Diaphorina citri psyllid: psy10269


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MGPKCALFLHMSYIVGSEDGEKIQTVLKAAGVEVEPYWPGLFAKALEGVNVKELISNVGSGAGAGPAAAAPAAAQAAAPAAAEAKEDKKKKEESDEGSDDDMGFGLFD
ccHHHHHHHHHccccccccHHHHHHHHHHHccccccccHHHHHHHHccccHHHHHHHcccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccc
*GPKCALFLHMSYIVGSEDGEKIQTVLKAAGVEVEPYWPGLFAKALEGVNVKELISNV*******************************************MGFGLFD
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGPKCALFLHMSYIVGSEDGEKIQTVLKAAGVEVEPYWPGLFAKALEGVNVKELISNVGSGAGAGPAAAAPAAAQAAAPAAAEAKEDKKKKEESDEGSDDDMGFGLFD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S acidic ribosomal protein P1 Plays an important role in the elongation step of protein synthesis.very confidentQ9HGV0
60S acidic ribosomal protein P1 Plays an important role in the elongation step of protein synthesis.very confidentP08570
60S acidic ribosomal protein P1 Plays an important role in the elongation step of protein synthesis.very confidentP91913

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0022625 [CC]cytosolic large ribosomal subunitprobableGO:0005737, GO:0005575, GO:0005622, GO:0022626, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0044445, GO:0043226, GO:0044424, GO:0015934, GO:0043228, GO:0030529, GO:0032991, GO:0044422
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LBF, chain A
Confidence level:very confident
Coverage over the Query: 2-62
View the alignment between query and template
View the model in PyMOL
Template: 2ZKR, chain g
Confidence level:confident
Coverage over the Query: 50-55
View the alignment between query and template
View the model in PyMOL