BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy10249
(91 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q09225|NRF6_CAEEL Nose resistant to fluoxetine protein 6 OS=Caenorhabditis elegans
GN=nrf-6 PE=1 SV=3
Length = 822
Score = 37.0 bits (84), Expect = 0.037, Method: Compositional matrix adjust.
Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 4/63 (6%)
Query: 2 GDMNYTYDRLDAANYAAFAPITWCLVFMWVIFLSYTGNAGFLGRLASWKVFLVCTRISYT 61
GD++ ++ L Y F + L WV+F TGN G + + SW++F+ ++I++
Sbjct: 679 GDISKPWEIL----YTIFGTPAYALALGWVVFACTTGNGGPVDTILSWRLFVPLSKITFC 734
Query: 62 FYL 64
YL
Sbjct: 735 AYL 737
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.333 0.143 0.490
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 34,015,794
Number of Sequences: 539616
Number of extensions: 1165721
Number of successful extensions: 2639
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 2636
Number of HSP's gapped (non-prelim): 8
length of query: 91
length of database: 191,569,459
effective HSP length: 61
effective length of query: 30
effective length of database: 158,652,883
effective search space: 4759586490
effective search space used: 4759586490
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 55 (25.8 bits)