++A  H FFDELR                            EL+I P+
Sbjct:   298 LLEYTPTQRLSAIEAMCHPFFDELRDPNTKLPDSRHPNGAARDLPNLFDFSRHELSIAPS 357

Query:    63 LNAALLP--KRP 72
             +N+ L+P   RP
Sbjct:   358 MNSRLVPPHSRP 369


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.318   0.134   0.409    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      113        67   0.00091  102 3  11 22  0.46    28
                                                     29  0.49    28


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  28
  No. of states in DFA:  540 (57 KB)
  Total size of DFA:  99 KB (2069 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:01
  No. of threads or processors used:  24
  Search cpu time:  6.59u 0.07s 6.66t   Elapsed:  00:00:11
  Total cpu time:  6.59u 0.07s 6.66t   Elapsed:  00:00:14
  Start:  Thu Aug 15 12:19:40 2013   End:  Thu Aug 15 12:19:54 2013

Back to top