BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy10258
         (69 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1HWY|A Chain A, Bovine Glutamate Dehydrogenase Complexed With Nad And
           2-Oxoglutarate
 pdb|1HWY|B Chain B, Bovine Glutamate Dehydrogenase Complexed With Nad And
           2-Oxoglutarate
 pdb|1HWY|C Chain C, Bovine Glutamate Dehydrogenase Complexed With Nad And
           2-Oxoglutarate
 pdb|1HWY|D Chain D, Bovine Glutamate Dehydrogenase Complexed With Nad And
           2-Oxoglutarate
 pdb|1HWY|E Chain E, Bovine Glutamate Dehydrogenase Complexed With Nad And
           2-Oxoglutarate
 pdb|1HWY|F Chain F, Bovine Glutamate Dehydrogenase Complexed With Nad And
           2-Oxoglutarate
 pdb|1HWZ|A Chain A, Bovine Glutamate Dehydrogenase Complexed With Nadph,
           Glutamate, And Gtp
 pdb|1HWZ|B Chain B, Bovine Glutamate Dehydrogenase Complexed With Nadph,
           Glutamate, And Gtp
 pdb|1HWZ|C Chain C, Bovine Glutamate Dehydrogenase Complexed With Nadph,
           Glutamate, And Gtp
 pdb|1HWZ|D Chain D, Bovine Glutamate Dehydrogenase Complexed With Nadph,
           Glutamate, And Gtp
 pdb|1HWZ|E Chain E, Bovine Glutamate Dehydrogenase Complexed With Nadph,
           Glutamate, And Gtp
 pdb|1HWZ|F Chain F, Bovine Glutamate Dehydrogenase Complexed With Nadph,
           Glutamate, And Gtp
          Length = 501

 Score = 25.8 bits (55), Expect = 5.8,   Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 1/53 (1%)

Query: 13  PRLKTGVIPKGLDGPRPAQKDILAIRAYILLFLKQLMMLGPGVKEDELQSILN 65
           PR+K  +I +G +GP   Q D + +   I++ +  L +   GV     Q + N
Sbjct: 337 PRVKAKIIAEGANGPTTPQADKIFLERNIMV-IPDLYLNAGGVTVSYFQILKN 388


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.144    0.437 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,169,223
Number of Sequences: 62578
Number of extensions: 69621
Number of successful extensions: 149
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 149
Number of HSP's gapped (non-prelim): 1
length of query: 69
length of database: 14,973,337
effective HSP length: 39
effective length of query: 30
effective length of database: 12,532,795
effective search space: 375983850
effective search space used: 375983850
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 45 (21.9 bits)