Diaphorina citri psyllid: psy10256


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
ELKTARGLDREKIARYTLNAHVQDRDQPAWECVSLITLTLTDINDNAPEFASVINSASILENAEIGSLSTVNATIGVNRCGHTFRGKDLRCYNLFK
ccEEccccccccccEEEEEEEEEEccccccccEEEEEEEEEcccccccccccccEEEEEcccccccCEEEEcccccccccEEEEcccccccccccc
ELKTARGLDREKIARYTLNAHVQDRDQPAWECVSLITLTLTDINDNAPEFASVINSASILENAEIGSLSTVNATIGVNRCGHTFRGKDLRCYNLFK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ELKTARGLDREKIARYTLNAHVQDRDQPAWECVSLITLTLTDINDNAPEFASVINSASILENAEIGSLSTVNATIGVNRCGHTFRGKDLRCYNLFK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0005913 [CC]cell-cell adherens junctionprobableGO:0005575, GO:0030054, GO:0070161, GO:0005912, GO:0005911
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0005925 [CC]focal adhesionprobableGO:0070161, GO:0005575, GO:0005912, GO:0005924, GO:0030054, GO:0030055
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0016337 [BP]cell-cell adhesionprobableGO:0009987, GO:0008150, GO:0007155, GO:0044763, GO:0022610, GO:0044699
GO:0019222 [BP]regulation of metabolic processprobableGO:0008150, GO:0065007, GO:0050789
GO:0044700 [BP]single organism signalingprobableGO:0008150, GO:0023052, GO:0044699
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0043229 [CC]intracellular organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0043226
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0016342 [CC]catenin complexprobableGO:0019897, GO:0043234, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0019898, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0007154 [BP]cell communicationprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Q55, chain A
Confidence level:very confident
Coverage over the Query: 1-94
View the alignment between query and template
View the model in PyMOL