BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy10258
(69 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1HWY|A Chain A, Bovine Glutamate Dehydrogenase Complexed With Nad And
2-Oxoglutarate
pdb|1HWY|B Chain B, Bovine Glutamate Dehydrogenase Complexed With Nad And
2-Oxoglutarate
pdb|1HWY|C Chain C, Bovine Glutamate Dehydrogenase Complexed With Nad And
2-Oxoglutarate
pdb|1HWY|D Chain D, Bovine Glutamate Dehydrogenase Complexed With Nad And
2-Oxoglutarate
pdb|1HWY|E Chain E, Bovine Glutamate Dehydrogenase Complexed With Nad And
2-Oxoglutarate
pdb|1HWY|F Chain F, Bovine Glutamate Dehydrogenase Complexed With Nad And
2-Oxoglutarate
pdb|1HWZ|A Chain A, Bovine Glutamate Dehydrogenase Complexed With Nadph,
Glutamate, And Gtp
pdb|1HWZ|B Chain B, Bovine Glutamate Dehydrogenase Complexed With Nadph,
Glutamate, And Gtp
pdb|1HWZ|C Chain C, Bovine Glutamate Dehydrogenase Complexed With Nadph,
Glutamate, And Gtp
pdb|1HWZ|D Chain D, Bovine Glutamate Dehydrogenase Complexed With Nadph,
Glutamate, And Gtp
pdb|1HWZ|E Chain E, Bovine Glutamate Dehydrogenase Complexed With Nadph,
Glutamate, And Gtp
pdb|1HWZ|F Chain F, Bovine Glutamate Dehydrogenase Complexed With Nadph,
Glutamate, And Gtp
Length = 501
Score = 25.8 bits (55), Expect = 5.8, Method: Composition-based stats.
Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 1/53 (1%)
Query: 13 PRLKTGVIPKGLDGPRPAQKDILAIRAYILLFLKQLMMLGPGVKEDELQSILN 65
PR+K +I +G +GP Q D + + I++ + L + GV Q + N
Sbjct: 337 PRVKAKIIAEGANGPTTPQADKIFLERNIMV-IPDLYLNAGGVTVSYFQILKN 388
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.144 0.437
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,169,223
Number of Sequences: 62578
Number of extensions: 69621
Number of successful extensions: 149
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 149
Number of HSP's gapped (non-prelim): 1
length of query: 69
length of database: 14,973,337
effective HSP length: 39
effective length of query: 30
effective length of database: 12,532,795
effective search space: 375983850
effective search space used: 375983850
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 45 (21.9 bits)