BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy10249
         (91 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q09225|NRF6_CAEEL Nose resistant to fluoxetine protein 6 OS=Caenorhabditis elegans
           GN=nrf-6 PE=1 SV=3
          Length = 822

 Score = 37.0 bits (84), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 4/63 (6%)

Query: 2   GDMNYTYDRLDAANYAAFAPITWCLVFMWVIFLSYTGNAGFLGRLASWKVFLVCTRISYT 61
           GD++  ++ L    Y  F    + L   WV+F   TGN G +  + SW++F+  ++I++ 
Sbjct: 679 GDISKPWEIL----YTIFGTPAYALALGWVVFACTTGNGGPVDTILSWRLFVPLSKITFC 734

Query: 62  FYL 64
            YL
Sbjct: 735 AYL 737


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.333    0.143    0.490 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 34,015,794
Number of Sequences: 539616
Number of extensions: 1165721
Number of successful extensions: 2639
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 2636
Number of HSP's gapped (non-prelim): 8
length of query: 91
length of database: 191,569,459
effective HSP length: 61
effective length of query: 30
effective length of database: 158,652,883
effective search space: 4759586490
effective search space used: 4759586490
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 55 (25.8 bits)