Diaphorina citri psyllid: psy10215


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110---
MIFITWSITLLEYTPSSRISPLQACAHDFFDELRNPATTLPNGNPLPPLFNFTEQELAIQPNLNAALLPKRPGSTEDGPNPSSSSAPPPAGPTTSTDLSETTSLHPPGANDMA
ccHHHHHHHHccccccccccHHHHHccccccccccccccccccccccccccccHHHHHHcHHHHHHccccccccccccccccccccccccccccccccccccccccccccccc
MIFITWSITLLEYTPSSRISPLQACAHDFFDELRNPATTLPNGNPLPPLFNFTEQELAIQPNLNAA***********************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIFITWSITLLEYTPSSRISPLQACAHDFFDELRNPATTLPNGNPLPPLFNFTEQELAIQPNLNAALLPKRPGSTEDGPNPSSSSAPPPAGPTTSTDLSETTSLHPPGANDMA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glycogen synthase kinase-3 alpha Constitutively active protein kinase that acts as a negative regulator in the hormonal control of glucose homeostasis, Wnt signaling and regulation of transctiption factors and microtubules, by phosphorylating and inactivating glycogen synthase (GYS1 or GYS2), CTNNB1/beta-catenin, APC and AXIN1. Requires primed phosphorylation of the majority of its substrates. Contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. Regulates glycogen metabolism in liver, but not in muscle. May also mediate the development of insulin resistance by regulating activation of transcription factors. In Wnt signaling, regulates the level and transcriptional activity of nuclear CTNNB1/beta-catenin. May be involved in the regulation of replication in pancreatic beta-cells. Is necessary for the establishment of neuronal polarity and axon outgrowth.confidentQ2NL51
Glycogen synthase kinase-3 alpha Constitutively active protein kinase that acts as a negative regulator in the hormonal control of glucose homeostasis, Wnt signaling and regulation of transctiption factors and microtubules, by phosphorylating and inactivating glycogen synthase (GYS1 or GYS2), CTNNB1/beta-catenin, APC and AXIN1. Requires primed phosphorylation of the majority of its substrates. Contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. Regulates glycogen metabolism in liver, but not in muscle. May also mediate the development of insulin resistance by regulating activation of transcription factors. In Wnt signaling, regulates the level and transcriptional activity of nuclear CTNNB1/beta-catenin. May be involved in the regulation of replication in pancreatic beta-cells. Is necessary for the establishment of neuronal polarity and axon outgrowth.confidentP18265
Glycogen synthase kinase-3 alpha Constitutively active protein kinase that acts as a negative regulator in the hormonal control of glucose homeostasis, Wnt signaling and regulation of transctiption factors and microtubules, by phosphorylating and inactivating glycogen synthase (GYS1 or GYS2), CTNNB1/beta-catenin, APC and AXIN1. Requires primed phosphorylation of the majority of its substrates. Contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. Regulates glycogen metabolism in liver, but not in muscle. May also mediate the development of insulin resistance by regulating activation of transcription factors. In Wnt signaling, regulates the level and transcriptional activity of nuclear CTNNB1/beta-catenin. Facilitates amyloid precursor protein (APP) processing and the generation of APP-derived amyloid plaques found in Alzheimer disease. May be involved in the regulation of replication in pancreatic beta-cells. Is necessary for the establishment of neuronal polarity and axon outgrowth.confidentP49840

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051348 [BP]negative regulation of transferase activityprobableGO:0019222, GO:0050790, GO:0051338, GO:0050789, GO:0065007, GO:0044092, GO:0008150, GO:0065009, GO:0043086
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0051128 [BP]regulation of cellular component organizationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0060284 [BP]regulation of cell developmentprobableGO:0050793, GO:0050794, GO:0045595, GO:0008150, GO:0065007, GO:0050789
GO:0008286 [BP]insulin receptor signaling pathwayprobableGO:0042221, GO:0007169, GO:0070887, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0032869, GO:0032868, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0071375, GO:1901698, GO:0071417, GO:0071310, GO:0065007, GO:0071495, GO:0044700, GO:0009987, GO:0050794, GO:0032870, GO:0044763, GO:0007154, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0010243, GO:1901699, GO:1901652, GO:1901653, GO:0008150, GO:0050896
GO:2000113 [BP]negative regulation of cellular macromolecule biosynthetic processprobableGO:0009889, GO:0010605, GO:0019222, GO:0009890, GO:0031327, GO:0031326, GO:0031323, GO:0031324, GO:2000112, GO:0050794, GO:0050789, GO:0060255, GO:0010556, GO:0065007, GO:0008150, GO:0048519, GO:0009892, GO:0010558, GO:0048523
GO:0006468 [BP]protein phosphorylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0044093 [BP]positive regulation of molecular functionprobableGO:0008150, GO:0065009, GO:0065007
GO:0046325 [BP]negative regulation of glucose importprobableGO:0051051, GO:0051049, GO:0008150, GO:0010827, GO:0065007, GO:0046324, GO:0048519, GO:0032879, GO:0010829, GO:0050789
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0033138 [BP]positive regulation of peptidyl-serine phosphorylationprobableGO:0019220, GO:0009893, GO:0019222, GO:0033135, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0001932, GO:0001934, GO:0048522
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0046627 [BP]negative regulation of insulin receptor signaling pathwayprobableGO:0009968, GO:0009966, GO:0048585, GO:0023051, GO:0048583, GO:0046626, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:1900077, GO:1900076, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0071285 [BP]cellular response to lithium ionprobableGO:0051716, GO:0071248, GO:0010038, GO:0050896, GO:0009987, GO:0071241, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0010226, GO:0010035, GO:0044699
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0035324 [CC]female germline ring canalprobableGO:0005575, GO:0005576, GO:0045171, GO:0044421, GO:0045172
GO:0071407 [BP]cellular response to organic cyclic compoundprobableGO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0071310, GO:0044763, GO:0044699, GO:0070887, GO:0042221, GO:0010033, GO:0014070
GO:0072686 [CC]mitotic spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0010800 [BP]positive regulation of peptidyl-threonine phosphorylationprobableGO:0019220, GO:0080090, GO:0019222, GO:0031325, GO:0031323, GO:0050789, GO:0009893, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0010799, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0001932, GO:0001934, GO:0048522
GO:0004674 [MF]protein serine/threonine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0030162 [BP]regulation of proteolysisprobableGO:0080090, GO:0019222, GO:0060255, GO:0051246, GO:0065007, GO:0008150, GO:0050789
GO:0045169 [CC]fusomeprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0045596 [BP]negative regulation of cell differentiationprobableGO:0051093, GO:0050793, GO:0050794, GO:0008150, GO:0045595, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0032502 [BP]developmental processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4E7W, chain A
Confidence level:very confident
Coverage over the Query: 2-74
View the alignment between query and template
View the model in PyMOL