Diaphorina citri psyllid: psy10259

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MPHLSFDTMFFLGKLVGYHLVFDTTNRRKLLFQKTMITIISTMAMCAVVRQTYWVIMNKQDYSWDDHGYSLMNRLYNDVGNLLDDKFKIAYNLTYYTLAGRTQVDTSRFRRAIWNYVQCLFGIRHDDYDYGEVNQ
cccccHHHHHHHHHHHcEEEEEEccccccccccHHHHHcccHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccccccccccccc
***LSFDTMFFLGKLVGYHLVFDTTNRRKLLFQKTMITIISTMAMCAVVRQTYWVIMNKQDYSWDDHGYSLMNRLYNDVGNLLDDKFKIAYNLTYYTLAGRTQVDTSRFRRAIWNYVQCLFGIRHDDYDYGEV**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPHLSFDTMFFLGKLVGYHLVFDTTNRRKLLFQKTMITIISTMAMCAVVRQTYWVIMNKQDYSWDDHGYSLMNRLYNDVGNLLDDKFKIAYNLTYYTLAGRTQVDTSRFRRAIWNYVQCLFGIRHDDYDYGEVNQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sestrin homolog confidentQ9W1K5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0002121 [BP]inter-male aggressive behaviorprobableGO:0050896, GO:0007610, GO:0008150, GO:0002118, GO:0051705, GO:0051704
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0010259 [BP]multicellular organismal agingprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0030308 [BP]negative regulation of cell growthprobableGO:0045926, GO:0040008, GO:0051128, GO:0008150, GO:0001558, GO:0065007, GO:0048519, GO:0050794, GO:0050789, GO:0048523
GO:0000422 [BP]mitochondrion degradationprobableGO:0006914, GO:0009987, GO:0044237, GO:0044248, GO:0008150, GO:0008152, GO:0009056
GO:0007368 [BP]determination of left/right symmetryprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0009855, GO:0009799, GO:0007275, GO:0044699
GO:0007050 [BP]cell cycle arrestprobableGO:0044699, GO:0045786, GO:0051726, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0022402, GO:0048523, GO:0048519, GO:0044763, GO:0050789, GO:0007049
GO:0008285 [BP]negative regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:2000377 [BP]regulation of reactive oxygen species metabolic processprobableGO:0019222, GO:0031323, GO:0050794, GO:0008150, GO:0065007, GO:0050789
GO:0006974 [BP]response to DNA damage stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0033554, GO:0008150, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted