Query         psy10278
Match_columns 110
No_of_seqs    113 out of 2258
Neff          11.1
Searched_HMMs 46136
Date          Fri Aug 16 22:21:41 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10278.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10278hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 2.8E-26   6E-31  137.0   5.5   98    2-102   169-266 (279)
  2 KOG2462|consensus               99.9 3.8E-26 8.2E-31  136.4   5.0  103    2-107   138-243 (279)
  3 KOG1074|consensus               99.7 1.6E-18 3.5E-23  116.4   1.3   55   51-105   605-659 (958)
  4 KOG3576|consensus               99.7 3.9E-18 8.4E-23   98.7  -0.2  102    2-104   125-237 (267)
  5 KOG3623|consensus               99.7 1.1E-17 2.3E-22  111.4   1.3   82   19-100   890-971 (1007)
  6 KOG3576|consensus               99.7 3.7E-17 8.1E-22   94.6   2.3   86   20-105   114-199 (267)
  7 KOG3623|consensus               99.7   9E-17   2E-21  107.1   3.9  101    2-102   218-332 (1007)
  8 KOG1074|consensus               99.6 5.1E-16 1.1E-20  104.7   4.7   58   52-109   880-937 (958)
  9 KOG3608|consensus               99.6 1.3E-14 2.9E-19   90.2   6.3  102    2-104   187-317 (467)
 10 KOG3608|consensus               99.5 4.2E-14 9.1E-19   88.0   7.0  101    2-106   245-348 (467)
 11 PHA00733 hypothetical protein   99.4 2.2E-13 4.8E-18   75.3   4.4   84   20-105    37-125 (128)
 12 PHA02768 hypothetical protein;  99.2 1.1E-11 2.5E-16   57.9   1.9   44   51-96      5-48  (55)
 13 PLN03086 PRLI-interacting fact  99.1 7.9E-10 1.7E-14   73.8   8.0   91    7-104   465-565 (567)
 14 PF13465 zf-H2C2_2:  Zinc-finge  99.0 1.9E-10 4.2E-15   46.3   2.5   26   66-91      1-26  (26)
 15 PHA00733 hypothetical protein   99.0 1.3E-09 2.9E-14   60.3   5.7   64    9-76     61-124 (128)
 16 PHA02768 hypothetical protein;  99.0 1.4E-10   3E-15   54.3   1.4   44   23-68      5-48  (55)
 17 PLN03086 PRLI-interacting fact  99.0 2.6E-09 5.6E-14   71.4   6.6   77   21-102   451-537 (567)
 18 KOG3993|consensus               98.9 3.8E-10 8.2E-15   72.1  -0.0   81   24-104   268-381 (500)
 19 PF13465 zf-H2C2_2:  Zinc-finge  98.8 4.2E-09 9.2E-14   42.4   2.2   25    9-34      1-25  (26)
 20 PHA00616 hypothetical protein   98.7 7.7E-09 1.7E-13   46.2   1.3   31   52-82      2-32  (44)
 21 PHA00616 hypothetical protein   98.6 1.4E-08   3E-13   45.4   1.4   33   23-55      1-33  (44)
 22 PHA00732 hypothetical protein   98.5 1.3E-07 2.8E-12   48.1   3.4   45   23-73      1-46  (79)
 23 PF05605 zf-Di19:  Drought indu  98.4 1.1E-06 2.5E-11   41.5   4.3   49   52-103     3-53  (54)
 24 KOG3993|consensus               98.4 1.7E-07 3.8E-12   60.3   1.7   71    3-74    276-379 (500)
 25 PHA00732 hypothetical protein   98.3 5.5E-07 1.2E-11   45.8   2.9   47   51-103     1-48  (79)
 26 PF00096 zf-C2H2:  Zinc finger,  98.3 4.1E-07 8.8E-12   35.3   1.7   22   80-101     1-22  (23)
 27 PF13912 zf-C2H2_6:  C2H2-type   98.3 8.2E-07 1.8E-11   35.9   2.2   26   79-104     1-26  (27)
 28 PF05605 zf-Di19:  Drought indu  98.3 2.3E-06 4.9E-11   40.4   4.0   50   23-75      2-53  (54)
 29 PF13894 zf-C2H2_4:  C2H2-type   98.2 1.2E-06 2.6E-11   34.1   2.1   24   80-103     1-24  (24)
 30 PF12756 zf-C2H2_2:  C2H2 type   98.2 1.7E-06 3.7E-11   45.7   3.1   74   25-103     1-74  (100)
 31 PF00096 zf-C2H2:  Zinc finger,  98.1 2.2E-06 4.7E-11   33.2   1.2   22   24-45      1-22  (23)
 32 COG5189 SFP1 Putative transcri  97.8 5.3E-06 1.1E-10   52.0   0.6   70   21-100   347-419 (423)
 33 PF09237 GAGA:  GAGA factor;  I  97.8 3.4E-05 7.4E-10   35.4   2.6   33   75-107    20-52  (54)
 34 PF13912 zf-C2H2_6:  C2H2-type   97.8 1.2E-05 2.7E-10   32.3   1.0   24   23-46      1-24  (27)
 35 PF13894 zf-C2H2_4:  C2H2-type   97.8 2.1E-05 4.5E-10   30.4   1.6   23   24-46      1-23  (24)
 36 PF12874 zf-met:  Zinc-finger o  97.6 6.7E-05 1.4E-09   29.5   1.7   23   80-102     1-23  (25)
 37 smart00355 ZnF_C2H2 zinc finge  97.5 8.1E-05 1.7E-09   29.1   2.0   23   80-102     1-23  (26)
 38 PF12171 zf-C2H2_jaz:  Zinc-fin  97.4 0.00011 2.4E-09   29.5   1.5   22   80-101     2-23  (27)
 39 PRK04860 hypothetical protein;  97.3 0.00027 5.9E-09   40.7   2.9   38   51-92    119-156 (160)
 40 PF13909 zf-H2C2_5:  C2H2-type   97.3 0.00016 3.6E-09   28.1   1.5   24   80-104     1-24  (24)
 41 smart00355 ZnF_C2H2 zinc finge  97.3 0.00025 5.5E-09   27.6   2.1   23   24-46      1-23  (26)
 42 PF09237 GAGA:  GAGA factor;  I  97.3   8E-05 1.7E-09   34.2   0.4   29   50-78     23-51  (54)
 43 PF12874 zf-met:  Zinc-finger o  97.0 0.00031 6.8E-09   27.5   0.7   21   24-44      1-21  (25)
 44 PRK04860 hypothetical protein;  96.9 0.00095 2.1E-08   38.5   2.7   37   23-63    119-155 (160)
 45 PF12756 zf-C2H2_2:  C2H2 type   96.4  0.0053 1.1E-07   32.1   3.0   66    3-74      8-73  (100)
 46 PF13913 zf-C2HC_2:  zinc-finge  96.3  0.0038 8.2E-08   24.5   1.7   19   81-100     4-22  (25)
 47 smart00451 ZnF_U1 U1-like zinc  96.2  0.0056 1.2E-07   25.8   2.0   24   79-102     3-26  (35)
 48 cd00350 rubredoxin_like Rubred  94.8   0.023 5.1E-07   23.8   1.5   10   24-33      2-11  (33)
 49 PF09538 FYDLN_acid:  Protein o  94.2   0.024 5.2E-07   30.6   1.0   14   51-64     26-39  (108)
 50 COG5048 FOG: Zn-finger [Genera  94.0   0.019 4.2E-07   37.5   0.4   55   51-105   289-349 (467)
 51 COG5048 FOG: Zn-finger [Genera  93.8   0.017 3.7E-07   37.8  -0.1   63   22-84    288-356 (467)
 52 KOG1146|consensus               93.5  0.0096 2.1E-07   44.3  -1.7   83   16-102   458-541 (1406)
 53 KOG2893|consensus               93.4   0.015 3.4E-07   35.6  -0.6   39   56-98     15-53  (341)
 54 TIGR00622 ssl1 transcription f  93.2     0.3 6.4E-06   26.6   4.1   83   21-105    13-107 (112)
 55 COG4049 Uncharacterized protei  93.1   0.043 9.4E-07   25.8   0.7   27   76-102    14-40  (65)
 56 COG1592 Rubrerythrin [Energy p  92.1     0.1 2.2E-06   30.4   1.5   10   77-86    147-156 (166)
 57 COG5189 SFP1 Putative transcri  92.0   0.091   2E-06   33.7   1.3   29   76-104   346-376 (423)
 58 PF13719 zinc_ribbon_5:  zinc-r  91.9     0.2 4.4E-06   21.5   2.0   32   53-89      4-35  (37)
 59 KOG4173|consensus               91.9    0.08 1.7E-06   31.8   0.9   78   24-104    80-171 (253)
 60 KOG2231|consensus               91.8    0.78 1.7E-05   32.6   5.7   47   53-103   184-236 (669)
 61 PF09986 DUF2225:  Uncharacteri  91.4   0.048   1E-06   33.1  -0.3   17   22-38      4-20  (214)
 62 KOG2186|consensus               90.8    0.23   5E-06   30.8   2.2   49   24-75      4-52  (276)
 63 KOG2231|consensus               90.5       1 2.2E-05   32.1   5.2   72   32-103   123-206 (669)
 64 TIGR02300 FYDLN_acid conserved  90.4    0.16 3.4E-06   28.2   1.1   15   50-64     25-39  (129)
 65 cd00729 rubredoxin_SM Rubredox  90.4    0.19 4.2E-06   21.2   1.2   10   24-33      3-12  (34)
 66 KOG2186|consensus               90.1    0.29 6.3E-06   30.4   2.2   32    9-43     17-48  (276)
 67 TIGR02098 MJ0042_CXXC MJ0042 f  90.0    0.33 7.2E-06   20.7   1.8   10   80-89     26-35  (38)
 68 COG1997 RPL43A Ribosomal prote  89.1    0.27 5.8E-06   25.4   1.3   14   78-91     52-65  (89)
 69 PRK00398 rpoP DNA-directed RNA  89.0    0.28   6E-06   22.1   1.2    8   80-87     22-29  (46)
 70 TIGR00373 conserved hypothetic  89.0    0.63 1.4E-05   27.0   2.9   30   50-88    108-137 (158)
 71 TIGR00373 conserved hypothetic  89.0    0.66 1.4E-05   26.9   3.0   34   19-61    105-138 (158)
 72 PF13717 zinc_ribbon_4:  zinc-r  88.8    0.53 1.1E-05   20.1   2.0   11   79-89     25-35  (36)
 73 COG2888 Predicted Zn-ribbon RN  88.8    0.39 8.4E-06   23.0   1.6   33   50-87     26-58  (61)
 74 PF02892 zf-BED:  BED zinc fing  88.6    0.58 1.3E-05   20.7   2.1   25   77-101    14-42  (45)
 75 smart00659 RPOLCX RNA polymera  88.5    0.56 1.2E-05   21.1   2.0   10   52-61      3-12  (44)
 76 smart00531 TFIIE Transcription  88.4     1.5 3.2E-05   25.0   4.2   37   49-89     97-133 (147)
 77 TIGR02605 CxxC_CxxC_SSSS putat  88.1    0.16 3.5E-06   23.4   0.1   13   24-36      6-18  (52)
 78 PRK14890 putative Zn-ribbon RN  87.5    0.76 1.6E-05   22.0   2.2   32   50-87     24-56  (59)
 79 smart00614 ZnF_BED BED zinc fi  87.3    0.59 1.3E-05   21.4   1.8   22   80-101    19-45  (50)
 80 smart00834 CxxC_CXXC_SSSS Puta  87.3     0.2 4.4E-06   21.7   0.2   13   24-36      6-18  (41)
 81 PRK06266 transcription initiat  86.0    0.97 2.1E-05   26.8   2.6   29   51-88    117-145 (178)
 82 PRK00464 nrdR transcriptional   85.7    0.18 3.9E-06   29.1  -0.5   13   52-64     29-41  (154)
 83 KOG2482|consensus               85.3     2.3 4.9E-05   28.0   4.1   25   80-104   196-220 (423)
 84 PF06524 NOA36:  NOA36 protein;  85.3    0.52 1.1E-05   29.6   1.2   81   19-100   138-230 (314)
 85 PF04959 ARS2:  Arsenite-resist  84.9    0.75 1.6E-05   28.1   1.8   30   76-105    74-103 (214)
 86 PF05443 ROS_MUCR:  ROS/MUCR tr  84.1    0.81 1.8E-05   25.7   1.6   27   77-106    70-96  (132)
 87 PF14353 CpXC:  CpXC protein     84.1    0.16 3.5E-06   28.2  -1.2   12   25-36      3-14  (128)
 88 PTZ00255 60S ribosomal protein  83.9    0.57 1.2E-05   24.5   0.9   14   78-91     53-66  (90)
 89 PF12013 DUF3505:  Protein of u  83.3     1.2 2.6E-05   24.0   2.0   25   80-104    81-109 (109)
 90 smart00734 ZnF_Rad18 Rad18-lik  82.1     1.5 3.2E-05   17.2   1.6   18   81-99      3-20  (26)
 91 PF05290 Baculo_IE-1:  Baculovi  82.0    0.44 9.4E-06   26.7   0.0   59   18-93     75-135 (140)
 92 PRK09678 DNA-binding transcrip  81.3    0.49 1.1E-05   23.7   0.0   15   77-91     25-41  (72)
 93 TIGR00280 L37a ribosomal prote  81.2    0.65 1.4E-05   24.3   0.5   13   78-90     52-64  (91)
 94 PF02176 zf-TRAF:  TRAF-type zi  80.9     1.4 3.1E-05   20.7   1.6   40   51-91      9-54  (60)
 95 PF08790 zf-LYAR:  LYAR-type C2  80.4    0.45 9.9E-06   19.2  -0.2   19   80-99      1-19  (28)
 96 KOG4167|consensus               79.6    0.38 8.2E-06   34.4  -0.9   26   79-104   792-817 (907)
 97 PF01780 Ribosomal_L37ae:  Ribo  79.6    0.47   1E-05   24.8  -0.3   12   79-90     53-64  (90)
 98 KOG2785|consensus               79.3     3.3 7.2E-05   27.5   3.2   24   79-102   217-243 (390)
 99 PF04959 ARS2:  Arsenite-resist  78.0     1.4 2.9E-05   27.0   1.2   27   21-47     75-101 (214)
100 PF07754 DUF1610:  Domain of un  78.0     1.2 2.7E-05   17.2   0.7    8   79-86     16-23  (24)
101 COG5236 Uncharacterized conser  78.0     1.4   3E-05   29.0   1.3   21   53-73    222-242 (493)
102 KOG2893|consensus               77.8    0.61 1.3E-05   28.9  -0.3   45   21-70      9-53  (341)
103 PF03604 DNA_RNApol_7kD:  DNA d  77.4     1.2 2.5E-05   18.6   0.6    8   80-87     18-25  (32)
104 PHA00626 hypothetical protein   77.4     1.7 3.7E-05   20.5   1.2   15   78-92     22-36  (59)
105 PRK03976 rpl37ae 50S ribosomal  76.9    0.98 2.1E-05   23.6   0.4   13   78-90     53-65  (90)
106 KOG3408|consensus               75.9       2 4.4E-05   23.7   1.4   23   79-101    57-79  (129)
107 PF10571 UPF0547:  Uncharacteri  75.9     1.5 3.3E-05   17.3   0.7    9   81-89     16-24  (26)
108 COG0068 HypF Hydrogenase matur  75.3    0.37 7.9E-06   34.4  -1.8   58   26-90    126-184 (750)
109 PF10013 DUF2256:  Uncharacteri  75.2     2.3   5E-05   18.9   1.2   14   81-94     10-23  (42)
110 KOG1146|consensus               74.8    0.31 6.7E-06   37.0  -2.4   77   24-105  1261-1354(1406)
111 smart00154 ZnF_AN1 AN1-like Zi  73.9     2.1 4.5E-05   18.6   0.9   13   79-91     12-24  (39)
112 PF05191 ADK_lid:  Adenylate ki  73.8    0.51 1.1E-05   20.2  -1.0    8   80-87     22-29  (36)
113 PF12013 DUF3505:  Protein of u  73.3     3.1 6.7E-05   22.4   1.7   18   27-44     88-105 (109)
114 COG4530 Uncharacterized protei  72.8     1.8 3.9E-05   23.5   0.7   12   50-61     25-36  (129)
115 COG1996 RPC10 DNA-directed RNA  72.4     3.1 6.7E-05   19.2   1.3   10   24-33      7-16  (49)
116 PF15135 UPF0515:  Uncharacteri  72.0     8.9 0.00019   24.2   3.6   58   22-92    111-168 (278)
117 PF09723 Zn-ribbon_8:  Zinc rib  71.9     2.2 4.7E-05   18.8   0.8   13   80-92      6-18  (42)
118 KOG2907|consensus               71.7       5 0.00011   21.9   2.2   38   52-92     75-115 (116)
119 PF13878 zf-C2H2_3:  zinc-finge  71.0     5.1 0.00011   17.6   1.9   23   24-46     14-38  (41)
120 KOG2785|consensus               71.0       6 0.00013   26.4   2.9   52   22-73    165-242 (390)
121 PRK03824 hypA hydrogenase nick  70.3     1.8   4E-05   24.4   0.5   12   52-63     71-82  (135)
122 COG5216 Uncharacterized conser  69.9     4.2 9.1E-05   19.4   1.5   30   24-59     23-52  (67)
123 PF12760 Zn_Tnp_IS1595:  Transp  69.4     4.8  0.0001   18.0   1.7    9   78-86     36-44  (46)
124 PF01428 zf-AN1:  AN1-like Zinc  68.8     2.2 4.7E-05   18.9   0.4   14   78-91     12-25  (43)
125 PF08274 PhnA_Zn_Ribbon:  PhnA   68.5     2.7 5.9E-05   17.2   0.7    8   51-58     19-26  (30)
126 COG1198 PriA Primosomal protei  68.4     5.3 0.00011   29.1   2.4   49   24-88    436-484 (730)
127 PF13451 zf-trcl:  Probable zin  68.0     2.8 6.1E-05   19.3   0.7   16   77-92      2-17  (49)
128 KOG2593|consensus               67.8     8.9 0.00019   26.1   3.2   36   48-86    125-160 (436)
129 PF04780 DUF629:  Protein of un  67.1     4.8  0.0001   27.7   1.9   22   51-72     57-78  (466)
130 KOG2482|consensus               66.9      18 0.00038   24.1   4.3   66    8-73    129-217 (423)
131 PF14446 Prok-RING_1:  Prokaryo  66.7     5.3 0.00011   18.8   1.5   26   24-61      6-31  (54)
132 PF15269 zf-C2H2_7:  Zinc-finge  66.5     5.4 0.00012   17.9   1.4   22   80-101    21-42  (54)
133 TIGR00595 priA primosomal prot  64.4     8.3 0.00018   26.8   2.7   10   78-87    252-261 (505)
134 KOG4167|consensus               63.8     1.4 3.1E-05   31.7  -0.9   25   23-47    792-816 (907)
135 COG5236 Uncharacterized conser  62.9      15 0.00032   24.5   3.4   77   25-106   222-308 (493)
136 COG4338 Uncharacterized protei  60.1     4.4 9.5E-05   18.5   0.6   14   81-94     14-27  (54)
137 KOG1842|consensus               59.2     5.4 0.00012   27.2   1.1   22   52-73     16-37  (505)
138 PRK14873 primosome assembly pr  59.1     9.5 0.00021   27.6   2.3   11   78-88    421-431 (665)
139 COG4957 Predicted transcriptio  59.1     5.2 0.00011   22.7   0.8   22   80-104    77-98  (148)
140 PF04423 Rad50_zn_hook:  Rad50   58.8     4.3 9.3E-05   18.8   0.4   12   81-92     22-33  (54)
141 PF13824 zf-Mss51:  Zinc-finger  58.5      11 0.00024   17.8   1.8    8   51-58     14-21  (55)
142 PF12907 zf-met2:  Zinc-binding  58.2     8.5 0.00018   16.9   1.3   27   80-106     2-31  (40)
143 PF01363 FYVE:  FYVE zinc finge  58.1     7.7 0.00017   18.8   1.3    9   25-33     11-19  (69)
144 PF04780 DUF629:  Protein of un  57.8     7.6 0.00017   26.8   1.6   26   23-48     57-83  (466)
145 PF13453 zf-TFIIB:  Transcripti  57.5      11 0.00023   16.4   1.6   16   52-67     20-35  (41)
146 PRK00432 30S ribosomal protein  56.3     8.6 0.00019   17.7   1.2   12   78-89     36-47  (50)
147 PTZ00448 hypothetical protein;  56.2     8.8 0.00019   25.6   1.6   24   79-102   314-337 (373)
148 COG4888 Uncharacterized Zn rib  56.2       3 6.6E-05   22.3  -0.3   36   22-61     21-56  (104)
149 PRK05580 primosome assembly pr  55.5      14 0.00031   26.8   2.7   10   78-87    420-429 (679)
150 smart00064 FYVE Protein presen  55.0     9.1  0.0002   18.5   1.3   10   25-34     12-21  (68)
151 TIGR00416 sms DNA repair prote  54.9     9.7 0.00021   26.2   1.8   30   22-65      6-35  (454)
152 COG1675 TFA1 Transcription ini  54.6      23  0.0005   21.1   3.1    8   80-87    133-140 (176)
153 TIGR00100 hypA hydrogenase nic  54.5     7.3 0.00016   21.3   1.0   11   52-62     71-81  (115)
154 PF10276 zf-CHCC:  Zinc-finger   54.4     7.1 0.00015   17.1   0.7   12   78-89     28-39  (40)
155 PF07282 OrfB_Zn_ribbon:  Putat  54.2      25 0.00054   16.9   3.0   13   77-89     44-56  (69)
156 KOG1280|consensus               53.0      21 0.00045   23.8   2.9   23   51-73     79-101 (381)
157 PRK12380 hydrogenase nickel in  52.6     8.7 0.00019   21.0   1.1   10   52-61     71-80  (113)
158 smart00440 ZnF_C2C2 C2C2 Zinc   52.1     1.6 3.4E-05   19.1  -1.5    9   80-88     29-37  (40)
159 cd00065 FYVE FYVE domain; Zinc  51.7      15 0.00032   16.9   1.7   10   26-35      5-14  (57)
160 COG3091 SprT Zn-dependent meta  51.4     7.5 0.00016   22.5   0.7   34   49-87    115-148 (156)
161 PF14787 zf-CCHC_5:  GAG-polypr  51.4     5.5 0.00012   17.0   0.1   16   81-96      4-19  (36)
162 KOG2923|consensus               51.1      16 0.00034   17.9   1.6   29   24-58     23-51  (67)
163 COG1655 Uncharacterized protei  50.9     3.4 7.4E-05   25.6  -0.7   25   20-44     16-40  (267)
164 PF15616 TerY-C:  TerY-C metal   49.7     2.8 6.1E-05   23.6  -1.1   14   76-89    102-115 (131)
165 PRK11823 DNA repair protein Ra  49.6      13 0.00029   25.4   1.8   29   22-64      6-34  (446)
166 PLN02748 tRNA dimethylallyltra  49.6      13 0.00029   25.7   1.7   26   78-103   417-443 (468)
167 PF10083 DUF2321:  Uncharacteri  48.7     3.3 7.2E-05   24.0  -1.0   17   77-93     66-82  (158)
168 PF07975 C1_4:  TFIIH C1-like d  48.5      16 0.00034   17.0   1.4   16   51-66     21-36  (51)
169 TIGR00627 tfb4 transcription f  47.6      20 0.00042   23.1   2.2   25   51-89    255-279 (279)
170 cd01121 Sms Sms (bacterial rad  47.2      18  0.0004   24.2   2.1   10   24-33      1-10  (372)
171 COG3677 Transposase and inacti  46.5      11 0.00024   21.2   0.9   15   77-91     51-65  (129)
172 COG1326 Uncharacterized archae  46.5      37  0.0008   20.7   3.0   11   51-61     30-40  (201)
173 KOG0717|consensus               46.4      14  0.0003   25.6   1.4   22   80-101   293-314 (508)
174 PF14311 DUF4379:  Domain of un  46.4      15 0.00033   17.0   1.3   10   52-61     29-38  (55)
175 KOG2807|consensus               45.5      43 0.00094   22.2   3.4   24   80-103   346-369 (378)
176 PRK00420 hypothetical protein;  45.5      20 0.00043   19.7   1.7   28   24-62     24-51  (112)
177 PRK04023 DNA polymerase II lar  44.4      29 0.00062   26.7   2.8    9   24-32    627-635 (1121)
178 KOG4118|consensus               44.4     9.5 0.00021   18.7   0.4   27   80-106    39-65  (74)
179 PLN02294 cytochrome c oxidase   44.0      15 0.00033   21.7   1.2   18   73-91    136-153 (174)
180 PRK00564 hypA hydrogenase nick  43.8      13 0.00028   20.4   0.9   12   52-63     72-83  (117)
181 COG2331 Uncharacterized protei  43.8      12 0.00026   19.0   0.7   10   24-33     13-22  (82)
182 COG1773 Rubredoxin [Energy pro  42.9      12 0.00026   17.7   0.6   12   79-90      3-14  (55)
183 PHA02998 RNA polymerase subuni  42.9     4.5 9.7E-05   24.1  -1.0   12   80-91    172-183 (195)
184 PF07503 zf-HYPF:  HypF finger;  42.7      16 0.00036   15.4   0.9   13   78-90     20-32  (35)
185 PF08209 Sgf11:  Sgf11 (transcr  42.5      15 0.00032   15.4   0.8   21   79-100     4-24  (33)
186 COG5112 UFD2 U1-like Zn-finger  41.6      15 0.00033   19.9   0.9   22   80-101    56-77  (126)
187 COG2879 Uncharacterized small   40.6      33 0.00072   16.7   1.9   18   90-107    23-40  (65)
188 PF02891 zf-MIZ:  MIZ/SP-RING z  39.7      14 0.00031   16.9   0.5    8   24-31     42-49  (50)
189 PF11672 DUF3268:  Protein of u  39.4      16 0.00035   19.7   0.8   10   23-32      2-11  (102)
190 COG3357 Predicted transcriptio  39.2      15 0.00032   19.4   0.6   27   22-58     57-83  (97)
191 PF01155 HypA:  Hydrogenase exp  39.1      12 0.00026   20.4   0.3   13   52-64     71-83  (113)
192 PF08792 A2L_zn_ribbon:  A2L zi  38.7      18 0.00038   15.1   0.7   10   80-89     22-31  (33)
193 cd00924 Cyt_c_Oxidase_Vb Cytoc  37.5      23 0.00049   18.9   1.2   17   73-90     74-90  (97)
194 PRK03681 hypA hydrogenase nick  37.0      19 0.00041   19.7   0.9   10   52-61     71-80  (114)
195 PF06676 DUF1178:  Protein of u  36.9      26 0.00056   20.3   1.4   29    3-36     17-45  (148)
196 PF02591 DUF164:  Putative zinc  36.7      50  0.0011   15.3   2.2   11   77-87     44-54  (56)
197 KOG0978|consensus               36.6      13 0.00028   27.0   0.3   21   78-98    677-697 (698)
198 TIGR03831 YgiT_finger YgiT-typ  36.5      23 0.00049   15.3   1.0   14   22-35     31-44  (46)
199 PLN03238 probable histone acet  36.2      60  0.0013   21.1   3.0   22   51-72     48-69  (290)
200 COG4306 Uncharacterized protei  35.8      14 0.00031   20.7   0.3   15   77-91     66-80  (160)
201 COG1066 Sms Predicted ATP-depe  35.4      24 0.00051   24.3   1.2   27   22-62      6-32  (456)
202 PRK14892 putative transcriptio  35.3      19 0.00042   19.3   0.7   34   23-63     21-54  (99)
203 COG1998 RPS31 Ribosomal protei  35.1      42 0.00092   15.5   1.7   10   79-88     37-46  (51)
204 cd00730 rubredoxin Rubredoxin;  35.1      20 0.00044   16.5   0.7   12   24-35      2-13  (50)
205 PRK00762 hypA hydrogenase nick  34.5      18 0.00039   20.1   0.5   12   52-64     71-82  (124)
206 PF01286 XPA_N:  XPA protein N-  34.5      20 0.00042   15.2   0.5   12   80-91      4-15  (34)
207 KOG1088|consensus               34.4      25 0.00055   19.5   1.1   20   73-92     92-111 (124)
208 TIGR01206 lysW lysine biosynth  34.3      19 0.00042   16.9   0.6   11   80-90      3-13  (54)
209 COG3364 Zn-ribbon containing p  34.0      21 0.00047   19.2   0.7   15   22-36      1-15  (112)
210 COG1571 Predicted DNA-binding   33.9      35 0.00075   23.4   1.8   14   51-64    367-380 (421)
211 PF00301 Rubredoxin:  Rubredoxi  33.7      24 0.00052   16.1   0.8   11   80-90      2-12  (47)
212 PF07800 DUF1644:  Protein of u  33.4 1.1E+02  0.0023   18.1   3.8   53   51-105    80-134 (162)
213 KOG2071|consensus               33.3      35 0.00077   24.4   1.8   29   19-47    414-442 (579)
214 PF14354 Lar_restr_allev:  Rest  33.3      28 0.00061   16.3   1.1   11   23-33      3-13  (61)
215 PF04606 Ogr_Delta:  Ogr/Delta-  32.6      10 0.00022   17.1  -0.5   13   78-90     24-38  (47)
216 PRK12496 hypothetical protein;  32.6      31 0.00068   20.2   1.3   12   51-62    127-138 (164)
217 PF09845 DUF2072:  Zn-ribbon co  32.2      26 0.00056   19.8   0.9   15   23-37      1-15  (131)
218 PF06397 Desulfoferrod_N:  Desu  32.2      24 0.00052   15.1   0.6   12   78-89      5-16  (36)
219 COG1594 RPB9 DNA-directed RNA   32.0      12 0.00027   20.4  -0.3   11   80-90    101-111 (113)
220 COG0675 Transposase and inacti  31.3      65  0.0014   20.6   2.8   10   78-87    321-330 (364)
221 TIGR00143 hypF [NiFe] hydrogen  31.1     3.1 6.7E-05   30.2  -3.4   58   26-90     93-151 (711)
222 PTZ00303 phosphatidylinositol   30.8      39 0.00085   25.5   1.8   12   25-36    462-473 (1374)
223 KOG1994|consensus               30.6      31 0.00068   21.5   1.1   23   77-99    237-259 (268)
224 PF14634 zf-RING_5:  zinc-RING   30.2      58  0.0013   14.1   2.2   10   77-86     34-43  (44)
225 PF14803 Nudix_N_2:  Nudix N-te  30.0      31 0.00068   14.5   0.8    8   52-59     23-30  (34)
226 PRK03564 formate dehydrogenase  29.8      31 0.00068   22.6   1.1   11   23-33    187-197 (309)
227 PRK05978 hypothetical protein;  29.6      33 0.00071   19.9   1.1   10   81-90     54-63  (148)
228 PF01927 Mut7-C:  Mut7-C RNAse   29.5      42  0.0009   19.2   1.5   36   24-62     92-135 (147)
229 PF09855 DUF2082:  Nucleic-acid  29.4      24 0.00052   17.2   0.4    8   80-87      1-8   (64)
230 TIGR00686 phnA alkylphosphonat  29.4      29 0.00062   19.0   0.7   26   25-61      4-29  (109)
231 smart00647 IBR In Between Ring  29.0      44 0.00095   15.5   1.3   12   51-62     40-51  (64)
232 PRK05452 anaerobic nitric oxid  28.9      36 0.00078   23.7   1.3   17   48-64    422-438 (479)
233 PF14369 zf-RING_3:  zinc-finge  28.5      28 0.00061   14.6   0.5   10   25-34     23-32  (35)
234 PF09963 DUF2197:  Uncharacteri  28.5      24 0.00053   16.8   0.4    7   80-86     32-38  (56)
235 COG1579 Zn-ribbon protein, pos  28.4      58  0.0013   20.6   2.0   15   76-90    218-232 (239)
236 PF03966 Trm112p:  Trm112p-like  28.1      32 0.00069   16.7   0.8   18   73-90     47-64  (68)
237 PF14205 Cys_rich_KTR:  Cystein  28.1      26 0.00056   16.6   0.4   10   78-87     27-36  (55)
238 PF08271 TF_Zn_Ribbon:  TFIIB z  27.8      35 0.00075   14.9   0.8    8   81-88      2-9   (43)
239 COG5151 SSL1 RNA polymerase II  27.8      42  0.0009   22.2   1.4   25   78-102   387-411 (421)
240 COG4896 Uncharacterized protei  27.4      52  0.0011   16.0   1.4    7   52-58     32-38  (68)
241 PRK10220 hypothetical protein;  27.3      35 0.00077   18.7   0.9   27   25-62      5-31  (111)
242 PRK14714 DNA polymerase II lar  27.2      61  0.0013   25.8   2.3    9   24-32    668-676 (1337)
243 PF14255 Cys_rich_CPXG:  Cystei  26.5      35 0.00075   15.9   0.7   11   25-35      2-12  (52)
244 TIGR01384 TFS_arch transcripti  26.4      43 0.00092   17.7   1.1   26   25-62      2-27  (104)
245 PF01096 TFIIS_C:  Transcriptio  26.3      36 0.00077   14.6   0.7    9   80-88     29-37  (39)
246 COG3478 Predicted nucleic-acid  26.0      37 0.00081   16.7   0.7   10   79-88      4-13  (68)
247 PF14690 zf-ISL3:  zinc-finger   26.0      35 0.00076   14.9   0.6    9   79-87      2-10  (47)
248 KOG0402|consensus               25.9      42 0.00092   17.4   1.0    8   24-31     37-44  (92)
249 PF11290 DUF3090:  Protein of u  25.6 1.1E+02  0.0024   18.3   2.8   11   25-35    156-166 (171)
250 KOG3507|consensus               25.6      46 0.00099   16.0   1.0   11   79-89     37-47  (62)
251 TIGR03829 YokU_near_AblA uncha  25.3      51  0.0011   17.4   1.2   23   22-44     34-56  (89)
252 PF12773 DZR:  Double zinc ribb  24.7      47   0.001   14.8   1.0    8   52-59     30-37  (50)
253 PRK12722 transcriptional activ  24.7      61  0.0013   19.6   1.6   28   52-87    135-162 (187)
254 PTZ00043 cytochrome c oxidase   24.6      43 0.00094   21.0   1.0   31   21-54    179-209 (268)
255 PRK01343 zinc-binding protein;  24.2      45 0.00097   15.9   0.8   11   80-90     10-20  (57)
256 COG2956 Predicted N-acetylgluc  24.2 1.4E+02  0.0031   20.1   3.3   10   22-31    353-362 (389)
257 cd00974 DSRD Desulforedoxin (D  23.8      46   0.001   13.6   0.8   12   78-89      3-14  (34)
258 COG5188 PRP9 Splicing factor 3  23.8      30 0.00065   23.2   0.3   22   80-101   239-260 (470)
259 PLN03208 E3 ubiquitin-protein   23.6 1.8E+02  0.0038   17.9   3.4   54   22-91     17-80  (193)
260 PF01215 COX5B:  Cytochrome c o  23.2      38 0.00081   19.4   0.5   17   73-90    107-123 (136)
261 PF10537 WAC_Acf1_DNA_bd:  ATP-  23.2 1.4E+02   0.003   16.1   3.5   41   22-63      2-42  (102)
262 PF10263 SprT-like:  SprT-like   22.9      46   0.001   18.9   0.9   32   51-90    123-154 (157)
263 TIGR01562 FdhE formate dehydro  22.8      82  0.0018   20.7   2.0   13   47-59    206-218 (305)
264 PF09297 zf-NADH-PPase:  NADH p  22.8      34 0.00074   13.8   0.3   11   49-59     19-29  (32)
265 PRK08222 hydrogenase 4 subunit  22.7      67  0.0014   19.1   1.6   20   77-96    112-131 (181)
266 TIGR00319 desulf_FeS4 desulfof  22.7      51  0.0011   13.5   0.8   12   78-89      6-17  (34)
267 PRK12860 transcriptional activ  22.6      66  0.0014   19.5   1.5   27   52-86    135-161 (189)
268 PF03811 Zn_Tnp_IS1:  InsA N-te  22.0      34 0.00073   14.6   0.2    6   80-85     30-35  (36)
269 KOG2636|consensus               21.8      79  0.0017   22.1   1.8   27   18-44    396-423 (497)
270 PLN03239 histone acetyltransfe  21.8      93   0.002   20.9   2.1   25   77-101   104-128 (351)
271 smart00132 LIM Zinc-binding do  21.8      41 0.00089   13.5   0.4    9   80-88     28-36  (39)
272 PLN00104 MYST -like histone ac  21.7 1.1E+02  0.0023   21.5   2.4   25   77-101   196-220 (450)
273 KOG2857|consensus               21.7      56  0.0012   18.8   1.0   22   23-44     17-38  (157)
274 TIGR03847 conserved hypothetic  21.6 1.5E+02  0.0033   17.8   2.8   11   25-35    158-168 (177)
275 KOG0696|consensus               21.4      26 0.00057   24.3  -0.3   59   20-87     70-129 (683)
276 COG4391 Uncharacterized protei  21.4      66  0.0014   15.6   1.1   13   78-90     47-59  (62)
277 TIGR00515 accD acetyl-CoA carb  21.3      74  0.0016   20.6   1.6   34   24-66     27-60  (285)
278 PF05876 Terminase_GpA:  Phage   21.3      59  0.0013   23.2   1.3   40   52-91    201-241 (557)
279 PHA02942 putative transposase;  20.9   1E+02  0.0023   20.8   2.3   14   77-90    340-353 (383)
280 KOG3214|consensus               20.8      23  0.0005   19.0  -0.6   13   52-64     48-60  (109)
281 PF13821 DUF4187:  Domain of un  20.8      76  0.0017   14.9   1.2   21   77-97     25-45  (55)
282 PTZ00064 histone acetyltransfe  20.8 1.3E+02  0.0028   21.5   2.7   25   77-101   278-302 (552)
283 PF05129 Elf1:  Transcription e  20.5      46   0.001   17.0   0.5   10   77-86     20-29  (81)
284 PRK06260 threonine synthase; V  20.4      94   0.002   21.0   2.0   27   24-62      4-30  (397)
285 PRK04351 hypothetical protein;  20.3      69  0.0015   18.5   1.2   32   51-90    112-143 (149)
286 PRK14138 NAD-dependent deacety  20.2 1.7E+02  0.0038   18.3   3.1   13   52-64    120-132 (244)
287 KOG4602|consensus               20.1      36 0.00079   21.7   0.1   10   51-60    268-277 (318)
288 PF03884 DUF329:  Domain of unk  20.1      50  0.0011   15.8   0.5   12   80-91      3-14  (57)

No 1  
>KOG2462|consensus
Probab=99.93  E-value=2.8e-26  Score=137.01  Aligned_cols=98  Identities=40%  Similarity=0.686  Sum_probs=55.0

Q ss_pred             cchhcHHHHHHHHHHHhcCCCCccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCChHHHHHHHHhcCCCCcee
Q psy10278          2 NFYADIKCLKKHIREVHKRLKPFQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGDHNVLRKHVQRHMPVKKYQ   81 (110)
Q Consensus         2 ~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~   81 (110)
                      |.|.+...|+-|++ +|.  .+..|.+||+.|..+=.|+.|+++|+||+||.|+.|++.|...++|..|+++|.+.++|+
T Consensus       169 K~YvSmpALkMHir-TH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~q  245 (279)
T KOG2462|consen  169 KVYVSMPALKMHIR-THT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQ  245 (279)
T ss_pred             ceeeehHHHhhHhh-ccC--CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCcccc
Confidence            44555555555553 343  345555555555555555555555555555555555555555555555555555555555


Q ss_pred             ccCCCcccccHHHHHhhhhhc
Q psy10278         82 CTFCSYSCTERFRLKDHTLAK  102 (110)
Q Consensus        82 C~~C~~~f~~~~~l~~H~~~~  102 (110)
                      |..|+|+|+..+.|.+|..+.
T Consensus       246 C~~C~KsFsl~SyLnKH~ES~  266 (279)
T KOG2462|consen  246 CPRCGKSFALKSYLNKHSESA  266 (279)
T ss_pred             CcchhhHHHHHHHHHHhhhhc
Confidence            555555555555555555443


No 2  
>KOG2462|consensus
Probab=99.93  E-value=3.8e-26  Score=136.45  Aligned_cols=103  Identities=25%  Similarity=0.520  Sum_probs=94.5

Q ss_pred             cchhcHHHHHHHHHHHhc---CCCCccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCChHHHHHHHHhcCCCC
Q psy10278          2 NFYADIKCLKKHIREVHK---RLKPFQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGDHNVLRKHVQRHMPVK   78 (110)
Q Consensus         2 ~~f~~~~~l~~h~~~~~~---~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~   78 (110)
                      |.|++...|.+|.+ .|-   ..+.+.|+.|++.+.+-..|+.|+++|.  .+.+|.+||+.|..+.-|+.|+++|+||+
T Consensus       138 k~ysT~snLsrHkQ-~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEK  214 (279)
T KOG2462|consen  138 KSYSTSSNLSRHKQ-THRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEK  214 (279)
T ss_pred             cccccccccchhhc-ccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcccccccCCC
Confidence            67889999999995 664   3456899999999999999999999997  57899999999999999999999999999


Q ss_pred             ceeccCCCcccccHHHHHhhhhhcCCCCC
Q psy10278         79 KYQCTFCSYSCTERFRLKDHTLAKHNPGT  107 (110)
Q Consensus        79 p~~C~~C~~~f~~~~~l~~H~~~~~~~~~  107 (110)
                      ||.|+.|+++|+.+++|+.||.+|.+.+.
T Consensus       215 PF~C~hC~kAFADRSNLRAHmQTHS~~K~  243 (279)
T KOG2462|consen  215 PFSCPHCGKAFADRSNLRAHMQTHSDVKK  243 (279)
T ss_pred             CccCCcccchhcchHHHHHHHHhhcCCcc
Confidence            99999999999999999999999998764


No 3  
>KOG1074|consensus
Probab=99.71  E-value=1.6e-18  Score=116.40  Aligned_cols=55  Identities=22%  Similarity=0.417  Sum_probs=51.0

Q ss_pred             ceeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCcccccHHHHHhhhhhcCCC
Q psy10278         51 PYACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSYSCTERFRLKDHTLAKHNP  105 (110)
Q Consensus        51 ~~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~~f~~~~~l~~H~~~~~~~  105 (110)
                      +..|.+|.+...=.+.|+-|.++|+|||||+|..||++|+.+.+|+.|+.+|-..
T Consensus       605 PNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~  659 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAK  659 (958)
T ss_pred             ccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccC
Confidence            4689999999999999999999999999999999999999999999999888643


No 4  
>KOG3576|consensus
Probab=99.68  E-value=3.9e-18  Score=98.67  Aligned_cols=102  Identities=25%  Similarity=0.473  Sum_probs=58.2

Q ss_pred             cchhcHHHHHHHHHHHhcCCCCccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCChHHHHHHHHhcC------
Q psy10278          2 NFYADIKCLKKHIREVHKRLKPFQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGDHNVLRKHVQRHM------   75 (110)
Q Consensus         2 ~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~------   75 (110)
                      |.|.--.-|.+|++ .|...+.+.|..||+.|.....|++|+++|+|..||.|..|++.|.+.-.|..|++.-+      
T Consensus       125 K~F~lQRmlnrh~k-ch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~kvhgv~~~y  203 (267)
T KOG3576|consen  125 KKFGLQRMLNRHLK-CHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQY  203 (267)
T ss_pred             hhhhHHHHHHHHhh-hccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHHHcCchHHH
Confidence            45555555556662 45555555666666666666666666666666666666666666666655655555221      


Q ss_pred             -----CCCceeccCCCcccccHHHHHhhhhhcCC
Q psy10278         76 -----PVKKYQCTFCSYSCTERFRLKDHTLAKHN  104 (110)
Q Consensus        76 -----~~~p~~C~~C~~~f~~~~~l~~H~~~~~~  104 (110)
                           .++-|.|..||.+-.....+..|++.+|.
T Consensus       204 aykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp  237 (267)
T KOG3576|consen  204 AYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHP  237 (267)
T ss_pred             HHHHhhhheeeecccCCCCCChhHHHHHHHhcCC
Confidence                 13335666666665555566666655554


No 5  
>KOG3623|consensus
Probab=99.67  E-value=1.1e-17  Score=111.44  Aligned_cols=82  Identities=21%  Similarity=0.408  Sum_probs=77.7

Q ss_pred             cCCCCccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCcccccHHHHHhh
Q psy10278         19 KRLKPFQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSYSCTERFRLKDH   98 (110)
Q Consensus        19 ~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~~f~~~~~l~~H   98 (110)
                      ..+-.|.|..|+++|.-.++|.+|...|+|.+||.|.+|.+.|..+-.|..|.+.|.||+||.|.+|+|.|+...++.+|
T Consensus       890 te~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQH  969 (1007)
T KOG3623|consen  890 TEDGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQH  969 (1007)
T ss_pred             CccccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhh
Confidence            34557999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hh
Q psy10278         99 TL  100 (110)
Q Consensus        99 ~~  100 (110)
                      |.
T Consensus       970 MN  971 (1007)
T KOG3623|consen  970 MN  971 (1007)
T ss_pred             hc
Confidence            85


No 6  
>KOG3576|consensus
Probab=99.66  E-value=3.7e-17  Score=94.63  Aligned_cols=86  Identities=29%  Similarity=0.556  Sum_probs=80.5

Q ss_pred             CCCCccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCcccccHHHHHhhh
Q psy10278         20 RLKPFQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSYSCTERFRLKDHT   99 (110)
Q Consensus        20 ~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~~f~~~~~l~~H~   99 (110)
                      +...+.|.+|++.|.....|.+|++.|...+.+.|..||+.|...-.|..|.++|+|.+||+|..|+++|+++.+|..|+
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl  193 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHL  193 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHH
Confidence            44558999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhcCCC
Q psy10278        100 LAKHNP  105 (110)
Q Consensus       100 ~~~~~~  105 (110)
                      +.-|+-
T Consensus       194 ~kvhgv  199 (267)
T KOG3576|consen  194 KKVHGV  199 (267)
T ss_pred             HHHcCc
Confidence            977763


No 7  
>KOG3623|consensus
Probab=99.65  E-value=9e-17  Score=107.15  Aligned_cols=101  Identities=23%  Similarity=0.462  Sum_probs=87.7

Q ss_pred             cchhcHHHHHHHHHHHhc-CCCCccCCcccccccCchhHHHHHHhcCC-------------CCceeCCCCCCCcCChHHH
Q psy10278          2 NFYADIKCLKKHIREVHK-RLKPFQCPVCGFTTGRKATLQLHVRQHTR-------------EKPYACPTCEFKTGDHNVL   67 (110)
Q Consensus         2 ~~f~~~~~l~~h~~~~~~-~~~~~~C~~c~~~~~~~~~l~~h~~~~~~-------------~~~~~c~~c~~~~~~~~~l   67 (110)
                      +.|.+...|+.|+...|. .+..|.|..|..+|.....|.+|+..|-.             .+.|+|..|++.|..+-.|
T Consensus       218 rgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAFKfKHHL  297 (1007)
T KOG3623|consen  218 RGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAFKFKHHL  297 (1007)
T ss_pred             HHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchhhhhHHHH
Confidence            356667789999976665 45559999999999999999999988743             2348999999999999999


Q ss_pred             HHHHHhcCCCCceeccCCCcccccHHHHHhhhhhc
Q psy10278         68 RKHVQRHMPVKKYQCTFCSYSCTERFRLKDHTLAK  102 (110)
Q Consensus        68 ~~h~~~h~~~~p~~C~~C~~~f~~~~~l~~H~~~~  102 (110)
                      ..|+++|.||+||.|+-|+|.|+...++..||.+.
T Consensus       298 KEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmSSK  332 (1007)
T KOG3623|consen  298 KEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMSSK  332 (1007)
T ss_pred             HhhheeecCCCCcCCcccccccccCCccccccccc
Confidence            99999999999999999999999999999998654


No 8  
>KOG1074|consensus
Probab=99.62  E-value=5.1e-16  Score=104.68  Aligned_cols=58  Identities=24%  Similarity=0.359  Sum_probs=54.0

Q ss_pred             eeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCcccccHHHHHhhhhhcCCCCCCC
Q psy10278         52 YACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSYSCTERFRLKDHTLAKHNPGTDG  109 (110)
Q Consensus        52 ~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~  109 (110)
                      ..|.+|++.|..++.|..|+++|++++||.|..|++.|+.+.+|+.||..|...++..
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~w~q~~s  937 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHMWVQPPS  937 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhccccccCCCc
Confidence            5799999999999999999999999999999999999999999999999988766544


No 9  
>KOG3608|consensus
Probab=99.55  E-value=1.3e-14  Score=90.19  Aligned_cols=102  Identities=28%  Similarity=0.565  Sum_probs=80.9

Q ss_pred             cchhcHHHHHHHHHHHhcCCCCccCCcccccccCchhHHHHHHhcCC----------------------------CCcee
Q psy10278          2 NFYADIKCLKKHIREVHKRLKPFQCPVCGFTTGRKATLQLHVRQHTR----------------------------EKPYA   53 (110)
Q Consensus         2 ~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~----------------------------~~~~~   53 (110)
                      +.|.++..|..|++ .|++++..-|+.|+.-|.+...|..|.+..+.                            ...|.
T Consensus       187 ~~~~~k~~LreH~r-~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~yk  265 (467)
T KOG3608|consen  187 KHMGNKYRLREHIR-THSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNCYK  265 (467)
T ss_pred             hhhccHHHHHHHHH-hcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhccc
Confidence            56777788888884 67877777777777777777777777654321                            13588


Q ss_pred             CCCCCCCcCChHHHHHHHH-hcCCCCceeccCCCcccccHHHHHhhhhhcCC
Q psy10278         54 CPTCEFKTGDHNVLRKHVQ-RHMPVKKYQCTFCSYSCTERFRLKDHTLAKHN  104 (110)
Q Consensus        54 c~~c~~~~~~~~~l~~h~~-~h~~~~p~~C~~C~~~f~~~~~l~~H~~~~~~  104 (110)
                      |+.|+-.....+.|..|++ .|...+||+|..|.+.|...+.|.+|..+|..
T Consensus       266 CplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS~  317 (467)
T KOG3608|consen  266 CPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHSK  317 (467)
T ss_pred             ccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhccc
Confidence            9999999999999999999 68889999999999999999999999987763


No 10 
>KOG3608|consensus
Probab=99.53  E-value=4.2e-14  Score=88.03  Aligned_cols=101  Identities=33%  Similarity=0.675  Sum_probs=84.5

Q ss_pred             cchhcHHHHHHHHHHHhcCCCCccCCcccccccCchhHHHHHH-hcCCCCceeCCCCCCCcCChHHHHHHHHhcCCCCce
Q psy10278          2 NFYADIKCLKKHIREVHKRLKPFQCPVCGFTTGRKATLQLHVR-QHTREKPYACPTCEFKTGDHNVLRKHVQRHMPVKKY   80 (110)
Q Consensus         2 ~~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~-~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~p~   80 (110)
                      |.|.+...|..|+. .|-.  -|+|+.|.++....++|..|++ .|...+|++|..|+..+...+.|..|..+|. +..|
T Consensus       245 KrFaTeklL~~Hv~-rHvn--~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y  320 (467)
T KOG3608|consen  245 KRFATEKLLKSHVV-RHVN--CYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVY  320 (467)
T ss_pred             HHHhHHHHHHHHHH-Hhhh--cccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccce
Confidence            67899999999984 4543  5899999999999999999998 5778899999999999999999999999887 5668


Q ss_pred             eccC--CCcccccHHHHHhhhhhcCCCC
Q psy10278         81 QCTF--CSYSCTERFRLKDHTLAKHNPG  106 (110)
Q Consensus        81 ~C~~--C~~~f~~~~~l~~H~~~~~~~~  106 (110)
                      .|..  |...|.+..+++.|++.+|..+
T Consensus       321 ~C~h~~C~~s~r~~~q~~~H~~evhEg~  348 (467)
T KOG3608|consen  321 QCEHPDCHYSVRTYTQMRRHFLEVHEGN  348 (467)
T ss_pred             ecCCCCCcHHHHHHHHHHHHHHHhccCC
Confidence            8866  8888888888888888777433


No 11 
>PHA00733 hypothetical protein
Probab=99.43  E-value=2.2e-13  Score=75.25  Aligned_cols=84  Identities=20%  Similarity=0.294  Sum_probs=69.6

Q ss_pred             CCCCccCCcccccccCchhHHHH--HH---hcCCCCceeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCcccccHHH
Q psy10278         20 RLKPFQCPVCGFTTGRKATLQLH--VR---QHTREKPYACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSYSCTERFR   94 (110)
Q Consensus        20 ~~~~~~C~~c~~~~~~~~~l~~h--~~---~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~~f~~~~~   94 (110)
                      ..+++.|.+|...|.....+..+  +.   .+.+.++|.|..|++.|.....|..|+..+  +.++.|..|++.|.....
T Consensus        37 ~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~s  114 (128)
T PHA00733         37 EQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDS  114 (128)
T ss_pred             hhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHH
Confidence            35568999999888877666655  11   233477999999999999999999999976  467999999999999999


Q ss_pred             HHhhhhhcCCC
Q psy10278         95 LKDHTLAKHNP  105 (110)
Q Consensus        95 l~~H~~~~~~~  105 (110)
                      |..|+...|+-
T Consensus       115 L~~H~~~~h~~  125 (128)
T PHA00733        115 TLDHVCKKHNI  125 (128)
T ss_pred             HHHHHHHhcCc
Confidence            99999988863


No 12 
>PHA02768 hypothetical protein; Provisional
Probab=99.18  E-value=1.1e-11  Score=57.88  Aligned_cols=44  Identities=16%  Similarity=0.301  Sum_probs=34.0

Q ss_pred             ceeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCcccccHHHHH
Q psy10278         51 PYACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSYSCTERFRLK   96 (110)
Q Consensus        51 ~~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~~f~~~~~l~   96 (110)
                      .|.|+.||+.|...+.|..|++.|+  +|++|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            3678888888888888888888877  6788888888887666553


No 13 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.09  E-value=7.9e-10  Score=73.76  Aligned_cols=91  Identities=22%  Similarity=0.421  Sum_probs=64.4

Q ss_pred             HHHHHHHHHHHhcCCCCccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCC----------hHHHHHHHHhcCC
Q psy10278          7 IKCLKKHIREVHKRLKPFQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGD----------HNVLRKHVQRHMP   76 (110)
Q Consensus         7 ~~~l~~h~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~----------~~~l~~h~~~h~~   76 (110)
                      ...|..|+. .+.  .++.|+ |+..+ ....|..|+..|-+.+++.|+.|+..+..          ...|..|.... +
T Consensus       465 ~s~LekH~~-~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G  538 (567)
T PLN03086        465 QGEMEKHMK-VFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-G  538 (567)
T ss_pred             hHHHHHHHH-hcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-C
Confidence            567788885 443  578888 88654 45778888777888888888888877741          34677787774 7


Q ss_pred             CCceeccCCCcccccHHHHHhhhhhcCC
Q psy10278         77 VKKYQCTFCSYSCTERFRLKDHTLAKHN  104 (110)
Q Consensus        77 ~~p~~C~~C~~~f~~~~~l~~H~~~~~~  104 (110)
                      .+++.|..|++.+..+ .+..|+...|.
T Consensus       539 ~rt~~C~~Cgk~Vrlr-dm~~H~~~~h~  565 (567)
T PLN03086        539 SRTAPCDSCGRSVMLK-EMDIHQIAVHQ  565 (567)
T ss_pred             CcceEccccCCeeeeh-hHHHHHHHhhc
Confidence            7888888888877654 56667665543


No 14 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.05  E-value=1.9e-10  Score=46.33  Aligned_cols=26  Identities=35%  Similarity=0.797  Sum_probs=21.6

Q ss_pred             HHHHHHHhcCCCCceeccCCCccccc
Q psy10278         66 VLRKHVQRHMPVKKYQCTFCSYSCTE   91 (110)
Q Consensus        66 ~l~~h~~~h~~~~p~~C~~C~~~f~~   91 (110)
                      +|..|++.|++++||.|+.|++.|..
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            46788889999999999999988863


No 15 
>PHA00733 hypothetical protein
Probab=99.01  E-value=1.3e-09  Score=60.31  Aligned_cols=64  Identities=25%  Similarity=0.529  Sum_probs=52.8

Q ss_pred             HHHHHHHHHhcCCCCccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCChHHHHHHHHhcCC
Q psy10278          9 CLKKHIREVHKRLKPFQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGDHNVLRKHVQRHMP   76 (110)
Q Consensus         9 ~l~~h~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~   76 (110)
                      .|..|+  .+.+++||.|+.|++.|.+...|..|+..+  ..++.|..|++.|.....|..|+...++
T Consensus        61 ~l~~~~--~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         61 YLYKLL--TSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             HHHhhc--ccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            344454  245688999999999999999999999865  3478999999999999999999886553


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=99.01  E-value=1.4e-10  Score=54.25  Aligned_cols=44  Identities=18%  Similarity=0.451  Sum_probs=39.4

Q ss_pred             CccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCChHHHH
Q psy10278         23 PFQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGDHNVLR   68 (110)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~   68 (110)
                      .|.|+.||+.|.....|..|++.|+  +++.|..|++.|...+.|+
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            4899999999999999999999998  6899999999998776654


No 17 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.96  E-value=2.6e-09  Score=71.38  Aligned_cols=77  Identities=18%  Similarity=0.487  Sum_probs=64.1

Q ss_pred             CCCccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCcccc----------
Q psy10278         21 LKPFQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSYSCT----------   90 (110)
Q Consensus        21 ~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~~f~----------   90 (110)
                      +..+.|+.|++.|. ...+..|+..++  +++.|+ |+..+ ....|..|+..|..++|+.|..|++.|.          
T Consensus       451 ~~H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d  525 (567)
T PLN03086        451 KNHVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRD  525 (567)
T ss_pred             ccCccCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhh
Confidence            34578999999996 577999999874  789999 99755 6689999999999999999999999985          


Q ss_pred             cHHHHHhhhhhc
Q psy10278         91 ERFRLKDHTLAK  102 (110)
Q Consensus        91 ~~~~l~~H~~~~  102 (110)
                      ..+.|..|....
T Consensus       526 ~~s~Lt~HE~~C  537 (567)
T PLN03086        526 RLRGMSEHESIC  537 (567)
T ss_pred             hhhhHHHHHHhc
Confidence            245788888764


No 18 
>KOG3993|consensus
Probab=98.86  E-value=3.8e-10  Score=72.07  Aligned_cols=81  Identities=20%  Similarity=0.387  Sum_probs=55.9

Q ss_pred             ccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCChHHHHHHHHhcC----------------------------
Q psy10278         24 FQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGDHNVLRKHVQRHM----------------------------   75 (110)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~----------------------------   75 (110)
                      |.|.+|...|.....|.+|.-.-.....|.|+.|++.|.=..+|..|.+=|.                            
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~r  347 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAER  347 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccc
Confidence            6666666666666666666443333345666666666666666666665441                            


Q ss_pred             -----CCCceeccCCCcccccHHHHHhhhhhcCC
Q psy10278         76 -----PVKKYQCTFCSYSCTERFRLKDHTLAKHN  104 (110)
Q Consensus        76 -----~~~p~~C~~C~~~f~~~~~l~~H~~~~~~  104 (110)
                           .+..|.|..|++.|.....|++|+.+|+.
T Consensus       348 sg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~  381 (500)
T KOG3993|consen  348 SGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQR  381 (500)
T ss_pred             cCCcccCceeecHHhhhhhHHHHHHHHhHHhhhc
Confidence                 12359999999999999999999999885


No 19 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.81  E-value=4.2e-09  Score=42.36  Aligned_cols=25  Identities=40%  Similarity=0.972  Sum_probs=18.8

Q ss_pred             HHHHHHHHHhcCCCCccCCccccccc
Q psy10278          9 CLKKHIREVHKRLKPFQCPVCGFTTG   34 (110)
Q Consensus         9 ~l~~h~~~~~~~~~~~~C~~c~~~~~   34 (110)
                      +|..|++ .|.+++||.|+.|++.|.
T Consensus         1 ~l~~H~~-~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMR-THTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHH-HHSSSSSEEESSSSEEES
T ss_pred             CHHHHhh-hcCCCCCCCCCCCcCeeC
Confidence            4677885 688888888888887775


No 20 
>PHA00616 hypothetical protein
Probab=98.69  E-value=7.7e-09  Score=46.22  Aligned_cols=31  Identities=16%  Similarity=0.222  Sum_probs=16.6

Q ss_pred             eeCCCCCCCcCChHHHHHHHHhcCCCCceec
Q psy10278         52 YACPTCEFKTGDHNVLRKHVQRHMPVKKYQC   82 (110)
Q Consensus        52 ~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C   82 (110)
                      |.|+.||+.|...+.+..|++.|+++.|+.|
T Consensus         2 YqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~   32 (44)
T PHA00616          2 YQCLRCGGIFRKKKEVIEHLLSVHKQNKLTL   32 (44)
T ss_pred             CccchhhHHHhhHHHHHHHHHHhcCCCccce
Confidence            4555555555555555555555555555544


No 21 
>PHA00616 hypothetical protein
Probab=98.64  E-value=1.4e-08  Score=45.43  Aligned_cols=33  Identities=18%  Similarity=0.313  Sum_probs=30.7

Q ss_pred             CccCCcccccccCchhHHHHHHhcCCCCceeCC
Q psy10278         23 PFQCPVCGFTTGRKATLQLHVRQHTREKPYACP   55 (110)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~   55 (110)
                      ||+|+.||+.|...+.+..|++.|++++++.|.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            689999999999999999999999999988775


No 22 
>PHA00732 hypothetical protein
Probab=98.54  E-value=1.3e-07  Score=48.08  Aligned_cols=45  Identities=40%  Similarity=0.775  Sum_probs=28.2

Q ss_pred             CccCCcccccccCchhHHHHHHh-cCCCCceeCCCCCCCcCChHHHHHHHHh
Q psy10278         23 PFQCPVCGFTTGRKATLQLHVRQ-HTREKPYACPTCEFKTGDHNVLRKHVQR   73 (110)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~-~~~~~~~~c~~c~~~~~~~~~l~~h~~~   73 (110)
                      ||.|..|++.|.+...|..|++. |.+   +.|+.|++.|.   .+..|...
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~---~l~~H~~~   46 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYR---RLNQHFYS   46 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeC---Chhhhhcc
Confidence            46677777777777777777663 432   36777777665   34455543


No 23 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.38  E-value=1.1e-06  Score=41.46  Aligned_cols=49  Identities=29%  Similarity=0.510  Sum_probs=20.8

Q ss_pred             eeCCCCCCCcCChHHHHHHHHh-cCC-CCceeccCCCcccccHHHHHhhhhhcC
Q psy10278         52 YACPTCEFKTGDHNVLRKHVQR-HMP-VKKYQCTFCSYSCTERFRLKDHTLAKH  103 (110)
Q Consensus        52 ~~c~~c~~~~~~~~~l~~h~~~-h~~-~~p~~C~~C~~~f~~~~~l~~H~~~~~  103 (110)
                      |.||.|++ ......|..|... |.. .+.+.|+.|...+.  .+|..|+...|
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            34445544 2233344444442 222 12345555544333  24555555444


No 24 
>KOG3993|consensus
Probab=98.37  E-value=1.7e-07  Score=60.28  Aligned_cols=71  Identities=30%  Similarity=0.416  Sum_probs=56.6

Q ss_pred             chhcHHHHHHHHHHHhcCCCCccCCcccccccCchhHHHHHHhcCC---------------------------------C
Q psy10278          3 FYADIKCLKKHIREVHKRLKPFQCPVCGFTTGRKATLQLHVRQHTR---------------------------------E   49 (110)
Q Consensus         3 ~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~---------------------------------~   49 (110)
                      .|.+...|.+|. -..+-..-|.|+.|++.|.-..+|..|.+.|-.                                 .
T Consensus       276 kYeD~F~LAQHr-C~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~  354 (500)
T KOG3993|consen  276 KYEDAFALAQHR-CPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSS  354 (500)
T ss_pred             hhhhHHHHhhcc-CCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccC
Confidence            477778888886 334444459999999999999999999887721                                 1


Q ss_pred             CceeCCCCCCCcCChHHHHHHHHhc
Q psy10278         50 KPYACPTCEFKTGDHNVLRKHVQRH   74 (110)
Q Consensus        50 ~~~~c~~c~~~~~~~~~l~~h~~~h   74 (110)
                      ..|.|..|++.|.....|..|+.+|
T Consensus       355 gi~~C~~C~KkFrRqAYLrKHqlth  379 (500)
T KOG3993|consen  355 GIFSCHTCGKKFRRQAYLRKHQLTH  379 (500)
T ss_pred             ceeecHHhhhhhHHHHHHHHhHHhh
Confidence            2488999999999999999997766


No 25 
>PHA00732 hypothetical protein
Probab=98.34  E-value=5.5e-07  Score=45.76  Aligned_cols=47  Identities=30%  Similarity=0.639  Sum_probs=37.5

Q ss_pred             ceeCCCCCCCcCChHHHHHHHHh-cCCCCceeccCCCcccccHHHHHhhhhhcC
Q psy10278         51 PYACPTCEFKTGDHNVLRKHVQR-HMPVKKYQCTFCSYSCTERFRLKDHTLAKH  103 (110)
Q Consensus        51 ~~~c~~c~~~~~~~~~l~~h~~~-h~~~~p~~C~~C~~~f~~~~~l~~H~~~~~  103 (110)
                      ||.|..|++.|.....|..|++. |.   ++.|+.|++.|.+   +..|..+..
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~~---l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYRR---LNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeCC---hhhhhcccC
Confidence            47899999999999999999984 54   3589999999984   667775544


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.32  E-value=4.1e-07  Score=35.33  Aligned_cols=22  Identities=32%  Similarity=0.674  Sum_probs=18.5

Q ss_pred             eeccCCCcccccHHHHHhhhhh
Q psy10278         80 YQCTFCSYSCTERFRLKDHTLA  101 (110)
Q Consensus        80 ~~C~~C~~~f~~~~~l~~H~~~  101 (110)
                      |.|+.|++.|.....|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            5788888888888888888876


No 27 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.28  E-value=8.2e-07  Score=35.85  Aligned_cols=26  Identities=15%  Similarity=0.450  Sum_probs=22.5

Q ss_pred             ceeccCCCcccccHHHHHhhhhhcCC
Q psy10278         79 KYQCTFCSYSCTERFRLKDHTLAKHN  104 (110)
Q Consensus        79 p~~C~~C~~~f~~~~~l~~H~~~~~~  104 (110)
                      ||.|..|++.|.....|..|++.++.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            68899999999999999999987764


No 28 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.28  E-value=2.3e-06  Score=40.43  Aligned_cols=50  Identities=30%  Similarity=0.649  Sum_probs=38.0

Q ss_pred             CccCCcccccccCchhHHHHHH-hcCCC-CceeCCCCCCCcCChHHHHHHHHhcC
Q psy10278         23 PFQCPVCGFTTGRKATLQLHVR-QHTRE-KPYACPTCEFKTGDHNVLRKHVQRHM   75 (110)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~-~~~~~-~~~~c~~c~~~~~~~~~l~~h~~~h~   75 (110)
                      .|.||.|++ ..+...|..|.. .|..+ +.+.||+|...+.  .+|..|+...+
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            488999999 566788999987 45553 5689999997544  48888887543


No 29 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.22  E-value=1.2e-06  Score=34.11  Aligned_cols=24  Identities=29%  Similarity=0.693  Sum_probs=18.3

Q ss_pred             eeccCCCcccccHHHHHhhhhhcC
Q psy10278         80 YQCTFCSYSCTERFRLKDHTLAKH  103 (110)
Q Consensus        80 ~~C~~C~~~f~~~~~l~~H~~~~~  103 (110)
                      |.|+.|++.|.....|..|+..+|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            578888888888888888888765


No 30 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=98.21  E-value=1.7e-06  Score=45.69  Aligned_cols=74  Identities=20%  Similarity=0.368  Sum_probs=22.3

Q ss_pred             cCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCcccccHHHHHhhhhhcC
Q psy10278         25 QCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSYSCTERFRLKDHTLAKH  103 (110)
Q Consensus        25 ~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~~f~~~~~l~~H~~~~~  103 (110)
                      +|..|+..|.+...+..|+....+...-   . ...+.....+...+.... ...+.|..|++.|.....|..|+..++
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~---~-~~~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f~s~~~l~~Hm~~~~   74 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIP---D-QKYLVDPNRLLNYLRKKV-KESFRCPYCNKTFRSREALQEHMRSKH   74 (100)
T ss_dssp             -----------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHTT
T ss_pred             Cccccccccccccccccccccccccccc---c-cccccccccccccccccc-CCCCCCCccCCCCcCHHHHHHHHcCcc
Confidence            4889999999999999998754432211   1 111122333333433222 237999999999999999999999764


No 31 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.06  E-value=2.2e-06  Score=33.20  Aligned_cols=22  Identities=36%  Similarity=0.984  Sum_probs=13.4

Q ss_pred             ccCCcccccccCchhHHHHHHh
Q psy10278         24 FQCPVCGFTTGRKATLQLHVRQ   45 (110)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~   45 (110)
                      |.|+.|++.|.....|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4566666666666666666554


No 32 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.83  E-value=5.3e-06  Score=52.00  Aligned_cols=70  Identities=27%  Similarity=0.436  Sum_probs=42.1

Q ss_pred             CCCccCCc--ccccccCchhHHHHHHh-cCCCCceeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCcccccHHHHHh
Q psy10278         21 LKPFQCPV--CGFTTGRKATLQLHVRQ-HTREKPYACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSYSCTERFRLKD   97 (110)
Q Consensus        21 ~~~~~C~~--c~~~~~~~~~l~~h~~~-~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~~f~~~~~l~~   97 (110)
                      ++||+|++  |.+.+.....|+-|+.. |-..+...-+.          ...+..+-...+||.|++|+|.+.....|.-
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~----------p~~~~~F~~~~KPYrCevC~KRYKNlNGLKY  416 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPS----------PEKMNIFSAKDKPYRCEVCDKRYKNLNGLKY  416 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCC----------ccccccccccCCceeccccchhhccCcccee
Confidence            46777766  77777777777766552 21111111110          0011111335689999999999999988888


Q ss_pred             hhh
Q psy10278         98 HTL  100 (110)
Q Consensus        98 H~~  100 (110)
                      |+.
T Consensus       417 Hr~  419 (423)
T COG5189         417 HRK  419 (423)
T ss_pred             ccc
Confidence            875


No 33 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.77  E-value=3.4e-05  Score=35.40  Aligned_cols=33  Identities=15%  Similarity=0.267  Sum_probs=20.7

Q ss_pred             CCCCceeccCCCcccccHHHHHhhhhhcCCCCC
Q psy10278         75 MPVKKYQCTFCSYSCTERFRLKDHTLAKHNPGT  107 (110)
Q Consensus        75 ~~~~p~~C~~C~~~f~~~~~l~~H~~~~~~~~~  107 (110)
                      ..+.|-.|+.|+..+.+..+|+.|+...|...+
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            346778888888888888888888877776554


No 34 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.76  E-value=1.2e-05  Score=32.28  Aligned_cols=24  Identities=42%  Similarity=0.805  Sum_probs=14.7

Q ss_pred             CccCCcccccccCchhHHHHHHhc
Q psy10278         23 PFQCPVCGFTTGRKATLQLHVRQH   46 (110)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~   46 (110)
                      ||.|..|+..|.+...|..|++.|
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHh
Confidence            355666666666666666665544


No 35 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.75  E-value=2.1e-05  Score=30.40  Aligned_cols=23  Identities=48%  Similarity=1.031  Sum_probs=13.1

Q ss_pred             ccCCcccccccCchhHHHHHHhc
Q psy10278         24 FQCPVCGFTTGRKATLQLHVRQH   46 (110)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~   46 (110)
                      |.|+.|+..|.+...|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            45666666666666666666543


No 36 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.55  E-value=6.7e-05  Score=29.48  Aligned_cols=23  Identities=26%  Similarity=0.592  Sum_probs=19.5

Q ss_pred             eeccCCCcccccHHHHHhhhhhc
Q psy10278         80 YQCTFCSYSCTERFRLKDHTLAK  102 (110)
Q Consensus        80 ~~C~~C~~~f~~~~~l~~H~~~~  102 (110)
                      |.|..|++.|.....+..|++++
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            57889999999999999998754


No 37 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.55  E-value=8.1e-05  Score=29.11  Aligned_cols=23  Identities=26%  Similarity=0.564  Sum_probs=16.0

Q ss_pred             eeccCCCcccccHHHHHhhhhhc
Q psy10278         80 YQCTFCSYSCTERFRLKDHTLAK  102 (110)
Q Consensus        80 ~~C~~C~~~f~~~~~l~~H~~~~  102 (110)
                      +.|..|++.|.....+..|+..|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            45777777777777777777643


No 38 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=97.40  E-value=0.00011  Score=29.49  Aligned_cols=22  Identities=23%  Similarity=0.498  Sum_probs=19.5

Q ss_pred             eeccCCCcccccHHHHHhhhhh
Q psy10278         80 YQCTFCSYSCTERFRLKDHTLA  101 (110)
Q Consensus        80 ~~C~~C~~~f~~~~~l~~H~~~  101 (110)
                      |.|..|++.|.....+..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6799999999999999999875


No 39 
>PRK04860 hypothetical protein; Provisional
Probab=97.31  E-value=0.00027  Score=40.73  Aligned_cols=38  Identities=24%  Similarity=0.546  Sum_probs=32.1

Q ss_pred             ceeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCcccccH
Q psy10278         51 PYACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSYSCTER   92 (110)
Q Consensus        51 ~~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~~f~~~   92 (110)
                      +|.|. |+.   ....+..|.+.+.++++|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            58897 886   566778999999999999999999987643


No 40 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.31  E-value=0.00016  Score=28.08  Aligned_cols=24  Identities=42%  Similarity=0.837  Sum_probs=16.6

Q ss_pred             eeccCCCcccccHHHHHhhhhhcCC
Q psy10278         80 YQCTFCSYSCTERFRLKDHTLAKHN  104 (110)
Q Consensus        80 ~~C~~C~~~f~~~~~l~~H~~~~~~  104 (110)
                      |.|+.|..... ...|..|++.+|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            57888887777 7788888877653


No 41 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.31  E-value=0.00025  Score=27.61  Aligned_cols=23  Identities=39%  Similarity=0.883  Sum_probs=13.4

Q ss_pred             ccCCcccccccCchhHHHHHHhc
Q psy10278         24 FQCPVCGFTTGRKATLQLHVRQH   46 (110)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~   46 (110)
                      |.|..|++.|.....+..|+..|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            34666666666666666665543


No 42 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.27  E-value=8e-05  Score=34.20  Aligned_cols=29  Identities=28%  Similarity=0.522  Sum_probs=12.6

Q ss_pred             CceeCCCCCCCcCChHHHHHHHHhcCCCC
Q psy10278         50 KPYACPTCEFKTGDHNVLRKHVQRHMPVK   78 (110)
Q Consensus        50 ~~~~c~~c~~~~~~~~~l~~h~~~h~~~~   78 (110)
                      .|..|++|+..+.+..+|..|+...++.+
T Consensus        23 ~PatCP~C~a~~~~srnLrRHle~~H~~k   51 (54)
T PF09237_consen   23 QPATCPICGAVIRQSRNLRRHLEIRHFKK   51 (54)
T ss_dssp             --EE-TTT--EESSHHHHHHHHHHHTTTS
T ss_pred             CCCCCCcchhhccchhhHHHHHHHHhccc
Confidence            34555555555555555555555444443


No 43 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.98  E-value=0.00031  Score=27.48  Aligned_cols=21  Identities=29%  Similarity=0.732  Sum_probs=14.1

Q ss_pred             ccCCcccccccCchhHHHHHH
Q psy10278         24 FQCPVCGFTTGRKATLQLHVR   44 (110)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~   44 (110)
                      |.|.+|+..|.+...+..|++
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCCCcCCHHHHHHHHC
Confidence            456677777777777766665


No 44 
>PRK04860 hypothetical protein; Provisional
Probab=96.94  E-value=0.00095  Score=38.53  Aligned_cols=37  Identities=27%  Similarity=0.512  Sum_probs=31.9

Q ss_pred             CccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCC
Q psy10278         23 PFQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGD   63 (110)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~   63 (110)
                      +|.|. |+.   ....+..|.+.+.++++|.|..|+..+..
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEE
Confidence            58998 987   66778999999999999999999987754


No 45 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=96.35  E-value=0.0053  Score=32.14  Aligned_cols=66  Identities=17%  Similarity=0.310  Sum_probs=21.2

Q ss_pred             chhcHHHHHHHHHHHhcCCCCccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCChHHHHHHHHhc
Q psy10278          3 FYADIKCLKKHIREVHKRLKPFQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGDHNVLRKHVQRH   74 (110)
Q Consensus         3 ~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h   74 (110)
                      .|.+...|..|+...|.-..+    . ...+.....+........ ...+.|..|+..|.....|..|+..+
T Consensus         8 ~f~~~~~l~~H~~~~H~~~~~----~-~~~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    8 SFSSVDDLLQHMKKKHGFDIP----D-QKYLVDPNRLLNYLRKKV-KESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             -----------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             ccccccccccccccccccccc----c-cccccccccccccccccc-CCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            577888899999766654332    1 111112222333322221 22689999999999999999999964


No 46 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.33  E-value=0.0038  Score=24.54  Aligned_cols=19  Identities=26%  Similarity=0.553  Sum_probs=12.0

Q ss_pred             eccCCCcccccHHHHHhhhh
Q psy10278         81 QCTFCSYSCTERFRLKDHTL  100 (110)
Q Consensus        81 ~C~~C~~~f~~~~~l~~H~~  100 (110)
                      .|+.|++.| ....|..|+.
T Consensus         4 ~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHHH
Confidence            567777777 4456666654


No 47 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=96.17  E-value=0.0056  Score=25.81  Aligned_cols=24  Identities=21%  Similarity=0.602  Sum_probs=18.7

Q ss_pred             ceeccCCCcccccHHHHHhhhhhc
Q psy10278         79 KYQCTFCSYSCTERFRLKDHTLAK  102 (110)
Q Consensus        79 p~~C~~C~~~f~~~~~l~~H~~~~  102 (110)
                      +|.|..|+..|.....+..|+...
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~gk   26 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKGK   26 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHChH
Confidence            577888888888888888887643


No 48 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.81  E-value=0.023  Score=23.80  Aligned_cols=10  Identities=50%  Similarity=1.557  Sum_probs=4.7

Q ss_pred             ccCCcccccc
Q psy10278         24 FQCPVCGFTT   33 (110)
Q Consensus        24 ~~C~~c~~~~   33 (110)
                      |.|..||..+
T Consensus         2 ~~C~~CGy~y   11 (33)
T cd00350           2 YVCPVCGYIY   11 (33)
T ss_pred             EECCCCCCEE
Confidence            3455555443


No 49 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=94.20  E-value=0.024  Score=30.64  Aligned_cols=14  Identities=29%  Similarity=0.757  Sum_probs=7.0

Q ss_pred             ceeCCCCCCCcCCh
Q psy10278         51 PYACPTCEFKTGDH   64 (110)
Q Consensus        51 ~~~c~~c~~~~~~~   64 (110)
                      |..|+.||..|...
T Consensus        26 PivCP~CG~~~~~~   39 (108)
T PF09538_consen   26 PIVCPKCGTEFPPE   39 (108)
T ss_pred             CccCCCCCCccCcc
Confidence            44555555554433


No 50 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.96  E-value=0.019  Score=37.53  Aligned_cols=55  Identities=22%  Similarity=0.442  Sum_probs=36.1

Q ss_pred             ceeCCCCCCCcCChHHHHHHHH--hcCCC--Cceecc--CCCcccccHHHHHhhhhhcCCC
Q psy10278         51 PYACPTCEFKTGDHNVLRKHVQ--RHMPV--KKYQCT--FCSYSCTERFRLKDHTLAKHNP  105 (110)
Q Consensus        51 ~~~c~~c~~~~~~~~~l~~h~~--~h~~~--~p~~C~--~C~~~f~~~~~l~~H~~~~~~~  105 (110)
                      ++.|..|...|.....+..|..  .|.++  +|+.|+  .|++.|.+...+..|...+.+.
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~  349 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSI  349 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCC
Confidence            4556666666666666666666  56666  677776  5777777766666666666553


No 51 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.76  E-value=0.017  Score=37.77  Aligned_cols=63  Identities=25%  Similarity=0.597  Sum_probs=54.7

Q ss_pred             CCccCCcccccccCchhHHHHHH--hcCCC--CceeCC--CCCCCcCChHHHHHHHHhcCCCCceeccC
Q psy10278         22 KPFQCPVCGFTTGRKATLQLHVR--QHTRE--KPYACP--TCEFKTGDHNVLRKHVQRHMPVKKYQCTF   84 (110)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~--~~~~~--~~~~c~--~c~~~~~~~~~l~~h~~~h~~~~p~~C~~   84 (110)
                      .++.|..|...|.....+..|.+  .|.++  +++.|+  .|++.|.....+..|...|.+..++.+..
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  356 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKL  356 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCcccccc
Confidence            36789999999999999999999  78888  899999  79999999999999999998877776643


No 52 
>KOG1146|consensus
Probab=93.49  E-value=0.0096  Score=44.30  Aligned_cols=83  Identities=28%  Similarity=0.508  Sum_probs=46.8

Q ss_pred             HHhcCCCCccCCcccccccCchhHHHHHHh-cCCCCceeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCcccccHHH
Q psy10278         16 EVHKRLKPFQCPVCGFTTGRKATLQLHVRQ-HTREKPYACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSYSCTERFR   94 (110)
Q Consensus        16 ~~~~~~~~~~C~~c~~~~~~~~~l~~h~~~-~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~~f~~~~~   94 (110)
                      ..+.-.+.+.|+.|+..+.....|-.|++. |.....   ..|.. +...-.+..-...-.+-+||.|..|...++.+.+
T Consensus       458 ~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~---~~c~~-gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~  533 (1406)
T KOG1146|consen  458 VLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQS---AYCKA-GQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGN  533 (1406)
T ss_pred             eeecccccccCCccchhhhhHHHhhhcccccccccch---hHhHh-ccccccccccccccCCCCcccceeeeeeeecchH
Confidence            334445667788888888887777777774 322211   11110 0000000000001123467899999999999999


Q ss_pred             HHhhhhhc
Q psy10278         95 LKDHTLAK  102 (110)
Q Consensus        95 l~~H~~~~  102 (110)
                      |..|+.+-
T Consensus       534 LsihlqS~  541 (1406)
T KOG1146|consen  534 LSIHLQSD  541 (1406)
T ss_pred             HHHHHHHH
Confidence            99998753


No 53 
>KOG2893|consensus
Probab=93.43  E-value=0.015  Score=35.58  Aligned_cols=39  Identities=23%  Similarity=0.458  Sum_probs=18.6

Q ss_pred             CCCCCcCChHHHHHHHHhcCCCCceeccCCCcccccHHHHHhh
Q psy10278         56 TCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSYSCTERFRLKDH   98 (110)
Q Consensus        56 ~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~~f~~~~~l~~H   98 (110)
                      .|++.|.....|++|++    .+.|+|-.|.+.....-.|..|
T Consensus        15 ycnrefddekiliqhqk----akhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   15 YCNREFDDEKILIQHQK----AKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             ecccccchhhhhhhhhh----hccceeeeehhhhccCCCceee
Confidence            45555555555555544    2335555555443333344333


No 54 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=93.19  E-value=0.3  Score=26.61  Aligned_cols=83  Identities=19%  Similarity=0.271  Sum_probs=51.5

Q ss_pred             CCCccCCcccccccCchhHHHHHHhcCCCCc------------eeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCcc
Q psy10278         21 LKPFQCPVCGFTTGRKATLQLHVRQHTREKP------------YACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSYS   88 (110)
Q Consensus        21 ~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~------------~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~~   88 (110)
                      +-|-.|++|+-.+-+...|.+..-.-....+            ..|..|...|........  ..-.....|.|+.|...
T Consensus        13 ~LP~~CpiCgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~--~~~~~~~~y~C~~C~~~   90 (112)
T TIGR00622        13 ELPVECPICGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPF--DELKDSHRYVCAVCKNV   90 (112)
T ss_pred             CCCCcCCcCCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCcccccc--cccccccceeCCCCCCc
Confidence            3477899999988888877755321111111            137788887765421110  00122346899999999


Q ss_pred             cccHHHHHhhhhhcCCC
Q psy10278         89 CTERFRLKDHTLAKHNP  105 (110)
Q Consensus        89 f~~~~~l~~H~~~~~~~  105 (110)
                      |--.-+.-.|-..|.-.
T Consensus        91 FC~dCD~fiHe~Lh~CP  107 (112)
T TIGR00622        91 FCVDCDVFVHESLHCCP  107 (112)
T ss_pred             cccccchhhhhhccCCc
Confidence            98887777787766644


No 55 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=93.12  E-value=0.043  Score=25.78  Aligned_cols=27  Identities=15%  Similarity=0.191  Sum_probs=14.5

Q ss_pred             CCCceeccCCCcccccHHHHHhhhhhc
Q psy10278         76 PVKKYQCTFCSYSCTERFRLKDHTLAK  102 (110)
Q Consensus        76 ~~~p~~C~~C~~~f~~~~~l~~H~~~~  102 (110)
                      ||--+.|+-|+..|....++..|....
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNKa   40 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNKA   40 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhHH
Confidence            344455555666555555555555433


No 56 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=92.11  E-value=0.1  Score=30.45  Aligned_cols=10  Identities=20%  Similarity=0.580  Sum_probs=5.1

Q ss_pred             CCceeccCCC
Q psy10278         77 VKKYQCTFCS   86 (110)
Q Consensus        77 ~~p~~C~~C~   86 (110)
                      +-|..||.||
T Consensus       147 e~P~~CPiCg  156 (166)
T COG1592         147 EAPEVCPICG  156 (166)
T ss_pred             CCCCcCCCCC
Confidence            4445555554


No 57 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=91.96  E-value=0.091  Score=33.72  Aligned_cols=29  Identities=31%  Similarity=0.535  Sum_probs=25.3

Q ss_pred             CCCceeccC--CCcccccHHHHHhhhhhcCC
Q psy10278         76 PVKKYQCTF--CSYSCTERFRLKDHTLAKHN  104 (110)
Q Consensus        76 ~~~p~~C~~--C~~~f~~~~~l~~H~~~~~~  104 (110)
                      +++||+|++  |.|.+.....|.-|++-.|.
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~  376 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQ  376 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhcccc
Confidence            469999976  99999999999999987773


No 58 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=91.89  E-value=0.2  Score=21.51  Aligned_cols=32  Identities=19%  Similarity=0.392  Sum_probs=14.4

Q ss_pred             eCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCccc
Q psy10278         53 ACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSYSC   89 (110)
Q Consensus        53 ~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~~f   89 (110)
                      .|+.|+..|.-...-     ...+.+...|+.|+..|
T Consensus         4 ~CP~C~~~f~v~~~~-----l~~~~~~vrC~~C~~~f   35 (37)
T PF13719_consen    4 TCPNCQTRFRVPDDK-----LPAGGRKVRCPKCGHVF   35 (37)
T ss_pred             ECCCCCceEEcCHHH-----cccCCcEEECCCCCcEe
Confidence            455555555443321     11223345566665544


No 59 
>KOG4173|consensus
Probab=91.87  E-value=0.08  Score=31.82  Aligned_cols=78  Identities=22%  Similarity=0.376  Sum_probs=56.9

Q ss_pred             ccCCc--ccccccCchhHHHHHHhcCCCCceeCCCCCCCcCChHHHHHHHHhc----------CCCCceec--cCCCccc
Q psy10278         24 FQCPV--CGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGDHNVLRKHVQRH----------MPVKKYQC--TFCSYSC   89 (110)
Q Consensus        24 ~~C~~--c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h----------~~~~p~~C--~~C~~~f   89 (110)
                      +-|++  |...|.....+..|...-.+   -.|..|.+.|...--|..|+.-.          -|.-.|.|  ..|+..|
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KF  156 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKF  156 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhh
Confidence            66876  77788887777766553332   37899999998888888887642          23345888  4599999


Q ss_pred             ccHHHHHhhhhhcCC
Q psy10278         90 TERFRLKDHTLAKHN  104 (110)
Q Consensus        90 ~~~~~l~~H~~~~~~  104 (110)
                      ........|+...|.
T Consensus       157 kT~r~RkdH~I~~Hk  171 (253)
T KOG4173|consen  157 KTSRDRKDHMIRMHK  171 (253)
T ss_pred             hhhhhhhhHHHHhcc
Confidence            988888888887664


No 60 
>KOG2231|consensus
Probab=91.84  E-value=0.78  Score=32.64  Aligned_cols=47  Identities=23%  Similarity=0.412  Sum_probs=27.3

Q ss_pred             eCCCCCCCcCChHHHHHHHHhcCCCCceeccCC------CcccccHHHHHhhhhhcC
Q psy10278         53 ACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFC------SYSCTERFRLKDHTLAKH  103 (110)
Q Consensus        53 ~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C------~~~f~~~~~l~~H~~~~~  103 (110)
                      .|..|...|.....+..|++.++    |.|..|      .--|.....|..|.+..|
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcC
Confidence            56667667766666666666443    233333      234556666666666655


No 61 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=91.38  E-value=0.048  Score=33.11  Aligned_cols=17  Identities=41%  Similarity=0.786  Sum_probs=11.8

Q ss_pred             CCccCCcccccccCchh
Q psy10278         22 KPFQCPVCGFTTGRKAT   38 (110)
Q Consensus        22 ~~~~C~~c~~~~~~~~~   38 (110)
                      +...||+|+..|.++..
T Consensus         4 k~~~CPvC~~~F~~~~v   20 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKV   20 (214)
T ss_pred             CceECCCCCCeeeeeEE
Confidence            44678888888877643


No 62 
>KOG2186|consensus
Probab=90.82  E-value=0.23  Score=30.85  Aligned_cols=49  Identities=18%  Similarity=0.444  Sum_probs=34.0

Q ss_pred             ccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCChHHHHHHHHhcC
Q psy10278         24 FQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGDHNVLRKHVQRHM   75 (110)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~   75 (110)
                      |.|..||....-+. +-.|+..-.+ .-|.|..|+..|.. ..+..|..--+
T Consensus         4 FtCnvCgEsvKKp~-vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kCIT   52 (276)
T KOG2186|consen    4 FTCNVCGESVKKPQ-VEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKCIT   52 (276)
T ss_pred             Eehhhhhhhccccc-hHHHHHhccC-CeeEEeeccccccc-chhhhhhhhcc
Confidence            67888888776654 4557776555 46888888888877 45566666433


No 63 
>KOG2231|consensus
Probab=90.49  E-value=1  Score=32.07  Aligned_cols=72  Identities=21%  Similarity=0.163  Sum_probs=45.3

Q ss_pred             cccCchhHHHHHH-hcCCCCceeCCCCCCCc------CChHHHHHHHHhcCC-CC----ceeccCCCcccccHHHHHhhh
Q psy10278         32 TTGRKATLQLHVR-QHTREKPYACPTCEFKT------GDHNVLRKHVQRHMP-VK----KYQCTFCSYSCTERFRLKDHT   99 (110)
Q Consensus        32 ~~~~~~~l~~h~~-~~~~~~~~~c~~c~~~~------~~~~~l~~h~~~h~~-~~----p~~C~~C~~~f~~~~~l~~H~   99 (110)
                      .|.+...|+.|+. .|-.-....|..-.+.|      .....|..|+..... ++    .-.|..|..-|.....|..|+
T Consensus       123 ~~~s~~~Lk~H~~~~H~~~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~rH~  202 (669)
T KOG2231|consen  123 EFKSVENLKNHMRDQHKLHLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYRHL  202 (669)
T ss_pred             chhHHHHHHHHHHHhhhhhccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhhccHHHHHHhh
Confidence            3447788999986 45433222232212222      334567777775332 22    146889999999999999999


Q ss_pred             hhcC
Q psy10278        100 LAKH  103 (110)
Q Consensus       100 ~~~~  103 (110)
                      +..|
T Consensus       203 ~~~h  206 (669)
T KOG2231|consen  203 RFDH  206 (669)
T ss_pred             ccce
Confidence            9766


No 64 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=90.44  E-value=0.16  Score=28.20  Aligned_cols=15  Identities=13%  Similarity=0.140  Sum_probs=7.8

Q ss_pred             CceeCCCCCCCcCCh
Q psy10278         50 KPYACPTCEFKTGDH   64 (110)
Q Consensus        50 ~~~~c~~c~~~~~~~   64 (110)
                      .|..|+.||..|...
T Consensus        25 ~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        25 RPAVSPYTGEQFPPE   39 (129)
T ss_pred             CCccCCCcCCccCcc
Confidence            355566665554433


No 65 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=90.43  E-value=0.19  Score=21.16  Aligned_cols=10  Identities=50%  Similarity=1.560  Sum_probs=5.5

Q ss_pred             ccCCcccccc
Q psy10278         24 FQCPVCGFTT   33 (110)
Q Consensus        24 ~~C~~c~~~~   33 (110)
                      |.|..||..+
T Consensus         3 ~~C~~CG~i~   12 (34)
T cd00729           3 WVCPVCGYIH   12 (34)
T ss_pred             EECCCCCCEe
Confidence            5566666543


No 66 
>KOG2186|consensus
Probab=90.09  E-value=0.29  Score=30.44  Aligned_cols=32  Identities=28%  Similarity=0.486  Sum_probs=14.4

Q ss_pred             HHHHHHHHHhcCCCCccCCcccccccCchhHHHHH
Q psy10278          9 CLKKHIREVHKRLKPFQCPVCGFTTGRKATLQLHV   43 (110)
Q Consensus         9 ~l~~h~~~~~~~~~~~~C~~c~~~~~~~~~l~~h~   43 (110)
                      .+..|+- ...+ .-|.|-.|+..|.. .++..|.
T Consensus        17 ~vekH~s-rCrn-~~fSCIDC~k~F~~-~sYknH~   48 (276)
T KOG2186|consen   17 QVEKHMS-RCRN-AYFSCIDCGKTFER-VSYKNHT   48 (276)
T ss_pred             chHHHHH-hccC-CeeEEeeccccccc-chhhhhh
Confidence            3444552 2333 23455555555555 3344443


No 67 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=89.99  E-value=0.33  Score=20.75  Aligned_cols=10  Identities=20%  Similarity=0.507  Sum_probs=5.3

Q ss_pred             eeccCCCccc
Q psy10278         80 YQCTFCSYSC   89 (110)
Q Consensus        80 ~~C~~C~~~f   89 (110)
                      ..|+.|+..|
T Consensus        26 v~C~~C~~~~   35 (38)
T TIGR02098        26 VRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEE
Confidence            4555555544


No 68 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=89.07  E-value=0.27  Score=25.43  Aligned_cols=14  Identities=14%  Similarity=0.458  Sum_probs=8.9

Q ss_pred             CceeccCCCccccc
Q psy10278         78 KKYQCTFCSYSCTE   91 (110)
Q Consensus        78 ~p~~C~~C~~~f~~   91 (110)
                      ..|.|..|+..|+-
T Consensus        52 GIW~C~kCg~~fAG   65 (89)
T COG1997          52 GIWKCRKCGAKFAG   65 (89)
T ss_pred             CeEEcCCCCCeecc
Confidence            45677777766653


No 69 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=89.02  E-value=0.28  Score=22.10  Aligned_cols=8  Identities=38%  Similarity=1.530  Sum_probs=3.8

Q ss_pred             eeccCCCc
Q psy10278         80 YQCTFCSY   87 (110)
Q Consensus        80 ~~C~~C~~   87 (110)
                      +.|+.||.
T Consensus        22 ~~Cp~CG~   29 (46)
T PRK00398         22 VRCPYCGY   29 (46)
T ss_pred             eECCCCCC
Confidence            44555543


No 70 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=88.98  E-value=0.63  Score=26.96  Aligned_cols=30  Identities=13%  Similarity=0.398  Sum_probs=16.6

Q ss_pred             CceeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCcc
Q psy10278         50 KPYACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSYS   88 (110)
Q Consensus        50 ~~~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~~   88 (110)
                      .-|.|+.|+..|+....+.         --|.|+.||-.
T Consensus       108 ~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~  137 (158)
T TIGR00373       108 MFFICPNMCVRFTFNEAME---------LNFTCPRCGAM  137 (158)
T ss_pred             CeEECCCCCcEeeHHHHHH---------cCCcCCCCCCE
Confidence            3466666666665554442         13666666643


No 71 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=88.98  E-value=0.66  Score=26.89  Aligned_cols=34  Identities=18%  Similarity=0.373  Sum_probs=25.7

Q ss_pred             cCCCCccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCc
Q psy10278         19 KRLKPFQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKT   61 (110)
Q Consensus        19 ~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~   61 (110)
                      .+..-|.|+.|+..|.....+.         ..|.|+.||...
T Consensus       105 ~~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       105 TNNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAML  138 (158)
T ss_pred             cCCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEe
Confidence            3445699999999888776653         268999999743


No 72 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=88.83  E-value=0.53  Score=20.09  Aligned_cols=11  Identities=27%  Similarity=0.643  Sum_probs=5.9

Q ss_pred             ceeccCCCccc
Q psy10278         79 KYQCTFCSYSC   89 (110)
Q Consensus        79 p~~C~~C~~~f   89 (110)
                      ...|+.|+..|
T Consensus        25 ~v~C~~C~~~f   35 (36)
T PF13717_consen   25 KVRCSKCGHVF   35 (36)
T ss_pred             EEECCCCCCEe
Confidence            45555555544


No 73 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=88.78  E-value=0.39  Score=22.97  Aligned_cols=33  Identities=18%  Similarity=0.476  Sum_probs=18.7

Q ss_pred             CceeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCc
Q psy10278         50 KPYACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSY   87 (110)
Q Consensus        50 ~~~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~   87 (110)
                      ..|.|+.||..--....     +--.-..+|.|+.||.
T Consensus        26 v~F~CPnCGe~~I~Rc~-----~CRk~g~~Y~Cp~CGF   58 (61)
T COG2888          26 VKFPCPNCGEVEIYRCA-----KCRKLGNPYRCPKCGF   58 (61)
T ss_pred             eEeeCCCCCceeeehhh-----hHHHcCCceECCCcCc
Confidence            35788888854322211     1111246899998875


No 74 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=88.61  E-value=0.58  Score=20.73  Aligned_cols=25  Identities=28%  Similarity=0.430  Sum_probs=12.2

Q ss_pred             CCceeccCCCcccccH----HHHHhhhhh
Q psy10278         77 VKKYQCTFCSYSCTER----FRLKDHTLA  101 (110)
Q Consensus        77 ~~p~~C~~C~~~f~~~----~~l~~H~~~  101 (110)
                      +.-..|..|++.+...    +.|..|++.
T Consensus        14 ~~~a~C~~C~~~~~~~~~~ts~l~~HL~~   42 (45)
T PF02892_consen   14 KKKAKCKYCGKVIKYSSGGTSNLKRHLKK   42 (45)
T ss_dssp             SS-EEETTTTEE-----SSTHHHHHHHHH
T ss_pred             cCeEEeCCCCeEEeeCCCcHHHHHHhhhh
Confidence            3445666676666543    566666643


No 75 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=88.50  E-value=0.56  Score=21.05  Aligned_cols=10  Identities=30%  Similarity=0.866  Sum_probs=4.6

Q ss_pred             eeCCCCCCCc
Q psy10278         52 YACPTCEFKT   61 (110)
Q Consensus        52 ~~c~~c~~~~   61 (110)
                      |.|..|+..+
T Consensus         3 Y~C~~Cg~~~   12 (44)
T smart00659        3 YICGECGREN   12 (44)
T ss_pred             EECCCCCCEe
Confidence            4444444443


No 76 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=88.37  E-value=1.5  Score=25.05  Aligned_cols=37  Identities=22%  Similarity=0.415  Sum_probs=21.7

Q ss_pred             CCceeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCccc
Q psy10278         49 EKPYACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSYSC   89 (110)
Q Consensus        49 ~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~~f   89 (110)
                      ...|.|+.|+..|.....+..   ... ...|.|+.||...
T Consensus        97 ~~~Y~Cp~C~~~y~~~ea~~~---~d~-~~~f~Cp~Cg~~l  133 (147)
T smart00531       97 NAYYKCPNCQSKYTFLEANQL---LDM-DGTFTCPRCGEEL  133 (147)
T ss_pred             CcEEECcCCCCEeeHHHHHHh---cCC-CCcEECCCCCCEE
Confidence            345788888877764433211   112 3348888888654


No 77 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=88.10  E-value=0.16  Score=23.41  Aligned_cols=13  Identities=23%  Similarity=0.743  Sum_probs=7.9

Q ss_pred             ccCCcccccccCc
Q psy10278         24 FQCPVCGFTTGRK   36 (110)
Q Consensus        24 ~~C~~c~~~~~~~   36 (110)
                      |.|..|+..|...
T Consensus         6 y~C~~Cg~~fe~~   18 (52)
T TIGR02605         6 YRCTACGHRFEVL   18 (52)
T ss_pred             EEeCCCCCEeEEE
Confidence            5566666666544


No 78 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=87.52  E-value=0.76  Score=22.00  Aligned_cols=32  Identities=22%  Similarity=0.597  Sum_probs=18.6

Q ss_pred             CceeCCCCCCC-cCChHHHHHHHHhcCCCCceeccCCCc
Q psy10278         50 KPYACPTCEFK-TGDHNVLRKHVQRHMPVKKYQCTFCSY   87 (110)
Q Consensus        50 ~~~~c~~c~~~-~~~~~~l~~h~~~h~~~~p~~C~~C~~   87 (110)
                      ..|.|+.||.. ...-..-.    .  -..+|.|+.||.
T Consensus        24 ~~F~CPnCG~~~I~RC~~CR----k--~~~~Y~CP~CGF   56 (59)
T PRK14890         24 VKFLCPNCGEVIIYRCEKCR----K--QSNPYTCPKCGF   56 (59)
T ss_pred             CEeeCCCCCCeeEeechhHH----h--cCCceECCCCCC
Confidence            35788888875 22221111    1  136788988875


No 79 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=87.30  E-value=0.59  Score=21.39  Aligned_cols=22  Identities=18%  Similarity=0.484  Sum_probs=11.8

Q ss_pred             eeccCCCcccccH-----HHHHhhhhh
Q psy10278         80 YQCTFCSYSCTER-----FRLKDHTLA  101 (110)
Q Consensus        80 ~~C~~C~~~f~~~-----~~l~~H~~~  101 (110)
                      -.|..|++.++..     +.|..|+..
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~~   45 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLRR   45 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHHh
Confidence            4555565555433     456666653


No 80 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=87.27  E-value=0.2  Score=21.70  Aligned_cols=13  Identities=31%  Similarity=0.720  Sum_probs=7.1

Q ss_pred             ccCCcccccccCc
Q psy10278         24 FQCPVCGFTTGRK   36 (110)
Q Consensus        24 ~~C~~c~~~~~~~   36 (110)
                      |.|+.|+..|...
T Consensus         6 y~C~~Cg~~fe~~   18 (41)
T smart00834        6 YRCEDCGHTFEVL   18 (41)
T ss_pred             EEcCCCCCEEEEE
Confidence            4566666655443


No 81 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=86.04  E-value=0.97  Score=26.78  Aligned_cols=29  Identities=17%  Similarity=0.589  Sum_probs=15.7

Q ss_pred             ceeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCcc
Q psy10278         51 PYACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSYS   88 (110)
Q Consensus        51 ~~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~~   88 (110)
                      -|.|+.|+..|+....+.         --|.|+.||-.
T Consensus       117 ~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~  145 (178)
T PRK06266        117 FFFCPNCHIRFTFDEAME---------YGFRCPQCGEM  145 (178)
T ss_pred             EEECCCCCcEEeHHHHhh---------cCCcCCCCCCC
Confidence            456666666555544431         24666666643


No 82 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=85.65  E-value=0.18  Score=29.10  Aligned_cols=13  Identities=15%  Similarity=0.378  Sum_probs=7.8

Q ss_pred             eeCCCCCCCcCCh
Q psy10278         52 YACPTCEFKTGDH   64 (110)
Q Consensus        52 ~~c~~c~~~~~~~   64 (110)
                      +.|+.||..|...
T Consensus        29 ~~c~~c~~~f~~~   41 (154)
T PRK00464         29 RECLACGKRFTTF   41 (154)
T ss_pred             eeccccCCcceEe
Confidence            5666666666443


No 83 
>KOG2482|consensus
Probab=85.30  E-value=2.3  Score=27.96  Aligned_cols=25  Identities=24%  Similarity=0.579  Sum_probs=21.3

Q ss_pred             eeccCCCcccccHHHHHhhhhhcCC
Q psy10278         80 YQCTFCSYSCTERFRLKDHTLAKHN  104 (110)
Q Consensus        80 ~~C~~C~~~f~~~~~l~~H~~~~~~  104 (110)
                      +.|-.|.+.|..+..|+.||+....
T Consensus       196 ~~CLyCekifrdkntLkeHMrkK~H  220 (423)
T KOG2482|consen  196 LRCLYCEKIFRDKNTLKEHMRKKRH  220 (423)
T ss_pred             heeeeeccccCCcHHHHHHHHhccC
Confidence            7899999999999999999985443


No 84 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=85.28  E-value=0.52  Score=29.55  Aligned_cols=81  Identities=20%  Similarity=0.288  Sum_probs=45.6

Q ss_pred             cCCCCccCCcccccccCchhHHHHHHh--cCCCCceeCCCCCCCcCCh------HHHHHHHHh----cCCCCceeccCCC
Q psy10278         19 KRLKPFQCPVCGFTTGRKATLQLHVRQ--HTREKPYACPTCEFKTGDH------NVLRKHVQR----HMPVKKYQCTFCS   86 (110)
Q Consensus        19 ~~~~~~~C~~c~~~~~~~~~l~~h~~~--~~~~~~~~c~~c~~~~~~~------~~l~~h~~~----h~~~~p~~C~~C~   86 (110)
                      .|.+.|.|.+|..-+..-. --.|+.+  -.....|.|..|++.-..+      ..-..|.+.    ....+|+.|++|+
T Consensus       138 hGGrif~CsfC~~flCEDD-QFEHQAsCQvLe~E~~KC~SCNrlGq~sCLRCK~cfCddHvrrKg~ky~k~k~~PCPKCg  216 (314)
T PF06524_consen  138 HGGRIFKCSFCDNFLCEDD-QFEHQASCQVLESETFKCQSCNRLGQYSCLRCKICFCDDHVRRKGFKYEKGKPIPCPKCG  216 (314)
T ss_pred             CCCeEEEeecCCCeeeccc-hhhhhhhhhhhhcccccccccccccchhhhheeeeehhhhhhhcccccccCCCCCCCCCC
Confidence            4566789999976444333 3345542  3344567887776543221      111234332    2345789999999


Q ss_pred             cccccHHHHHhhhh
Q psy10278         87 YSCTERFRLKDHTL  100 (110)
Q Consensus        87 ~~f~~~~~l~~H~~  100 (110)
                      .--..-..|..-.+
T Consensus       217 ~et~eTkdLSmStR  230 (314)
T PF06524_consen  217 YETQETKDLSMSTR  230 (314)
T ss_pred             Ccccccccceeeee
Confidence            76665555544443


No 85 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=84.88  E-value=0.75  Score=28.09  Aligned_cols=30  Identities=20%  Similarity=0.428  Sum_probs=22.0

Q ss_pred             CCCceeccCCCcccccHHHHHhhhhhcCCC
Q psy10278         76 PVKKYQCTFCSYSCTERFRLKDHTLAKHNP  105 (110)
Q Consensus        76 ~~~p~~C~~C~~~f~~~~~l~~H~~~~~~~  105 (110)
                      .+..|.|+.|+|.|....-.++|+...|.+
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhcCHH
Confidence            344599999999999999999999887754


No 86 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=84.13  E-value=0.81  Score=25.74  Aligned_cols=27  Identities=22%  Similarity=0.285  Sum_probs=16.4

Q ss_pred             CCceeccCCCcccccHHHHHhhhhhcCCCC
Q psy10278         77 VKKYQCTFCSYSCTERFRLKDHTLAKHNPG  106 (110)
Q Consensus        77 ~~p~~C~~C~~~f~~~~~l~~H~~~~~~~~  106 (110)
                      +....|-+||+.|..   |..|+..||+-.
T Consensus        70 ~d~i~clecGk~~k~---LkrHL~~~~glt   96 (132)
T PF05443_consen   70 PDYIICLECGKKFKT---LKRHLRTHHGLT   96 (132)
T ss_dssp             SS-EE-TBT--EESB---HHHHHHHTT-S-
T ss_pred             cCeeEEccCCcccch---HHHHHHHccCCC
Confidence            344789999998886   488999987643


No 87 
>PF14353 CpXC:  CpXC protein
Probab=84.09  E-value=0.16  Score=28.17  Aligned_cols=12  Identities=33%  Similarity=0.833  Sum_probs=7.1

Q ss_pred             cCCcccccccCc
Q psy10278         25 QCPVCGFTTGRK   36 (110)
Q Consensus        25 ~C~~c~~~~~~~   36 (110)
                      .|+.|+..|...
T Consensus         3 tCP~C~~~~~~~   14 (128)
T PF14353_consen    3 TCPHCGHEFEFE   14 (128)
T ss_pred             CCCCCCCeeEEE
Confidence            466676665543


No 88 
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=83.86  E-value=0.57  Score=24.50  Aligned_cols=14  Identities=14%  Similarity=0.468  Sum_probs=8.6

Q ss_pred             CceeccCCCccccc
Q psy10278         78 KKYQCTFCSYSCTE   91 (110)
Q Consensus        78 ~p~~C~~C~~~f~~   91 (110)
                      ..|.|..|++.|+-
T Consensus        53 GIW~C~~C~~~~AG   66 (90)
T PTZ00255         53 GIWRCKGCKKTVAG   66 (90)
T ss_pred             EEEEcCCCCCEEeC
Confidence            45666666666653


No 89 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=83.31  E-value=1.2  Score=23.99  Aligned_cols=25  Identities=24%  Similarity=0.679  Sum_probs=23.2

Q ss_pred             eec----cCCCcccccHHHHHhhhhhcCC
Q psy10278         80 YQC----TFCSYSCTERFRLKDHTLAKHN  104 (110)
Q Consensus        80 ~~C----~~C~~~f~~~~~l~~H~~~~~~  104 (110)
                      |.|    ..|+....+...+..|...+|+
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            899    9999999999999999998875


No 90 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=82.06  E-value=1.5  Score=17.24  Aligned_cols=18  Identities=22%  Similarity=0.462  Sum_probs=10.1

Q ss_pred             eccCCCcccccHHHHHhhh
Q psy10278         81 QCTFCSYSCTERFRLKDHT   99 (110)
Q Consensus        81 ~C~~C~~~f~~~~~l~~H~   99 (110)
                      .|+.|++.+ ....+..|+
T Consensus         3 ~CPiC~~~v-~~~~in~HL   20 (26)
T smart00734        3 QCPVCFREV-PENLINSHL   20 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHH
Confidence            466666665 334555554


No 91 
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=82.04  E-value=0.44  Score=26.74  Aligned_cols=59  Identities=24%  Similarity=0.453  Sum_probs=33.4

Q ss_pred             hcCCCCccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCC--hHHHHHHHHhcCCCCceeccCCCcccccHH
Q psy10278         18 HKRLKPFQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGD--HNVLRKHVQRHMPVKKYQCTFCSYSCTERF   93 (110)
Q Consensus        18 ~~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~--~~~l~~h~~~h~~~~p~~C~~C~~~f~~~~   93 (110)
                      ....+.|+|.+|.++...+..|          +|-.|  ||.....  -..|+.+-..+.     .|+.|.-+|.+.+
T Consensus        75 F~d~~lYeCnIC~etS~ee~FL----------KPneC--CgY~iCn~Cya~LWK~~~~yp-----vCPvCkTSFKss~  135 (140)
T PF05290_consen   75 FLDPKLYECNICKETSAEERFL----------KPNEC--CGYSICNACYANLWKFCNLYP-----VCPVCKTSFKSSS  135 (140)
T ss_pred             ecCCCceeccCcccccchhhcC----------Ccccc--cchHHHHHHHHHHHHHcccCC-----CCCcccccccccc
Confidence            3456779999998876554433          23333  2222211  144555544443     6888888887543


No 92 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=81.30  E-value=0.49  Score=23.70  Aligned_cols=15  Identities=27%  Similarity=0.425  Sum_probs=8.1

Q ss_pred             CCceecc--CCCccccc
Q psy10278         77 VKKYQCT--FCSYSCTE   91 (110)
Q Consensus        77 ~~p~~C~--~C~~~f~~   91 (110)
                      ++.+.|.  .||.+|..
T Consensus        25 ~~Y~qC~N~eCg~tF~t   41 (72)
T PRK09678         25 ERYHQCQNVNCSATFIT   41 (72)
T ss_pred             eeeeecCCCCCCCEEEE
Confidence            4455555  56665543


No 93 
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=81.17  E-value=0.65  Score=24.32  Aligned_cols=13  Identities=15%  Similarity=0.475  Sum_probs=8.0

Q ss_pred             CceeccCCCcccc
Q psy10278         78 KKYQCTFCSYSCT   90 (110)
Q Consensus        78 ~p~~C~~C~~~f~   90 (110)
                      ..|.|..|++.|+
T Consensus        52 GIW~C~~C~~~~A   64 (91)
T TIGR00280        52 GIWTCRKCGAKFA   64 (91)
T ss_pred             EEEEcCCCCCEEe
Confidence            3466666666665


No 94 
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=80.89  E-value=1.4  Score=20.71  Aligned_cols=40  Identities=23%  Similarity=0.649  Sum_probs=21.3

Q ss_pred             ceeCCC--CCCCcCChHHHHHHHHhcCCCCceeccC----CCccccc
Q psy10278         51 PYACPT--CEFKTGDHNVLRKHVQRHMPVKKYQCTF----CSYSCTE   91 (110)
Q Consensus        51 ~~~c~~--c~~~~~~~~~l~~h~~~h~~~~p~~C~~----C~~~f~~   91 (110)
                      +..|+.  |...+ ....|..|+...-..++..|+.    |+..+..
T Consensus         9 ~v~C~~~cc~~~i-~r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~~   54 (60)
T PF02176_consen    9 PVPCPNGCCNEMI-PRKELDDHLENECPKRPVPCPYSPYGCKERVPR   54 (60)
T ss_dssp             EEE-TT--S-BEE-ECCCHHHHHHTTSTTSEEE-SS----S--EEEH
T ss_pred             EeeCCCCCcccce-eHHHHHHHHHccCCCCcEECCCCCCCCCCccch
Confidence            455655  33323 2346677877666667788888    7776654


No 95 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=80.44  E-value=0.45  Score=19.16  Aligned_cols=19  Identities=32%  Similarity=0.518  Sum_probs=11.4

Q ss_pred             eeccCCCcccccHHHHHhhh
Q psy10278         80 YQCTFCSYSCTERFRLKDHT   99 (110)
Q Consensus        80 ~~C~~C~~~f~~~~~l~~H~   99 (110)
                      |.|-.|++.|. ...+..|.
T Consensus         1 ~sCiDC~~~F~-~~~y~~Ht   19 (28)
T PF08790_consen    1 FSCIDCSKDFD-GDSYKSHT   19 (28)
T ss_dssp             EEETTTTEEEE-GGGTTT--
T ss_pred             CeeecCCCCcC-cCCcCCCC
Confidence            57888888884 34444454


No 96 
>KOG4167|consensus
Probab=79.64  E-value=0.38  Score=34.42  Aligned_cols=26  Identities=12%  Similarity=0.199  Sum_probs=23.4

Q ss_pred             ceeccCCCcccccHHHHHhhhhhcCC
Q psy10278         79 KYQCTFCSYSCTERFRLKDHTLAKHN  104 (110)
Q Consensus        79 p~~C~~C~~~f~~~~~l~~H~~~~~~  104 (110)
                      .|.|..|++.|..-.++..||++|.-
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            49999999999999999999998863


No 97 
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=79.63  E-value=0.47  Score=24.79  Aligned_cols=12  Identities=17%  Similarity=0.598  Sum_probs=8.2

Q ss_pred             ceeccCCCcccc
Q psy10278         79 KYQCTFCSYSCT   90 (110)
Q Consensus        79 p~~C~~C~~~f~   90 (110)
                      .|.|..|++.|+
T Consensus        53 IW~C~~C~~~~A   64 (90)
T PF01780_consen   53 IWKCKKCGKKFA   64 (90)
T ss_dssp             EEEETTTTEEEE
T ss_pred             EeecCCCCCEEe
Confidence            477777777665


No 98 
>KOG2785|consensus
Probab=79.25  E-value=3.3  Score=27.53  Aligned_cols=24  Identities=21%  Similarity=0.484  Sum_probs=20.5

Q ss_pred             ceeccCCC---cccccHHHHHhhhhhc
Q psy10278         79 KYQCTFCS---YSCTERFRLKDHTLAK  102 (110)
Q Consensus        79 p~~C~~C~---~~f~~~~~l~~H~~~~  102 (110)
                      -+.|-+|.   +.|.+....++||...
T Consensus       217 ~~~CL~CN~~~~~f~sleavr~HM~~K  243 (390)
T KOG2785|consen  217 GFICLFCNELGRPFSSLEAVRAHMRDK  243 (390)
T ss_pred             CceEEEeccccCcccccHHHHHHHhhc
Confidence            38888898   9999999999999843


No 99 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=78.04  E-value=1.4  Score=27.01  Aligned_cols=27  Identities=19%  Similarity=0.465  Sum_probs=20.7

Q ss_pred             CCCccCCcccccccCchhHHHHHHhcC
Q psy10278         21 LKPFQCPVCGFTTGRKATLQLHVRQHT   47 (110)
Q Consensus        21 ~~~~~C~~c~~~~~~~~~l~~h~~~~~   47 (110)
                      +..|.|++|++.|.-...+..|+..-+
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcC
Confidence            445999999999999999999998533


No 100
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=78.02  E-value=1.2  Score=17.20  Aligned_cols=8  Identities=25%  Similarity=1.028  Sum_probs=4.1

Q ss_pred             ceeccCCC
Q psy10278         79 KYQCTFCS   86 (110)
Q Consensus        79 p~~C~~C~   86 (110)
                      +|.|+.||
T Consensus        16 ~f~CPnCG   23 (24)
T PF07754_consen   16 PFPCPNCG   23 (24)
T ss_pred             eEeCCCCC
Confidence            35555554


No 101
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=77.96  E-value=1.4  Score=28.97  Aligned_cols=21  Identities=29%  Similarity=0.524  Sum_probs=12.7

Q ss_pred             eCCCCCCCcCChHHHHHHHHh
Q psy10278         53 ACPTCEFKTGDHNVLRKHVQR   73 (110)
Q Consensus        53 ~c~~c~~~~~~~~~l~~h~~~   73 (110)
                      .|..|...|.....|..|.+.
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~  242 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRL  242 (493)
T ss_pred             hhhhccceecChHHHHHHHHh
Confidence            456666666666666666553


No 102
>KOG2893|consensus
Probab=77.82  E-value=0.61  Score=28.90  Aligned_cols=45  Identities=27%  Similarity=0.404  Sum_probs=29.8

Q ss_pred             CCCccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCChHHHHHH
Q psy10278         21 LKPFQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGDHNVLRKH   70 (110)
Q Consensus        21 ~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h   70 (110)
                      ++|| |=.|+..|..+.-|..|++    .+.|+|-+|-+...+.-.|..|
T Consensus         9 ~kpw-cwycnrefddekiliqhqk----akhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen    9 DKPW-CWYCNREFDDEKILIQHQK----AKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             CCce-eeecccccchhhhhhhhhh----hccceeeeehhhhccCCCceee
Confidence            3454 7778889988887777765    3568898887644444344444


No 103
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=77.37  E-value=1.2  Score=18.58  Aligned_cols=8  Identities=25%  Similarity=0.758  Sum_probs=3.5

Q ss_pred             eeccCCCc
Q psy10278         80 YQCTFCSY   87 (110)
Q Consensus        80 ~~C~~C~~   87 (110)
                      ..|+.||.
T Consensus        18 irC~~CG~   25 (32)
T PF03604_consen   18 IRCPECGH   25 (32)
T ss_dssp             SSBSSSS-
T ss_pred             EECCcCCC
Confidence            45555543


No 104
>PHA00626 hypothetical protein
Probab=77.35  E-value=1.7  Score=20.54  Aligned_cols=15  Identities=27%  Similarity=0.747  Sum_probs=11.7

Q ss_pred             CceeccCCCcccccH
Q psy10278         78 KKYQCTFCSYSCTER   92 (110)
Q Consensus        78 ~p~~C~~C~~~f~~~   92 (110)
                      ..|.|+.|+..|+..
T Consensus        22 nrYkCkdCGY~ft~~   36 (59)
T PHA00626         22 DDYVCCDCGYNDSKD   36 (59)
T ss_pred             cceEcCCCCCeechh
Confidence            568888898888754


No 105
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=76.89  E-value=0.98  Score=23.62  Aligned_cols=13  Identities=15%  Similarity=0.519  Sum_probs=8.0

Q ss_pred             CceeccCCCcccc
Q psy10278         78 KKYQCTFCSYSCT   90 (110)
Q Consensus        78 ~p~~C~~C~~~f~   90 (110)
                      ..|.|..|++.|+
T Consensus        53 GIW~C~~C~~~~A   65 (90)
T PRK03976         53 GIWECRKCGAKFA   65 (90)
T ss_pred             EEEEcCCCCCEEe
Confidence            3466666666665


No 106
>KOG3408|consensus
Probab=75.92  E-value=2  Score=23.74  Aligned_cols=23  Identities=22%  Similarity=0.394  Sum_probs=14.4

Q ss_pred             ceeccCCCcccccHHHHHhhhhh
Q psy10278         79 KYQCTFCSYSCTERFRLKDHTLA  101 (110)
Q Consensus        79 p~~C~~C~~~f~~~~~l~~H~~~  101 (110)
                      .|.|-.|.+-|.....|..|.++
T Consensus        57 qfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   57 QFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             eeehhhhhhhhcchHHHHHHHhc
Confidence            36666666666666666666654


No 107
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=75.90  E-value=1.5  Score=17.25  Aligned_cols=9  Identities=33%  Similarity=1.047  Sum_probs=4.6

Q ss_pred             eccCCCccc
Q psy10278         81 QCTFCSYSC   89 (110)
Q Consensus        81 ~C~~C~~~f   89 (110)
                      .|+.||..|
T Consensus        16 ~Cp~CG~~F   24 (26)
T PF10571_consen   16 FCPHCGYDF   24 (26)
T ss_pred             cCCCCCCCC
Confidence            455555554


No 108
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=75.33  E-value=0.37  Score=34.36  Aligned_cols=58  Identities=22%  Similarity=0.374  Sum_probs=36.0

Q ss_pred             CCcccccccCchhHHHHHHhcCCCCce-eCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCcccc
Q psy10278         26 CPVCGFTTGRKATLQLHVRQHTREKPY-ACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSYSCT   90 (110)
Q Consensus        26 C~~c~~~~~~~~~l~~h~~~~~~~~~~-~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~~f~   90 (110)
                      |..||-+|.....|- -.+.++.-..| .|+.|.+.|..+.+    .+.|.  +|..|+.||....
T Consensus       126 CT~CGPRfTIi~alP-YDR~nTsM~~F~lC~~C~~EY~dP~n----RRfHA--Qp~aCp~CGP~~~  184 (750)
T COG0068         126 CTNCGPRFTIIEALP-YDRENTSMADFPLCPFCDKEYKDPLN----RRFHA--QPIACPKCGPHLF  184 (750)
T ss_pred             cCCCCcceeeeccCC-CCcccCccccCcCCHHHHHHhcCccc----ccccc--ccccCcccCCCeE
Confidence            777888887655431 11223332333 58888887777755    33453  7889999997543


No 109
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=75.16  E-value=2.3  Score=18.86  Aligned_cols=14  Identities=29%  Similarity=0.520  Sum_probs=9.5

Q ss_pred             eccCCCcccccHHH
Q psy10278         81 QCTFCSYSCTERFR   94 (110)
Q Consensus        81 ~C~~C~~~f~~~~~   94 (110)
                      .|..|++.|+++..
T Consensus        10 ~C~~C~rpf~WRKK   23 (42)
T PF10013_consen   10 ICPVCGRPFTWRKK   23 (42)
T ss_pred             cCcccCCcchHHHH
Confidence            57777777776543


No 110
>KOG1146|consensus
Probab=74.84  E-value=0.31  Score=36.98  Aligned_cols=77  Identities=14%  Similarity=0.219  Sum_probs=51.1

Q ss_pred             ccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCChHHHHHHHHhc-----------------CCCCceeccCCC
Q psy10278         24 FQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGDHNVLRKHVQRH-----------------MPVKKYQCTFCS   86 (110)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h-----------------~~~~p~~C~~C~   86 (110)
                      +.|..|.+.+.....+. ++.   ...+|.|..|...|.....+..|.+.-                 ..-.+| |..|.
T Consensus      1261 ~~c~~~~~~~~~~~~~~-~l~---~~~~~~~~~~~~~~~~~~~l~~~~~k~~~~~~~~~~~~~~~l~~~d~~~~-c~~c~ 1335 (1406)
T KOG1146|consen 1261 GECGAVDELLTPSFGIS-TLD---VTHRYLCRQCKMAFDGEAPLTAHQRKFCFAGRGSGGSMPPPLRVPDCTYH-CLACE 1335 (1406)
T ss_pred             chhhhccccccCcccee-ecc---cchhHHHHHHHhhhcchhHHHHHHHHHHhccCccccCCCCcccCcccccc-chHHH
Confidence            56777777766555443 322   233577777777777777777766421                 112235 99999


Q ss_pred             cccccHHHHHhhhhhcCCC
Q psy10278         87 YSCTERFRLKDHTLAKHNP  105 (110)
Q Consensus        87 ~~f~~~~~l~~H~~~~~~~  105 (110)
                      ..|.....|..|+++-+++
T Consensus      1336 ~~~~~~~alqihm~~~~~~ 1354 (1406)
T KOG1146|consen 1336 VLLSGREALQIHMRSSAHR 1354 (1406)
T ss_pred             hhcchhHHHHHHHHHhhhc
Confidence            9999999999999865543


No 111
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=73.90  E-value=2.1  Score=18.61  Aligned_cols=13  Identities=15%  Similarity=0.590  Sum_probs=10.8

Q ss_pred             ceeccCCCccccc
Q psy10278         79 KYQCTFCSYSCTE   91 (110)
Q Consensus        79 p~~C~~C~~~f~~   91 (110)
                      ||.|..|+..|=.
T Consensus        12 ~f~C~~C~~~FC~   24 (39)
T smart00154       12 GFKCRHCGNLFCG   24 (39)
T ss_pred             CeECCccCCcccc
Confidence            7899999988864


No 112
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=73.77  E-value=0.51  Score=20.20  Aligned_cols=8  Identities=25%  Similarity=0.451  Sum_probs=3.4

Q ss_pred             eeccCCCc
Q psy10278         80 YQCTFCSY   87 (110)
Q Consensus        80 ~~C~~C~~   87 (110)
                      -.|..||-
T Consensus        22 ~~Cd~cg~   29 (36)
T PF05191_consen   22 GVCDNCGG   29 (36)
T ss_dssp             TBCTTTTE
T ss_pred             CccCCCCC
Confidence            34444443


No 113
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=73.31  E-value=3.1  Score=22.37  Aligned_cols=18  Identities=44%  Similarity=0.835  Sum_probs=8.5

Q ss_pred             CcccccccCchhHHHHHH
Q psy10278         27 PVCGFTTGRKATLQLHVR   44 (110)
Q Consensus        27 ~~c~~~~~~~~~l~~h~~   44 (110)
                      ..|+....+...|..|.+
T Consensus        88 ~~C~y~~~~~~~m~~H~~  105 (109)
T PF12013_consen   88 PHCGYITRSKKTMRKHWR  105 (109)
T ss_pred             CCCCcEeccHHHHHHHHH
Confidence            444444444444444444


No 114
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=72.79  E-value=1.8  Score=23.49  Aligned_cols=12  Identities=17%  Similarity=0.193  Sum_probs=6.6

Q ss_pred             CceeCCCCCCCc
Q psy10278         50 KPYACPTCEFKT   61 (110)
Q Consensus        50 ~~~~c~~c~~~~   61 (110)
                      .|..|+.||+.|
T Consensus        25 dPiVsPytG~s~   36 (129)
T COG4530          25 DPIVSPYTGKSY   36 (129)
T ss_pred             CccccCcccccc
Confidence            355555555555


No 115
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=72.44  E-value=3.1  Score=19.18  Aligned_cols=10  Identities=30%  Similarity=1.039  Sum_probs=4.7

Q ss_pred             ccCCcccccc
Q psy10278         24 FQCPVCGFTT   33 (110)
Q Consensus        24 ~~C~~c~~~~   33 (110)
                      |.|..|+..+
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            4444444444


No 116
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=72.03  E-value=8.9  Score=24.16  Aligned_cols=58  Identities=17%  Similarity=0.394  Sum_probs=29.0

Q ss_pred             CCccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCcccccH
Q psy10278         22 KPFQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSYSCTER   92 (110)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~~f~~~   92 (110)
                      +.|-|..|...+..        +.........|..|.+.|..-..-.   .  -|---|.|+.|+..|...
T Consensus       111 rqFaC~~Cd~~WwR--------rvp~rKeVSRCr~C~~rYDPVP~dk---m--wG~aef~C~~C~h~F~G~  168 (278)
T PF15135_consen  111 RQFACSSCDHMWWR--------RVPQRKEVSRCRKCRKRYDPVPCDK---M--WGIAEFHCPKCRHNFRGF  168 (278)
T ss_pred             eeeeccccchHHHh--------ccCcccccccccccccccCCCcccc---c--cceeeeecccccccchhh
Confidence            56888888654322        3222222345666666554332100   0  012237777777777643


No 117
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=71.86  E-value=2.2  Score=18.80  Aligned_cols=13  Identities=23%  Similarity=0.557  Sum_probs=9.9

Q ss_pred             eeccCCCcccccH
Q psy10278         80 YQCTFCSYSCTER   92 (110)
Q Consensus        80 ~~C~~C~~~f~~~   92 (110)
                      |.|..||..|...
T Consensus         6 y~C~~Cg~~fe~~   18 (42)
T PF09723_consen    6 YRCEECGHEFEVL   18 (42)
T ss_pred             EEeCCCCCEEEEE
Confidence            7888898877643


No 118
>KOG2907|consensus
Probab=71.72  E-value=5  Score=21.95  Aligned_cols=38  Identities=26%  Similarity=0.505  Sum_probs=20.5

Q ss_pred             eeCCCCCCCcCChHHHHHHHHhcCCCC---ceeccCCCcccccH
Q psy10278         52 YACPTCEFKTGDHNVLRKHVQRHMPVK---KYQCTFCSYSCTER   92 (110)
Q Consensus        52 ~~c~~c~~~~~~~~~l~~h~~~h~~~~---p~~C~~C~~~f~~~   92 (110)
                      ..|+.||..=-   .+..-+-....|.   -|.|+.|+..|+..
T Consensus        75 ~kCpkCghe~m---~Y~T~QlRSADEGQTVFYTC~kC~~k~~e~  115 (116)
T KOG2907|consen   75 HKCPKCGHEEM---SYHTLQLRSADEGQTVFYTCPKCKYKFTEN  115 (116)
T ss_pred             ccCcccCCchh---hhhhhhcccccCCceEEEEcCccceeeecc
Confidence            46888874322   2222122223333   28999999888653


No 119
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=71.00  E-value=5.1  Score=17.57  Aligned_cols=23  Identities=30%  Similarity=0.671  Sum_probs=15.5

Q ss_pred             ccCCcccccccC--chhHHHHHHhc
Q psy10278         24 FQCPVCGFTTGR--KATLQLHVRQH   46 (110)
Q Consensus        24 ~~C~~c~~~~~~--~~~l~~h~~~~   46 (110)
                      -.|+.|++.+..  +.....|.+-|
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHH
Confidence            479999998764  35556665544


No 120
>KOG2785|consensus
Probab=71.00  E-value=6  Score=26.40  Aligned_cols=52  Identities=15%  Similarity=0.278  Sum_probs=40.4

Q ss_pred             CCccCCcccccccCchhHHHHHHhcCCC-----------------------CceeCCCCC---CCcCChHHHHHHHHh
Q psy10278         22 KPFQCPVCGFTTGRKATLQLHVRQHTRE-----------------------KPYACPTCE---FKTGDHNVLRKHVQR   73 (110)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~-----------------------~~~~c~~c~---~~~~~~~~l~~h~~~   73 (110)
                      -|-.|-.|+..+.+...-..||..++|-                       ..+.|..|+   +.|.+......|+..
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            3456888999999998888998866551                       346788887   888888888888873


No 121
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=70.34  E-value=1.8  Score=24.39  Aligned_cols=12  Identities=17%  Similarity=0.346  Sum_probs=7.5

Q ss_pred             eeCCCCCCCcCC
Q psy10278         52 YACPTCEFKTGD   63 (110)
Q Consensus        52 ~~c~~c~~~~~~   63 (110)
                      +.|..|+..|..
T Consensus        71 ~~C~~CG~~~~~   82 (135)
T PRK03824         71 LKCRNCGNEWSL   82 (135)
T ss_pred             EECCCCCCEEec
Confidence            567777765544


No 122
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=69.87  E-value=4.2  Score=19.43  Aligned_cols=30  Identities=27%  Similarity=0.674  Sum_probs=16.6

Q ss_pred             ccCCcccccccCchhHHHHHHhcCCCCceeCCCCCC
Q psy10278         24 FQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEF   59 (110)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~   59 (110)
                      |.|+ ||-.|...-.     ....|+....|+.|+-
T Consensus        23 yPCP-CGDRFeIsLe-----Dl~~GE~VArCPSCSL   52 (67)
T COG5216          23 YPCP-CGDRFEISLE-----DLRNGEVVARCPSCSL   52 (67)
T ss_pred             ecCC-CCCEeEEEHH-----HhhCCceEEEcCCceE
Confidence            4555 6666654321     2345666667777753


No 123
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=69.39  E-value=4.8  Score=18.00  Aligned_cols=9  Identities=33%  Similarity=1.165  Sum_probs=4.3

Q ss_pred             CceeccCCC
Q psy10278         78 KKYQCTFCS   86 (110)
Q Consensus        78 ~p~~C~~C~   86 (110)
                      ..|.|..|+
T Consensus        36 ~~~~C~~C~   44 (46)
T PF12760_consen   36 GRYRCKACR   44 (46)
T ss_pred             CeEECCCCC
Confidence            335555554


No 124
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=68.78  E-value=2.2  Score=18.86  Aligned_cols=14  Identities=21%  Similarity=0.555  Sum_probs=8.9

Q ss_pred             CceeccCCCccccc
Q psy10278         78 KKYQCTFCSYSCTE   91 (110)
Q Consensus        78 ~p~~C~~C~~~f~~   91 (110)
                      -|+.|..|+..|=.
T Consensus        12 ~~~~C~~C~~~FC~   25 (43)
T PF01428_consen   12 LPFKCKHCGKSFCL   25 (43)
T ss_dssp             SHEE-TTTS-EE-T
T ss_pred             CCeECCCCCcccCc
Confidence            57899999988854


No 125
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=68.52  E-value=2.7  Score=17.18  Aligned_cols=8  Identities=38%  Similarity=1.144  Sum_probs=3.6

Q ss_pred             ceeCCCCC
Q psy10278         51 PYACPTCE   58 (110)
Q Consensus        51 ~~~c~~c~   58 (110)
                      .+.|+.|+
T Consensus        19 ~~vCp~C~   26 (30)
T PF08274_consen   19 LLVCPECG   26 (30)
T ss_dssp             SEEETTTT
T ss_pred             EEeCCccc
Confidence            34444443


No 126
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=68.39  E-value=5.3  Score=29.15  Aligned_cols=49  Identities=16%  Similarity=0.445  Sum_probs=25.3

Q ss_pred             ccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCcc
Q psy10278         24 FQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSYS   88 (110)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~~   88 (110)
                      ..|..||..+.-+.- ...+..|-......|..|+..               ...|..|+.||..
T Consensus       436 l~C~~Cg~v~~Cp~C-d~~lt~H~~~~~L~CH~Cg~~---------------~~~p~~Cp~Cgs~  484 (730)
T COG1198         436 LLCRDCGYIAECPNC-DSPLTLHKATGQLRCHYCGYQ---------------EPIPQSCPECGSE  484 (730)
T ss_pred             eecccCCCcccCCCC-CcceEEecCCCeeEeCCCCCC---------------CCCCCCCCCCCCC
Confidence            346666665443210 011223444445666666532               2467888888854


No 127
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=68.02  E-value=2.8  Score=19.31  Aligned_cols=16  Identities=19%  Similarity=0.262  Sum_probs=12.3

Q ss_pred             CCceeccCCCcccccH
Q psy10278         77 VKKYQCTFCSYSCTER   92 (110)
Q Consensus        77 ~~p~~C~~C~~~f~~~   92 (110)
                      .+++.|..||..|..-
T Consensus         2 Dk~l~C~dCg~~FvfT   17 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFT   17 (49)
T ss_pred             CeeEEcccCCCeEEEe
Confidence            4678999999887643


No 128
>KOG2593|consensus
Probab=67.84  E-value=8.9  Score=26.09  Aligned_cols=36  Identities=22%  Similarity=0.548  Sum_probs=22.1

Q ss_pred             CCCceeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCC
Q psy10278         48 REKPYACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCS   86 (110)
Q Consensus        48 ~~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~   86 (110)
                      ....|.|+.|.+.|...-.+.-   .....--|.|..|+
T Consensus       125 ~~~~Y~Cp~C~kkyt~Lea~~L---~~~~~~~F~C~~C~  160 (436)
T KOG2593|consen  125 NVAGYVCPNCQKKYTSLEALQL---LDNETGEFHCENCG  160 (436)
T ss_pred             ccccccCCccccchhhhHHHHh---hcccCceEEEecCC
Confidence            4456888888888766544321   22223458888886


No 129
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=67.09  E-value=4.8  Score=27.68  Aligned_cols=22  Identities=27%  Similarity=0.572  Sum_probs=14.1

Q ss_pred             ceeCCCCCCCcCChHHHHHHHH
Q psy10278         51 PYACPTCEFKTGDHNVLRKHVQ   72 (110)
Q Consensus        51 ~~~c~~c~~~~~~~~~l~~h~~   72 (110)
                      -+.|+.|.+.|.....+..|+.
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~   78 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHME   78 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHH
Confidence            3566666666666666666666


No 130
>KOG2482|consensus
Probab=66.88  E-value=18  Score=24.08  Aligned_cols=66  Identities=21%  Similarity=0.399  Sum_probs=42.0

Q ss_pred             HHHHHHHHHHhcCCCCccCCccccccc-CchhHHHHHH-hcC---C------------------CCceeCCCCCCCcCCh
Q psy10278          8 KCLKKHIREVHKRLKPFQCPVCGFTTG-RKATLQLHVR-QHT---R------------------EKPYACPTCEFKTGDH   64 (110)
Q Consensus         8 ~~l~~h~~~~~~~~~~~~C~~c~~~~~-~~~~l~~h~~-~~~---~------------------~~~~~c~~c~~~~~~~   64 (110)
                      ..|..+++..-......+|-.|...+. ..+.+..|+. .|.   |                  -..+.|..|.+.|...
T Consensus       129 eaLeqqQ~Eredt~fslqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdk  208 (423)
T KOG2482|consen  129 EALEQQQKEREDTIFSLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDK  208 (423)
T ss_pred             HHHHHHHHHhcCCeeeeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCc
Confidence            345556543222223356888877644 4466667765 332   1                  1236899999999999


Q ss_pred             HHHHHHHHh
Q psy10278         65 NVLRKHVQR   73 (110)
Q Consensus        65 ~~l~~h~~~   73 (110)
                      ..|..|++.
T Consensus       209 ntLkeHMrk  217 (423)
T KOG2482|consen  209 NTLKEHMRK  217 (423)
T ss_pred             HHHHHHHHh
Confidence            999999983


No 131
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=66.72  E-value=5.3  Score=18.83  Aligned_cols=26  Identities=31%  Similarity=0.704  Sum_probs=18.0

Q ss_pred             ccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCc
Q psy10278         24 FQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKT   61 (110)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~   61 (110)
                      -.|+.|+..|....            ....|+.|+..+
T Consensus         6 ~~C~~Cg~~~~~~d------------DiVvCp~Cgapy   31 (54)
T PF14446_consen    6 CKCPVCGKKFKDGD------------DIVVCPECGAPY   31 (54)
T ss_pred             ccChhhCCcccCCC------------CEEECCCCCCcc
Confidence            46888888775433            246788888765


No 132
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=66.48  E-value=5.4  Score=17.94  Aligned_cols=22  Identities=32%  Similarity=0.827  Sum_probs=14.9

Q ss_pred             eeccCCCcccccHHHHHhhhhh
Q psy10278         80 YQCTFCSYSCTERFRLKDHTLA  101 (110)
Q Consensus        80 ~~C~~C~~~f~~~~~l~~H~~~  101 (110)
                      |+|-.|..+...++.|..||+.
T Consensus        21 ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHH
Confidence            5566666666677777777764


No 133
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=64.41  E-value=8.3  Score=26.82  Aligned_cols=10  Identities=20%  Similarity=0.474  Sum_probs=6.3

Q ss_pred             CceeccCCCc
Q psy10278         78 KKYQCTFCSY   87 (110)
Q Consensus        78 ~p~~C~~C~~   87 (110)
                      -|..|+.|+.
T Consensus       252 ~~~~Cp~C~s  261 (505)
T TIGR00595       252 IPKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCCC
Confidence            4566777764


No 134
>KOG4167|consensus
Probab=63.78  E-value=1.4  Score=31.71  Aligned_cols=25  Identities=24%  Similarity=0.473  Sum_probs=22.5

Q ss_pred             CccCCcccccccCchhHHHHHHhcC
Q psy10278         23 PFQCPVCGFTTGRKATLQLHVRQHT   47 (110)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~   47 (110)
                      .|.|.+|++.|.-.-++..||++|.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            4899999999999999999998885


No 135
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=62.93  E-value=15  Score=24.47  Aligned_cols=77  Identities=22%  Similarity=0.332  Sum_probs=50.5

Q ss_pred             cCCcccccccCchhHHHHHHhcCCCCceeCCCCC----CCcCChHHHHHHHHhcCCCCceeccC--CC----cccccHHH
Q psy10278         25 QCPVCGFTTGRKATLQLHVRQHTREKPYACPTCE----FKTGDHNVLRKHVQRHMPVKKYQCTF--CS----YSCTERFR   94 (110)
Q Consensus        25 ~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~----~~~~~~~~l~~h~~~h~~~~p~~C~~--C~----~~f~~~~~   94 (110)
                      .|..|...|.....|..|++.... +-+.|...+    ..|.....|..|.+.    -.|.|++  |.    ..|.....
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~HE-~ChICD~v~p~~~QYFK~Y~~Le~HF~~----~hy~ct~qtc~~~k~~vf~~~~e  296 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRHE-ACHICDMVGPIRYQYFKSYEDLEAHFRN----AHYCCTFQTCRVGKCYVFPYHTE  296 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhhh-hhhhhhccCccchhhhhCHHHHHHHhhc----CceEEEEEEEecCcEEEeccHHH
Confidence            589999999999999999985432 234443322    245555666666553    2355543  32    47888899


Q ss_pred             HHhhhhhcCCCC
Q psy10278         95 LKDHTLAKHNPG  106 (110)
Q Consensus        95 l~~H~~~~~~~~  106 (110)
                      |..|+...|+-+
T Consensus       297 l~~h~~~~h~~~  308 (493)
T COG5236         297 LLEHLTRFHKVN  308 (493)
T ss_pred             HHHHHHHHhhcc
Confidence            999998887643


No 136
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=60.08  E-value=4.4  Score=18.53  Aligned_cols=14  Identities=21%  Similarity=0.491  Sum_probs=9.6

Q ss_pred             eccCCCcccccHHH
Q psy10278         81 QCTFCSYSCTERFR   94 (110)
Q Consensus        81 ~C~~C~~~f~~~~~   94 (110)
                      .|+.|++.|+++..
T Consensus        14 ICpvCqRPFsWRkK   27 (54)
T COG4338          14 ICPVCQRPFSWRKK   27 (54)
T ss_pred             hhhhhcCchHHHHH
Confidence            57778877776543


No 137
>KOG1842|consensus
Probab=59.23  E-value=5.4  Score=27.23  Aligned_cols=22  Identities=23%  Similarity=0.659  Sum_probs=12.3

Q ss_pred             eeCCCCCCCcCChHHHHHHHHh
Q psy10278         52 YACPTCEFKTGDHNVLRKHVQR   73 (110)
Q Consensus        52 ~~c~~c~~~~~~~~~l~~h~~~   73 (110)
                      +.||.|...|.....|..|.-.
T Consensus        16 flCPiC~~dl~~~~~L~~H~d~   37 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLDV   37 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHhh
Confidence            4555555555555555555553


No 138
>PRK14873 primosome assembly protein PriA; Provisional
Probab=59.13  E-value=9.5  Score=27.61  Aligned_cols=11  Identities=18%  Similarity=0.739  Sum_probs=7.4

Q ss_pred             CceeccCCCcc
Q psy10278         78 KKYQCTFCSYS   88 (110)
Q Consensus        78 ~p~~C~~C~~~   88 (110)
                      .|+.|+.|+..
T Consensus       421 ~p~~Cp~Cgs~  431 (665)
T PRK14873        421 PDWRCPRCGSD  431 (665)
T ss_pred             cCccCCCCcCC
Confidence            36678888753


No 139
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=59.06  E-value=5.2  Score=22.66  Aligned_cols=22  Identities=18%  Similarity=0.119  Sum_probs=11.8

Q ss_pred             eeccCCCcccccHHHHHhhhhhcCC
Q psy10278         80 YQCTFCSYSCTERFRLKDHTLAKHN  104 (110)
Q Consensus        80 ~~C~~C~~~f~~~~~l~~H~~~~~~  104 (110)
                      ..|-++|+.|.   +|..|+.+|++
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~g   98 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYG   98 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccC
Confidence            45555555554   24555555554


No 140
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=58.81  E-value=4.3  Score=18.83  Aligned_cols=12  Identities=25%  Similarity=0.672  Sum_probs=6.1

Q ss_pred             eccCCCcccccH
Q psy10278         81 QCTFCSYSCTER   92 (110)
Q Consensus        81 ~C~~C~~~f~~~   92 (110)
                      .|+.|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            889999888743


No 141
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=58.54  E-value=11  Score=17.84  Aligned_cols=8  Identities=38%  Similarity=1.414  Sum_probs=3.9

Q ss_pred             ceeCCCCC
Q psy10278         51 PYACPTCE   58 (110)
Q Consensus        51 ~~~c~~c~   58 (110)
                      .|.|+.||
T Consensus        14 ~~~Cp~cG   21 (55)
T PF13824_consen   14 NFECPDCG   21 (55)
T ss_pred             CCcCCCCC
Confidence            34555554


No 142
>PF12907 zf-met2:  Zinc-binding
Probab=58.20  E-value=8.5  Score=16.91  Aligned_cols=27  Identities=30%  Similarity=0.535  Sum_probs=16.1

Q ss_pred             eeccCCCccc---ccHHHHHhhhhhcCCCC
Q psy10278         80 YQCTFCSYSC---TERFRLKDHTLAKHNPG  106 (110)
Q Consensus        80 ~~C~~C~~~f---~~~~~l~~H~~~~~~~~  106 (110)
                      +.|..|..+|   +....|..|-...|...
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~   31 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKN   31 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCC
Confidence            3566666444   34556777776666554


No 143
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=58.08  E-value=7.7  Score=18.79  Aligned_cols=9  Identities=33%  Similarity=0.947  Sum_probs=2.5

Q ss_pred             cCCcccccc
Q psy10278         25 QCPVCGFTT   33 (110)
Q Consensus        25 ~C~~c~~~~   33 (110)
                      .|..|+..|
T Consensus        11 ~C~~C~~~F   19 (69)
T PF01363_consen   11 NCMICGKKF   19 (69)
T ss_dssp             B-TTT--B-
T ss_pred             cCcCcCCcC
Confidence            355555555


No 144
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=57.79  E-value=7.6  Score=26.76  Aligned_cols=26  Identities=19%  Similarity=0.420  Sum_probs=22.6

Q ss_pred             CccCCcccccccCchhHHHHHH-hcCC
Q psy10278         23 PFQCPVCGFTTGRKATLQLHVR-QHTR   48 (110)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~-~~~~   48 (110)
                      -|.|+.|.+.|.....+..|+. .|.+
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhhhh
Confidence            3789999999999999999998 4654


No 145
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=57.48  E-value=11  Score=16.36  Aligned_cols=16  Identities=31%  Similarity=0.397  Sum_probs=7.8

Q ss_pred             eeCCCCCCCcCChHHH
Q psy10278         52 YACPTCEFKTGDHNVL   67 (110)
Q Consensus        52 ~~c~~c~~~~~~~~~l   67 (110)
                      ..|+.|+..+.....+
T Consensus        20 d~C~~C~G~W~d~~el   35 (41)
T PF13453_consen   20 DVCPSCGGIWFDAGEL   35 (41)
T ss_pred             EECCCCCeEEccHHHH
Confidence            4555555544444333


No 146
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=56.27  E-value=8.6  Score=17.71  Aligned_cols=12  Identities=25%  Similarity=0.938  Sum_probs=7.1

Q ss_pred             CceeccCCCccc
Q psy10278         78 KKYQCTFCSYSC   89 (110)
Q Consensus        78 ~p~~C~~C~~~f   89 (110)
                      .-+.|..|+..+
T Consensus        36 ~r~~C~~Cgyt~   47 (50)
T PRK00432         36 DRWHCGKCGYTE   47 (50)
T ss_pred             CcEECCCcCCEE
Confidence            346677776543


No 147
>PTZ00448 hypothetical protein; Provisional
Probab=56.21  E-value=8.8  Score=25.60  Aligned_cols=24  Identities=17%  Similarity=0.344  Sum_probs=21.1

Q ss_pred             ceeccCCCcccccHHHHHhhhhhc
Q psy10278         79 KYQCTFCSYSCTERFRLKDHTLAK  102 (110)
Q Consensus        79 p~~C~~C~~~f~~~~~l~~H~~~~  102 (110)
                      .|.|..|+..|......+.|+++-
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KSD  337 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRSE  337 (373)
T ss_pred             CccccccccccCCHHHHHHHhhhh
Confidence            588999999999888999998864


No 148
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=56.21  E-value=3  Score=22.26  Aligned_cols=36  Identities=25%  Similarity=0.569  Sum_probs=18.8

Q ss_pred             CCccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCc
Q psy10278         22 KPFQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKT   61 (110)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~   61 (110)
                      +.|.|+.|+..-.+...+..-    .......|..|+..|
T Consensus        21 k~FtCp~Cghe~vs~ctvkk~----~~~g~~~Cg~CGls~   56 (104)
T COG4888          21 KTFTCPRCGHEKVSSCTVKKT----VNIGTAVCGNCGLSF   56 (104)
T ss_pred             ceEecCccCCeeeeEEEEEec----CceeEEEcccCcceE
Confidence            347788887665544332211    122235677776655


No 149
>PRK05580 primosome assembly protein PriA; Validated
Probab=55.52  E-value=14  Score=26.78  Aligned_cols=10  Identities=20%  Similarity=0.424  Sum_probs=5.6

Q ss_pred             CceeccCCCc
Q psy10278         78 KKYQCTFCSY   87 (110)
Q Consensus        78 ~p~~C~~C~~   87 (110)
                      .|..|+.|+.
T Consensus       420 ~~~~Cp~Cg~  429 (679)
T PRK05580        420 IPKACPECGS  429 (679)
T ss_pred             CCCCCCCCcC
Confidence            3456666654


No 150
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=54.94  E-value=9.7  Score=26.15  Aligned_cols=30  Identities=23%  Similarity=0.519  Sum_probs=21.0

Q ss_pred             CCccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCChH
Q psy10278         22 KPFQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGDHN   65 (110)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~   65 (110)
                      ..|.|..||..+..+              ...|+.|+.+-+...
T Consensus         6 ~~y~C~~Cg~~~~~~--------------~g~Cp~C~~w~t~~~   35 (454)
T TIGR00416         6 SKFVCQHCGADSPKW--------------QGKCPACHAWNTITE   35 (454)
T ss_pred             CeEECCcCCCCCccc--------------cEECcCCCCccccch
Confidence            359999998765442              468999987665543


No 152
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=54.58  E-value=23  Score=21.13  Aligned_cols=8  Identities=25%  Similarity=0.941  Sum_probs=4.1

Q ss_pred             eeccCCCc
Q psy10278         80 YQCTFCSY   87 (110)
Q Consensus        80 ~~C~~C~~   87 (110)
                      |.|+.||-
T Consensus       133 F~Cp~Cg~  140 (176)
T COG1675         133 FTCPKCGE  140 (176)
T ss_pred             CCCCCCCc
Confidence            55555553


No 153
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=54.54  E-value=7.3  Score=21.33  Aligned_cols=11  Identities=18%  Similarity=0.604  Sum_probs=6.0

Q ss_pred             eeCCCCCCCcC
Q psy10278         52 YACPTCEFKTG   62 (110)
Q Consensus        52 ~~c~~c~~~~~   62 (110)
                      ..|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (115)
T TIGR00100        71 CECEDCSEEVS   81 (115)
T ss_pred             EEcccCCCEEe
Confidence            45666665543


No 154
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=54.39  E-value=7.1  Score=17.13  Aligned_cols=12  Identities=17%  Similarity=0.603  Sum_probs=8.1

Q ss_pred             CceeccCCCccc
Q psy10278         78 KKYQCTFCSYSC   89 (110)
Q Consensus        78 ~p~~C~~C~~~f   89 (110)
                      .+..|+.|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            356777777665


No 155
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=54.19  E-value=25  Score=16.95  Aligned_cols=13  Identities=15%  Similarity=0.708  Sum_probs=7.4

Q ss_pred             CCceeccCCCccc
Q psy10278         77 VKKYQCTFCSYSC   89 (110)
Q Consensus        77 ~~p~~C~~C~~~f   89 (110)
                      .+.|.|+.||...
T Consensus        44 ~r~~~C~~Cg~~~   56 (69)
T PF07282_consen   44 GRVFTCPNCGFEM   56 (69)
T ss_pred             cceEEcCCCCCEE
Confidence            3456666666553


No 156
>KOG1280|consensus
Probab=52.98  E-value=21  Score=23.76  Aligned_cols=23  Identities=22%  Similarity=0.511  Sum_probs=15.1

Q ss_pred             ceeCCCCCCCcCChHHHHHHHHh
Q psy10278         51 PYACPTCEFKTGDHNVLRKHVQR   73 (110)
Q Consensus        51 ~~~c~~c~~~~~~~~~l~~h~~~   73 (110)
                      .|.|+.|+.+-.....+..|...
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s  101 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLS  101 (381)
T ss_pred             cccCCcccccccchhHHHHHhhh
Confidence            46677777666666666666663


No 157
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=52.64  E-value=8.7  Score=20.97  Aligned_cols=10  Identities=20%  Similarity=0.272  Sum_probs=5.3

Q ss_pred             eeCCCCCCCc
Q psy10278         52 YACPTCEFKT   61 (110)
Q Consensus        52 ~~c~~c~~~~   61 (110)
                      ..|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (113)
T PRK12380         71 AWCWDCSQVV   80 (113)
T ss_pred             EEcccCCCEE
Confidence            4555665444


No 158
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=52.07  E-value=1.6  Score=19.07  Aligned_cols=9  Identities=44%  Similarity=0.980  Sum_probs=4.1

Q ss_pred             eeccCCCcc
Q psy10278         80 YQCTFCSYS   88 (110)
Q Consensus        80 ~~C~~C~~~   88 (110)
                      |.|..|+..
T Consensus        29 y~C~~C~~~   37 (40)
T smart00440       29 YVCTKCGHR   37 (40)
T ss_pred             EEeCCCCCE
Confidence            444444443


No 159
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=51.66  E-value=15  Score=16.91  Aligned_cols=10  Identities=30%  Similarity=0.507  Sum_probs=5.4

Q ss_pred             CCcccccccC
Q psy10278         26 CPVCGFTTGR   35 (110)
Q Consensus        26 C~~c~~~~~~   35 (110)
                      |..|+..|..
T Consensus         5 C~~C~~~F~~   14 (57)
T cd00065           5 CMGCGKPFTL   14 (57)
T ss_pred             CcccCccccC
Confidence            5556555543


No 160
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=51.44  E-value=7.5  Score=22.51  Aligned_cols=34  Identities=24%  Similarity=0.482  Sum_probs=20.0

Q ss_pred             CCceeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCc
Q psy10278         49 EKPYACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSY   87 (110)
Q Consensus        49 ~~~~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~   87 (110)
                      .-+|.|. |+..+...-   .|-..-.|+ -|.|..|+-
T Consensus       115 ~~~Y~C~-C~q~~l~~R---Rhn~~~~g~-~YrC~~C~g  148 (156)
T COG3091         115 TYPYRCQ-CQQHYLRIR---RHNTVRRGE-VYRCGKCGG  148 (156)
T ss_pred             ceeEEee-cCCccchhh---hcccccccc-eEEeccCCc
Confidence            3468888 887753332   222233344 688988864


No 161
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=51.37  E-value=5.5  Score=17.04  Aligned_cols=16  Identities=13%  Similarity=0.206  Sum_probs=8.9

Q ss_pred             eccCCCcccccHHHHH
Q psy10278         81 QCTFCSYSCTERFRLK   96 (110)
Q Consensus        81 ~C~~C~~~f~~~~~l~   96 (110)
                      .|+.|+++|-+.+..+
T Consensus         4 ~CprC~kg~Hwa~~C~   19 (36)
T PF14787_consen    4 LCPRCGKGFHWASECR   19 (36)
T ss_dssp             C-TTTSSSCS-TTT--
T ss_pred             cCcccCCCcchhhhhh
Confidence            5788888887765543


No 162
>KOG2923|consensus
Probab=51.06  E-value=16  Score=17.88  Aligned_cols=29  Identities=28%  Similarity=0.694  Sum_probs=14.5

Q ss_pred             ccCCcccccccCchhHHHHHHhcCCCCceeCCCCC
Q psy10278         24 FQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCE   58 (110)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~   58 (110)
                      |+|+ ||-.|.....     ..-.|+....|+.|+
T Consensus        23 yPCp-CGDrf~It~e-----dL~~ge~Va~CpsCS   51 (67)
T KOG2923|consen   23 YPCP-CGDRFQITLE-----DLENGEDVARCPSCS   51 (67)
T ss_pred             cCCC-CCCeeeecHH-----HHhCCCeeecCCCce
Confidence            4444 5655544321     223455556677665


No 163
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=50.92  E-value=3.4  Score=25.64  Aligned_cols=25  Identities=24%  Similarity=0.482  Sum_probs=16.3

Q ss_pred             CCCCccCCcccccccCchhHHHHHH
Q psy10278         20 RLKPFQCPVCGFTTGRKATLQLHVR   44 (110)
Q Consensus        20 ~~~~~~C~~c~~~~~~~~~l~~h~~   44 (110)
                      -++...||+|+..|..+...-..++
T Consensus        16 ~kk~ieCPvC~tkFkkeev~tgsiR   40 (267)
T COG1655          16 YKKTIECPVCNTKFKKEEVKTGSIR   40 (267)
T ss_pred             hhceeccCcccchhhhhheecccee
Confidence            3455789999998877654433333


No 164
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=49.67  E-value=2.8  Score=23.59  Aligned_cols=14  Identities=14%  Similarity=0.463  Sum_probs=10.2

Q ss_pred             CCCceeccCCCccc
Q psy10278         76 PVKKYQCTFCSYSC   89 (110)
Q Consensus        76 ~~~p~~C~~C~~~f   89 (110)
                      ++....|++|+..-
T Consensus       102 g~~~~~CPwCg~~g  115 (131)
T PF15616_consen  102 GEGEVTCPWCGNEG  115 (131)
T ss_pred             CCCCEECCCCCCee
Confidence            44568999998753


No 165
>PRK11823 DNA repair protein RadA; Provisional
Probab=49.61  E-value=13  Score=25.42  Aligned_cols=29  Identities=21%  Similarity=0.445  Sum_probs=19.6

Q ss_pred             CCccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCCh
Q psy10278         22 KPFQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGDH   64 (110)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~   64 (110)
                      ..|.|..||..+..+              ...|+.|+.+-+..
T Consensus         6 ~~y~C~~Cg~~~~~~--------------~g~Cp~C~~w~t~~   34 (446)
T PRK11823          6 TAYVCQECGAESPKW--------------LGRCPECGAWNTLV   34 (446)
T ss_pred             CeEECCcCCCCCccc--------------CeeCcCCCCcccee
Confidence            358999998765432              35788888765443


No 166
>PLN02748 tRNA dimethylallyltransferase
Probab=49.57  E-value=13  Score=25.71  Aligned_cols=26  Identities=15%  Similarity=0.404  Sum_probs=21.7

Q ss_pred             CceeccCCCc-ccccHHHHHhhhhhcC
Q psy10278         78 KKYQCTFCSY-SCTERFRLKDHTLAKH  103 (110)
Q Consensus        78 ~p~~C~~C~~-~f~~~~~l~~H~~~~~  103 (110)
                      +.|.|..|++ ++.....+..|+++..
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlksr~  443 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQGRG  443 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcchH
Confidence            5588999997 8999999999988654


No 167
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=48.72  E-value=3.3  Score=23.99  Aligned_cols=17  Identities=12%  Similarity=0.061  Sum_probs=12.2

Q ss_pred             CCceeccCCCcccccHH
Q psy10278         77 VKKYQCTFCSYSCTERF   93 (110)
Q Consensus        77 ~~p~~C~~C~~~f~~~~   93 (110)
                      +.|.-|..||+.|+|-.
T Consensus        66 ~~PsYC~~CGkpyPWt~   82 (158)
T PF10083_consen   66 EAPSYCHNCGKPYPWTE   82 (158)
T ss_pred             CCChhHHhCCCCCchHH
Confidence            46777888888887643


No 168
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=48.54  E-value=16  Score=17.03  Aligned_cols=16  Identities=25%  Similarity=0.488  Sum_probs=6.0

Q ss_pred             ceeCCCCCCCcCChHH
Q psy10278         51 PYACPTCEFKTGDHNV   66 (110)
Q Consensus        51 ~~~c~~c~~~~~~~~~   66 (110)
                      .|.|+.|...|...-.
T Consensus        21 ~y~C~~C~~~FC~dCD   36 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCD   36 (51)
T ss_dssp             EE--TTTT--B-HHHH
T ss_pred             eEECCCCCCccccCcC
Confidence            4666666666654433


No 169
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=47.63  E-value=20  Score=23.09  Aligned_cols=25  Identities=16%  Similarity=0.396  Sum_probs=15.6

Q ss_pred             ceeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCccc
Q psy10278         51 PYACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSYSC   89 (110)
Q Consensus        51 ~~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~~f   89 (110)
                      .|.|+.|...|...              |-.|+.|+-.|
T Consensus       255 GyvCs~Clsi~C~~--------------p~~C~~Cgt~f  279 (279)
T TIGR00627       255 GFVCSVCLSVLCQY--------------TPICKTCKTAF  279 (279)
T ss_pred             eEECCCccCCcCCC--------------CCCCCCCCCCC
Confidence            37777777666432              23677777654


No 170
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=47.21  E-value=18  Score=24.17  Aligned_cols=10  Identities=30%  Similarity=1.275  Sum_probs=5.9

Q ss_pred             ccCCcccccc
Q psy10278         24 FQCPVCGFTT   33 (110)
Q Consensus        24 ~~C~~c~~~~   33 (110)
                      |.|..||...
T Consensus         1 ~~c~~cg~~~   10 (372)
T cd01121           1 YVCSECGYVS   10 (372)
T ss_pred             CCCCCCCCCC
Confidence            4566666544


No 171
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=46.50  E-value=11  Score=21.18  Aligned_cols=15  Identities=27%  Similarity=0.702  Sum_probs=12.0

Q ss_pred             CCceeccCCCccccc
Q psy10278         77 VKKYQCTFCSYSCTE   91 (110)
Q Consensus        77 ~~p~~C~~C~~~f~~   91 (110)
                      .+-|.|+.|++.|..
T Consensus        51 ~qRyrC~~C~~tf~~   65 (129)
T COG3677          51 HQRYKCKSCGSTFTV   65 (129)
T ss_pred             ccccccCCcCcceee
Confidence            456899999998863


No 172
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=46.47  E-value=37  Score=20.66  Aligned_cols=11  Identities=18%  Similarity=0.407  Sum_probs=5.9

Q ss_pred             ceeCCCCCCCc
Q psy10278         51 PYACPTCEFKT   61 (110)
Q Consensus        51 ~~~c~~c~~~~   61 (110)
                      .+.|..||..+
T Consensus        30 lvrC~eCG~V~   40 (201)
T COG1326          30 LVRCEECGTVH   40 (201)
T ss_pred             EEEccCCCcEe
Confidence            34566666544


No 173
>KOG0717|consensus
Probab=46.41  E-value=14  Score=25.57  Aligned_cols=22  Identities=27%  Similarity=0.514  Sum_probs=16.6

Q ss_pred             eeccCCCcccccHHHHHhhhhh
Q psy10278         80 YQCTFCSYSCTERFRLKDHTLA  101 (110)
Q Consensus        80 ~~C~~C~~~f~~~~~l~~H~~~  101 (110)
                      +.|..|.++|.+...+..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            6688888888887777777653


No 174
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=46.36  E-value=15  Score=16.98  Aligned_cols=10  Identities=30%  Similarity=1.039  Sum_probs=4.6

Q ss_pred             eeCCCCCCCc
Q psy10278         52 YACPTCEFKT   61 (110)
Q Consensus        52 ~~c~~c~~~~   61 (110)
                      +.|+.|+..+
T Consensus        29 W~C~~Cgh~w   38 (55)
T PF14311_consen   29 WKCPKCGHEW   38 (55)
T ss_pred             EECCCCCCee
Confidence            3455554433


No 175
>KOG2807|consensus
Probab=45.47  E-value=43  Score=22.21  Aligned_cols=24  Identities=17%  Similarity=0.289  Sum_probs=15.0

Q ss_pred             eeccCCCcccccHHHHHhhhhhcC
Q psy10278         80 YQCTFCSYSCTERFRLKDHTLAKH  103 (110)
Q Consensus        80 ~~C~~C~~~f~~~~~l~~H~~~~~  103 (110)
                      |.|..|...|--.-+...|-.-|.
T Consensus       346 y~C~~Ck~~FCldCDv~iHesLh~  369 (378)
T KOG2807|consen  346 YRCESCKNVFCLDCDVFIHESLHN  369 (378)
T ss_pred             EEchhccceeeccchHHHHhhhhc
Confidence            677777777766665555554443


No 176
>PRK00420 hypothetical protein; Validated
Probab=45.45  E-value=20  Score=19.72  Aligned_cols=28  Identities=25%  Similarity=0.430  Sum_probs=16.0

Q ss_pred             ccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcC
Q psy10278         24 FQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTG   62 (110)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~   62 (110)
                      -.||.|+..+...         ..  ....|+.|+....
T Consensus        24 ~~CP~Cg~pLf~l---------k~--g~~~Cp~Cg~~~~   51 (112)
T PRK00420         24 KHCPVCGLPLFEL---------KD--GEVVCPVHGKVYI   51 (112)
T ss_pred             CCCCCCCCcceec---------CC--CceECCCCCCeee
Confidence            4588887654321         11  2457888877443


No 177
>PRK04023 DNA polymerase II large subunit; Validated
Probab=44.40  E-value=29  Score=26.72  Aligned_cols=9  Identities=44%  Similarity=1.150  Sum_probs=6.4

Q ss_pred             ccCCccccc
Q psy10278         24 FQCPVCGFT   32 (110)
Q Consensus        24 ~~C~~c~~~   32 (110)
                      ..|+.||..
T Consensus       627 RfCpsCG~~  635 (1121)
T PRK04023        627 RKCPSCGKE  635 (1121)
T ss_pred             ccCCCCCCc
Confidence            568888765


No 178
>KOG4118|consensus
Probab=44.35  E-value=9.5  Score=18.69  Aligned_cols=27  Identities=26%  Similarity=0.418  Sum_probs=16.2

Q ss_pred             eeccCCCcccccHHHHHhhhhhcCCCC
Q psy10278         80 YQCTFCSYSCTERFRLKDHTLAKHNPG  106 (110)
Q Consensus        80 ~~C~~C~~~f~~~~~l~~H~~~~~~~~  106 (110)
                      ++|.+|--.-.....+..|....|...
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~kHpk~   65 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFENKHPKE   65 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhhcCCCC
Confidence            566666655555556666666666544


No 179
>PLN02294 cytochrome c oxidase subunit Vb
Probab=44.02  E-value=15  Score=21.71  Aligned_cols=18  Identities=17%  Similarity=0.390  Sum_probs=13.6

Q ss_pred             hcCCCCceeccCCCccccc
Q psy10278         73 RHMPVKKYQCTFCSYSCTE   91 (110)
Q Consensus        73 ~h~~~~p~~C~~C~~~f~~   91 (110)
                      .+. .+|..|++||..|.-
T Consensus       136 L~k-Gkp~RCpeCG~~fkL  153 (174)
T PLN02294        136 LEK-GKSFECPVCTQYFEL  153 (174)
T ss_pred             ecC-CCceeCCCCCCEEEE
Confidence            344 478999999998863


No 180
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=43.79  E-value=13  Score=20.42  Aligned_cols=12  Identities=17%  Similarity=0.467  Sum_probs=7.4

Q ss_pred             eeCCCCCCCcCC
Q psy10278         52 YACPTCEFKTGD   63 (110)
Q Consensus        52 ~~c~~c~~~~~~   63 (110)
                      ..|..|+..|..
T Consensus        72 ~~C~~Cg~~~~~   83 (117)
T PRK00564         72 LECKDCSHVFKP   83 (117)
T ss_pred             EEhhhCCCcccc
Confidence            467777765533


No 181
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=43.77  E-value=12  Score=19.01  Aligned_cols=10  Identities=30%  Similarity=0.969  Sum_probs=6.2

Q ss_pred             ccCCcccccc
Q psy10278         24 FQCPVCGFTT   33 (110)
Q Consensus        24 ~~C~~c~~~~   33 (110)
                      |.|..|+..|
T Consensus        13 Y~c~~cg~~~   22 (82)
T COG2331          13 YECTECGNRF   22 (82)
T ss_pred             EeecccchHH
Confidence            6666666654


No 182
>COG1773 Rubredoxin [Energy production and conversion]
Probab=42.95  E-value=12  Score=17.71  Aligned_cols=12  Identities=25%  Similarity=1.099  Sum_probs=8.2

Q ss_pred             ceeccCCCcccc
Q psy10278         79 KYQCTFCSYSCT   90 (110)
Q Consensus        79 p~~C~~C~~~f~   90 (110)
                      .|.|..||..|-
T Consensus         3 ~~~C~~CG~vYd   14 (55)
T COG1773           3 RWRCSVCGYVYD   14 (55)
T ss_pred             ceEecCCceEec
Confidence            467777777664


No 183
>PHA02998 RNA polymerase subunit; Provisional
Probab=42.94  E-value=4.5  Score=24.06  Aligned_cols=12  Identities=17%  Similarity=0.348  Sum_probs=9.5

Q ss_pred             eeccCCCccccc
Q psy10278         80 YQCTFCSYSCTE   91 (110)
Q Consensus        80 ~~C~~C~~~f~~   91 (110)
                      |.|..|+..|.-
T Consensus       172 YkC~~CG~~wkp  183 (195)
T PHA02998        172 HACRDCKKHFKP  183 (195)
T ss_pred             EEcCCCCCccCC
Confidence            889999887753


No 184
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=42.69  E-value=16  Score=15.43  Aligned_cols=13  Identities=23%  Similarity=0.467  Sum_probs=5.8

Q ss_pred             CceeccCCCcccc
Q psy10278         78 KKYQCTFCSYSCT   90 (110)
Q Consensus        78 ~p~~C~~C~~~f~   90 (110)
                      .+..|+.||..++
T Consensus        20 ~~isC~~CGPr~~   32 (35)
T PF07503_consen   20 QFISCTNCGPRYS   32 (35)
T ss_dssp             TT--BTTCC-SCC
T ss_pred             cCccCCCCCCCEE
Confidence            3456777776543


No 185
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=42.47  E-value=15  Score=15.40  Aligned_cols=21  Identities=19%  Similarity=0.363  Sum_probs=12.9

Q ss_pred             ceeccCCCcccccHHHHHhhhh
Q psy10278         79 KYQCTFCSYSCTERFRLKDHTL  100 (110)
Q Consensus        79 p~~C~~C~~~f~~~~~l~~H~~  100 (110)
                      .+.|+.|++.+.. +-+..|+.
T Consensus         4 ~~~C~nC~R~v~a-~RfA~HLe   24 (33)
T PF08209_consen    4 YVECPNCGRPVAA-SRFAPHLE   24 (33)
T ss_dssp             EEE-TTTSSEEEG-GGHHHHHH
T ss_pred             eEECCCCcCCcch-hhhHHHHH
Confidence            4789999987653 34455553


No 186
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=41.59  E-value=15  Score=19.90  Aligned_cols=22  Identities=18%  Similarity=0.256  Sum_probs=13.7

Q ss_pred             eeccCCCcccccHHHHHhhhhh
Q psy10278         80 YQCTFCSYSCTERFRLKDHTLA  101 (110)
Q Consensus        80 ~~C~~C~~~f~~~~~l~~H~~~  101 (110)
                      +-|-+|.+-|.....|..|++.
T Consensus        56 hYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          56 HYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             eeeehhHHHHHHHHHHHHHhcc
Confidence            5566666666666666666653


No 187
>COG2879 Uncharacterized small protein [Function unknown]
Probab=40.59  E-value=33  Score=16.73  Aligned_cols=18  Identities=17%  Similarity=0.135  Sum_probs=11.0

Q ss_pred             ccHHHHHhhhhhcCCCCC
Q psy10278         90 TERFRLKDHTLAKHNPGT  107 (110)
Q Consensus        90 ~~~~~l~~H~~~~~~~~~  107 (110)
                      +...++..|++.+|.+.+
T Consensus        23 pdYdnYVehmr~~hPd~p   40 (65)
T COG2879          23 PDYDNYVEHMRKKHPDKP   40 (65)
T ss_pred             CcHHHHHHHHHHhCcCCC
Confidence            355566667776666554


No 188
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=39.65  E-value=14  Score=16.90  Aligned_cols=8  Identities=38%  Similarity=1.493  Sum_probs=2.5

Q ss_pred             ccCCcccc
Q psy10278         24 FQCPVCGF   31 (110)
Q Consensus        24 ~~C~~c~~   31 (110)
                      |.|++|++
T Consensus        42 W~CPiC~~   49 (50)
T PF02891_consen   42 WKCPICNK   49 (50)
T ss_dssp             -B-TTT--
T ss_pred             eECcCCcC
Confidence            66666653


No 189
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=39.45  E-value=16  Score=19.68  Aligned_cols=10  Identities=50%  Similarity=1.255  Sum_probs=6.2

Q ss_pred             CccCCccccc
Q psy10278         23 PFQCPVCGFT   32 (110)
Q Consensus        23 ~~~C~~c~~~   32 (110)
                      |-.|+.|+..
T Consensus         2 p~~CpYCg~~   11 (102)
T PF11672_consen    2 PIICPYCGGP   11 (102)
T ss_pred             CcccCCCCCe
Confidence            4457777664


No 190
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=39.16  E-value=15  Score=19.36  Aligned_cols=27  Identities=37%  Similarity=0.978  Sum_probs=19.1

Q ss_pred             CCccCCcccccccCchhHHHHHHhcCCCCceeCCCCC
Q psy10278         22 KPFQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCE   58 (110)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~   58 (110)
                      .|-.|..||+.|....          -.+|..|+.|.
T Consensus        57 ~Pa~CkkCGfef~~~~----------ik~pSRCP~CK   83 (97)
T COG3357          57 RPARCKKCGFEFRDDK----------IKKPSRCPKCK   83 (97)
T ss_pred             cChhhcccCccccccc----------cCCcccCCcch
Confidence            5678999999987621          12466788874


No 191
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=39.07  E-value=12  Score=20.41  Aligned_cols=13  Identities=15%  Similarity=0.419  Sum_probs=7.3

Q ss_pred             eeCCCCCCCcCCh
Q psy10278         52 YACPTCEFKTGDH   64 (110)
Q Consensus        52 ~~c~~c~~~~~~~   64 (110)
                      ..|..|+..|...
T Consensus        71 ~~C~~Cg~~~~~~   83 (113)
T PF01155_consen   71 ARCRDCGHEFEPD   83 (113)
T ss_dssp             EEETTTS-EEECH
T ss_pred             EECCCCCCEEecC
Confidence            4677777666444


No 192
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=38.74  E-value=18  Score=15.07  Aligned_cols=10  Identities=40%  Similarity=0.836  Sum_probs=5.1

Q ss_pred             eeccCCCccc
Q psy10278         80 YQCTFCSYSC   89 (110)
Q Consensus        80 ~~C~~C~~~f   89 (110)
                      +.|..|+..|
T Consensus        22 ~~C~~Cg~~~   31 (33)
T PF08792_consen   22 EVCIFCGSSF   31 (33)
T ss_pred             EEcccCCcEe
Confidence            4455555544


No 193
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=37.46  E-value=23  Score=18.92  Aligned_cols=17  Identities=18%  Similarity=0.254  Sum_probs=13.3

Q ss_pred             hcCCCCceeccCCCcccc
Q psy10278         73 RHMPVKKYQCTFCSYSCT   90 (110)
Q Consensus        73 ~h~~~~p~~C~~C~~~f~   90 (110)
                      .+.+ +|..|..||.-|.
T Consensus        74 l~~g-~~~rC~eCG~~fk   90 (97)
T cd00924          74 LEKG-KPKRCPECGHVFK   90 (97)
T ss_pred             EeCC-CceeCCCCCcEEE
Confidence            4455 7999999998875


No 194
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=37.04  E-value=19  Score=19.69  Aligned_cols=10  Identities=30%  Similarity=0.597  Sum_probs=6.6

Q ss_pred             eeCCCCCCCc
Q psy10278         52 YACPTCEFKT   61 (110)
Q Consensus        52 ~~c~~c~~~~   61 (110)
                      ..|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (114)
T PRK03681         71 CWCETCQQYV   80 (114)
T ss_pred             EEcccCCCee
Confidence            5677777654


No 195
>PF06676 DUF1178:  Protein of unknown function (DUF1178);  InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown.
Probab=36.93  E-value=26  Score=20.29  Aligned_cols=29  Identities=24%  Similarity=0.580  Sum_probs=14.7

Q ss_pred             chhcHHHHHHHHHHHhcCCCCccCCcccccccCc
Q psy10278          3 FYADIKCLKKHIREVHKRLKPFQCPVCGFTTGRK   36 (110)
Q Consensus         3 ~f~~~~~l~~h~~~~~~~~~~~~C~~c~~~~~~~   36 (110)
                      +|.+..++.....   .|  ...|++||..--.+
T Consensus        17 WF~ss~~fd~Q~~---~g--lv~CP~Cgs~~V~K   45 (148)
T PF06676_consen   17 WFRSSAAFDRQQA---RG--LVSCPVCGSTEVSK   45 (148)
T ss_pred             ecCCHHHHHHHHH---cC--CccCCCCCCCeEee
Confidence            4555555555542   11  34577776554333


No 196
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=36.71  E-value=50  Score=15.30  Aligned_cols=11  Identities=18%  Similarity=0.338  Sum_probs=5.9

Q ss_pred             CCceeccCCCc
Q psy10278         77 VKKYQCTFCSY   87 (110)
Q Consensus        77 ~~p~~C~~C~~   87 (110)
                      +....|+.|++
T Consensus        44 ~~i~~Cp~CgR   54 (56)
T PF02591_consen   44 DEIVFCPNCGR   54 (56)
T ss_pred             CCeEECcCCCc
Confidence            34455666654


No 197
>KOG0978|consensus
Probab=36.65  E-value=13  Score=27.05  Aligned_cols=21  Identities=14%  Similarity=0.293  Sum_probs=15.5

Q ss_pred             CceeccCCCcccccHHHHHhh
Q psy10278         78 KKYQCTFCSYSCTERFRLKDH   98 (110)
Q Consensus        78 ~p~~C~~C~~~f~~~~~l~~H   98 (110)
                      |.-+||.|+.+|.....+..|
T Consensus       677 RqRKCP~Cn~aFganDv~~I~  697 (698)
T KOG0978|consen  677 RQRKCPKCNAAFGANDVHRIH  697 (698)
T ss_pred             hcCCCCCCCCCCCcccccccC
Confidence            445899999999877665544


No 198
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=36.48  E-value=23  Score=15.30  Aligned_cols=14  Identities=29%  Similarity=0.603  Sum_probs=9.3

Q ss_pred             CCccCCcccccccC
Q psy10278         22 KPFQCPVCGFTTGR   35 (110)
Q Consensus        22 ~~~~C~~c~~~~~~   35 (110)
                      +.+.|+.||+.+.+
T Consensus        31 p~~~C~~CGE~~~~   44 (46)
T TIGR03831        31 PALVCPQCGEEYLD   44 (46)
T ss_pred             CccccccCCCEeeC
Confidence            34678888877644


No 199
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=36.19  E-value=60  Score=21.14  Aligned_cols=22  Identities=23%  Similarity=0.433  Sum_probs=12.1

Q ss_pred             ceeCCCCCCCcCChHHHHHHHH
Q psy10278         51 PYACPTCEFKTGDHNVLRKHVQ   72 (110)
Q Consensus        51 ~~~c~~c~~~~~~~~~l~~h~~   72 (110)
                      -|.|..|-+.|.....+..|+.
T Consensus        48 lyiCe~Clky~~~~~~l~~H~~   69 (290)
T PLN03238         48 LYICEYCLKYMRKKKSLLRHLA   69 (290)
T ss_pred             EEEcCCCcchhCCHHHHHHHHH
Confidence            3555555555555555555544


No 200
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=35.75  E-value=14  Score=20.66  Aligned_cols=15  Identities=13%  Similarity=0.120  Sum_probs=7.4

Q ss_pred             CCceeccCCCccccc
Q psy10278         77 VKKYQCTFCSYSCTE   91 (110)
Q Consensus        77 ~~p~~C~~C~~~f~~   91 (110)
                      +.|--|.-||+.|+|
T Consensus        66 e~psfchncgs~fpw   80 (160)
T COG4306          66 EPPSFCHNCGSRFPW   80 (160)
T ss_pred             CCcchhhcCCCCCCc
Confidence            334445555555554


No 201
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=35.35  E-value=24  Score=24.29  Aligned_cols=27  Identities=26%  Similarity=0.678  Sum_probs=17.9

Q ss_pred             CCccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcC
Q psy10278         22 KPFQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTG   62 (110)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~   62 (110)
                      ..|.|..||.....+              .-+|+.|+.+-+
T Consensus         6 t~f~C~~CG~~s~KW--------------~GkCp~Cg~Wns   32 (456)
T COG1066           6 TAFVCQECGYVSPKW--------------LGKCPACGAWNT   32 (456)
T ss_pred             cEEEcccCCCCCccc--------------cccCCCCCCccc
Confidence            358899998765443              236888876543


No 202
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=35.32  E-value=19  Score=19.25  Aligned_cols=34  Identities=24%  Similarity=0.515  Sum_probs=17.4

Q ss_pred             CccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCC
Q psy10278         23 PFQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGD   63 (110)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~   63 (110)
                      .+.|+.|+.. ...-.+      ..+.....|+.|+..+..
T Consensus        21 ~f~CP~Cge~-~v~v~~------~k~~~h~~C~~CG~y~~~   54 (99)
T PRK14892         21 IFECPRCGKV-SISVKI------KKNIAIITCGNCGLYTEF   54 (99)
T ss_pred             EeECCCCCCe-Eeeeec------CCCcceEECCCCCCccCE
Confidence            4778888732 111111      113334578888765543


No 203
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=35.08  E-value=42  Score=15.53  Aligned_cols=10  Identities=30%  Similarity=1.162  Sum_probs=6.4

Q ss_pred             ceeccCCCcc
Q psy10278         79 KYQCTFCSYS   88 (110)
Q Consensus        79 p~~C~~C~~~   88 (110)
                      -+.|..|+.+
T Consensus        37 R~~CGkCgyT   46 (51)
T COG1998          37 RWACGKCGYT   46 (51)
T ss_pred             eeEeccccce
Confidence            4667777654


No 204
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=35.08  E-value=20  Score=16.52  Aligned_cols=12  Identities=25%  Similarity=1.121  Sum_probs=8.4

Q ss_pred             ccCCcccccccC
Q psy10278         24 FQCPVCGFTTGR   35 (110)
Q Consensus        24 ~~C~~c~~~~~~   35 (110)
                      |.|..|+..+..
T Consensus         2 y~C~~CgyiYd~   13 (50)
T cd00730           2 YECRICGYIYDP   13 (50)
T ss_pred             cCCCCCCeEECC
Confidence            677777777654


No 205
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=34.54  E-value=18  Score=20.13  Aligned_cols=12  Identities=17%  Similarity=0.578  Sum_probs=7.6

Q ss_pred             eeCCCCCCCcCCh
Q psy10278         52 YACPTCEFKTGDH   64 (110)
Q Consensus        52 ~~c~~c~~~~~~~   64 (110)
                      ..| .|+..|...
T Consensus        71 ~~C-~Cg~~~~~~   82 (124)
T PRK00762         71 IEC-ECGYEGVVD   82 (124)
T ss_pred             EEe-eCcCccccc
Confidence            567 787666443


No 206
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=34.49  E-value=20  Score=15.16  Aligned_cols=12  Identities=17%  Similarity=0.487  Sum_probs=5.9

Q ss_pred             eeccCCCccccc
Q psy10278         80 YQCTFCSYSCTE   91 (110)
Q Consensus        80 ~~C~~C~~~f~~   91 (110)
                      -.|..|++.|..
T Consensus         4 ~~C~eC~~~f~d   15 (34)
T PF01286_consen    4 PKCDECGKPFMD   15 (34)
T ss_dssp             EE-TTT--EES-
T ss_pred             chHhHhCCHHHH
Confidence            368888888864


No 207
>KOG1088|consensus
Probab=34.38  E-value=25  Score=19.47  Aligned_cols=20  Identities=5%  Similarity=-0.082  Sum_probs=15.3

Q ss_pred             hcCCCCceeccCCCcccccH
Q psy10278         73 RHMPVKKYQCTFCSYSCTER   92 (110)
Q Consensus        73 ~h~~~~p~~C~~C~~~f~~~   92 (110)
                      .+..|....|+.||+.|.=.
T Consensus        92 ~~v~EG~l~CpetG~vfpI~  111 (124)
T KOG1088|consen   92 IDVIEGELVCPETGRVFPIS  111 (124)
T ss_pred             hhhccceEecCCCCcEeecc
Confidence            45567778999999998744


No 208
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=34.33  E-value=19  Score=16.90  Aligned_cols=11  Identities=18%  Similarity=0.685  Sum_probs=7.1

Q ss_pred             eeccCCCcccc
Q psy10278         80 YQCTFCSYSCT   90 (110)
Q Consensus        80 ~~C~~C~~~f~   90 (110)
                      ++|+.|+..+.
T Consensus         3 ~~CP~CG~~ie   13 (54)
T TIGR01206         3 FECPDCGAEIE   13 (54)
T ss_pred             cCCCCCCCEEe
Confidence            56777776553


No 209
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=34.00  E-value=21  Score=19.22  Aligned_cols=15  Identities=33%  Similarity=0.647  Sum_probs=10.7

Q ss_pred             CCccCCcccccccCc
Q psy10278         22 KPFQCPVCGFTTGRK   36 (110)
Q Consensus        22 ~~~~C~~c~~~~~~~   36 (110)
                      +|+.|.-||..|..-
T Consensus         1 MpH~CtrCG~vf~~g   15 (112)
T COG3364           1 MPHQCTRCGEVFDDG   15 (112)
T ss_pred             CCceecccccccccc
Confidence            366788888877764


No 210
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=33.95  E-value=35  Score=23.42  Aligned_cols=14  Identities=14%  Similarity=0.645  Sum_probs=7.5

Q ss_pred             ceeCCCCCCCcCCh
Q psy10278         51 PYACPTCEFKTGDH   64 (110)
Q Consensus        51 ~~~c~~c~~~~~~~   64 (110)
                      -|.|+-|+..+...
T Consensus       367 g~rC~kCg~~~~~~  380 (421)
T COG1571         367 GFRCKKCGTRARET  380 (421)
T ss_pred             CcccccccccCCcc
Confidence            45666666554433


No 211
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=33.67  E-value=24  Score=16.05  Aligned_cols=11  Identities=45%  Similarity=1.222  Sum_probs=7.0

Q ss_pred             eeccCCCcccc
Q psy10278         80 YQCTFCSYSCT   90 (110)
Q Consensus        80 ~~C~~C~~~f~   90 (110)
                      |.|..|+..+.
T Consensus         2 y~C~~CgyvYd   12 (47)
T PF00301_consen    2 YQCPVCGYVYD   12 (47)
T ss_dssp             EEETTTSBEEE
T ss_pred             cCCCCCCEEEc
Confidence            56777776553


No 212
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=33.41  E-value=1.1e+02  Score=18.14  Aligned_cols=53  Identities=28%  Similarity=0.567  Sum_probs=29.4

Q ss_pred             ceeCCCCCCCcCChHHHHHHHHhcCCCCceeccC--CCcccccHHHHHhhhhhcCCC
Q psy10278         51 PYACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTF--CSYSCTERFRLKDHTLAKHNP  105 (110)
Q Consensus        51 ~~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~--C~~~f~~~~~l~~H~~~~~~~  105 (110)
                      ...|+.|.......... .--+.+...|+-.|..  |... .....|++|.+..|..
T Consensus        80 ~L~CPLCRG~V~GWtvv-e~AR~~LN~K~RsC~~e~C~F~-GtY~eLrKHar~~HP~  134 (162)
T PF07800_consen   80 ELACPLCRGEVKGWTVV-EPARRFLNAKKRSCSQESCSFS-GTYSELRKHARSEHPS  134 (162)
T ss_pred             cccCccccCceeceEEc-hHHHHHhccCCccCcccccccc-cCHHHHHHHHHhhCCC
Confidence            46788876443332222 2234445556656644  4332 3667888888877754


No 213
>KOG2071|consensus
Probab=33.30  E-value=35  Score=24.38  Aligned_cols=29  Identities=24%  Similarity=0.445  Sum_probs=23.2

Q ss_pred             cCCCCccCCcccccccCchhHHHHHHhcC
Q psy10278         19 KRLKPFQCPVCGFTTGRKATLQLHVRQHT   47 (110)
Q Consensus        19 ~~~~~~~C~~c~~~~~~~~~l~~h~~~~~   47 (110)
                      ....|-.|..||.+|........||..|.
T Consensus       414 y~~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  414 YKDSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             ccCCcchhcccccccccchhhhhHhhhhh
Confidence            34567889999999999988887776664


No 214
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=33.27  E-value=28  Score=16.31  Aligned_cols=11  Identities=36%  Similarity=0.887  Sum_probs=6.9

Q ss_pred             CccCCcccccc
Q psy10278         23 PFQCPVCGFTT   33 (110)
Q Consensus        23 ~~~C~~c~~~~   33 (110)
                      ...||+||...
T Consensus         3 LkPCPFCG~~~   13 (61)
T PF14354_consen    3 LKPCPFCGSAD   13 (61)
T ss_pred             CcCCCCCCCcc
Confidence            34588886543


No 215
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=32.65  E-value=10  Score=17.08  Aligned_cols=13  Identities=31%  Similarity=0.496  Sum_probs=6.2

Q ss_pred             CceeccC--CCcccc
Q psy10278         78 KKYQCTF--CSYSCT   90 (110)
Q Consensus        78 ~p~~C~~--C~~~f~   90 (110)
                      .-+.|.-  ||..|.
T Consensus        24 ~Y~qC~N~~Cg~tfv   38 (47)
T PF04606_consen   24 LYCQCTNPECGHTFV   38 (47)
T ss_pred             EEEEECCCcCCCEEE
Confidence            3344532  555554


No 216
>PRK12496 hypothetical protein; Provisional
Probab=32.61  E-value=31  Score=20.21  Aligned_cols=12  Identities=25%  Similarity=0.445  Sum_probs=7.6

Q ss_pred             ceeCCCCCCCcC
Q psy10278         51 PYACPTCEFKTG   62 (110)
Q Consensus        51 ~~~c~~c~~~~~   62 (110)
                      .+.|..|++.|.
T Consensus       127 ~~~C~gC~~~~~  138 (164)
T PRK12496        127 RKVCKGCKKKYP  138 (164)
T ss_pred             eEECCCCCcccc
Confidence            356777776664


No 217
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=32.24  E-value=26  Score=19.85  Aligned_cols=15  Identities=33%  Similarity=0.704  Sum_probs=11.1

Q ss_pred             CccCCcccccccCch
Q psy10278         23 PFQCPVCGFTTGRKA   37 (110)
Q Consensus        23 ~~~C~~c~~~~~~~~   37 (110)
                      |++|..|+..|..-+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            567888888887654


No 218
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=32.21  E-value=24  Score=15.10  Aligned_cols=12  Identities=25%  Similarity=0.755  Sum_probs=6.3

Q ss_pred             CceeccCCCccc
Q psy10278         78 KKYQCTFCSYSC   89 (110)
Q Consensus        78 ~p~~C~~C~~~f   89 (110)
                      +-|+|..||...
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            458899888654


No 219
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=32.04  E-value=12  Score=20.44  Aligned_cols=11  Identities=45%  Similarity=1.162  Sum_probs=9.0

Q ss_pred             eeccCCCcccc
Q psy10278         80 YQCTFCSYSCT   90 (110)
Q Consensus        80 ~~C~~C~~~f~   90 (110)
                      |.|..||..+.
T Consensus       101 y~C~~Cg~~wr  111 (113)
T COG1594         101 YKCTRCGYRWR  111 (113)
T ss_pred             EEecccCCEee
Confidence            89999988764


No 220
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=31.33  E-value=65  Score=20.62  Aligned_cols=10  Identities=20%  Similarity=1.085  Sum_probs=5.0

Q ss_pred             CceeccCCCc
Q psy10278         78 KKYQCTFCSY   87 (110)
Q Consensus        78 ~p~~C~~C~~   87 (110)
                      +-|.|+.||.
T Consensus       321 r~~~C~~cg~  330 (364)
T COG0675         321 RLFKCPRCGF  330 (364)
T ss_pred             eeEECCCCCC
Confidence            3455555554


No 221
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=31.08  E-value=3.1  Score=30.17  Aligned_cols=58  Identities=22%  Similarity=0.399  Sum_probs=33.5

Q ss_pred             CCcccccccCchhHHHHHHhcCCCCce-eCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCcccc
Q psy10278         26 CPVCGFTTGRKATLQLHVRQHTREKPY-ACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSYSCT   90 (110)
Q Consensus        26 C~~c~~~~~~~~~l~~h~~~~~~~~~~-~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~~f~   90 (110)
                      |..||-.|.....|-- .+..+.-..+ .|+.|.+.+..+..    .+.|.  .+..|+.||....
T Consensus        93 Ct~CGPr~~i~~~lpy-dr~~t~m~~f~~C~~C~~ey~~p~~----rr~h~--~~~~C~~Cgp~l~  151 (711)
T TIGR00143        93 CTHCGPRFTIIEALPY-DRENTSMADFPLCPDCAKEYKDPLD----RRFHA--QPIACPRCGPQLN  151 (711)
T ss_pred             ccCCCCCeEEeecCCC-CCCCcCCCCCcCCHHHHHHhcCCcc----ccCCC--CCccCCCCCcEEE
Confidence            7888888876654321 1122222222 57777766655533    33443  6789999997653


No 222
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=30.76  E-value=39  Score=25.46  Aligned_cols=12  Identities=33%  Similarity=0.689  Sum_probs=7.7

Q ss_pred             cCCcccccccCc
Q psy10278         25 QCPVCGFTTGRK   36 (110)
Q Consensus        25 ~C~~c~~~~~~~   36 (110)
                      .|..|+..|...
T Consensus       462 tC~~C~kkFfSl  473 (1374)
T PTZ00303        462 SCPSCGRAFISL  473 (1374)
T ss_pred             cccCcCCccccc
Confidence            477777776543


No 223
>KOG1994|consensus
Probab=30.63  E-value=31  Score=21.55  Aligned_cols=23  Identities=26%  Similarity=0.625  Sum_probs=18.9

Q ss_pred             CCceeccCCCcccccHHHHHhhh
Q psy10278         77 VKKYQCTFCSYSCTERFRLKDHT   99 (110)
Q Consensus        77 ~~p~~C~~C~~~f~~~~~l~~H~   99 (110)
                      ...|-|-+||..|.....|..|=
T Consensus       237 ~eh~YC~fCG~~y~~~edl~ehC  259 (268)
T KOG1994|consen  237 SEHYYCFFCGIKYKDEEDLYEHC  259 (268)
T ss_pred             ccceEEEEeccccCCHHHHHHhC
Confidence            44589999999999988887764


No 224
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=30.16  E-value=58  Score=14.10  Aligned_cols=10  Identities=30%  Similarity=0.810  Sum_probs=5.8

Q ss_pred             CCceeccCCC
Q psy10278         77 VKKYQCTFCS   86 (110)
Q Consensus        77 ~~p~~C~~C~   86 (110)
                      .....|+.|+
T Consensus        34 ~~~~~CP~C~   43 (44)
T PF14634_consen   34 GKSVKCPICR   43 (44)
T ss_pred             CCCCCCcCCC
Confidence            3455676665


No 225
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=29.98  E-value=31  Score=14.46  Aligned_cols=8  Identities=50%  Similarity=1.559  Sum_probs=4.2

Q ss_pred             eeCCCCCC
Q psy10278         52 YACPTCEF   59 (110)
Q Consensus        52 ~~c~~c~~   59 (110)
                      +.|+.|+.
T Consensus        23 ~vC~~Cg~   30 (34)
T PF14803_consen   23 LVCPACGF   30 (34)
T ss_dssp             EEETTTTE
T ss_pred             eECCCCCC
Confidence            45555553


No 226
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=29.77  E-value=31  Score=22.58  Aligned_cols=11  Identities=45%  Similarity=0.945  Sum_probs=7.8

Q ss_pred             CccCCcccccc
Q psy10278         23 PFQCPVCGFTT   33 (110)
Q Consensus        23 ~~~C~~c~~~~   33 (110)
                      .-.||+||..-
T Consensus       187 ~~~CPvCGs~P  197 (309)
T PRK03564        187 RQFCPVCGSMP  197 (309)
T ss_pred             CCCCCCCCCcc
Confidence            35699998653


No 227
>PRK05978 hypothetical protein; Provisional
Probab=29.61  E-value=33  Score=19.89  Aligned_cols=10  Identities=30%  Similarity=0.747  Sum_probs=6.0

Q ss_pred             eccCCCcccc
Q psy10278         81 QCTFCSYSCT   90 (110)
Q Consensus        81 ~C~~C~~~f~   90 (110)
                      .|+.||..|.
T Consensus        54 ~C~~CG~~~~   63 (148)
T PRK05978         54 HCAACGEDFT   63 (148)
T ss_pred             CccccCCccc
Confidence            5666665554


No 228
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=29.46  E-value=42  Score=19.17  Aligned_cols=36  Identities=17%  Similarity=0.291  Sum_probs=19.8

Q ss_pred             ccCCcccccccCchhHHH--------HHHhcCCCCceeCCCCCCCcC
Q psy10278         24 FQCPVCGFTTGRKATLQL--------HVRQHTREKPYACPTCEFKTG   62 (110)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~--------h~~~~~~~~~~~c~~c~~~~~   62 (110)
                      -.|..|+..+.....-..        ......   -+.|+.|++.|=
T Consensus        92 sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~---f~~C~~C~kiyW  135 (147)
T PF01927_consen   92 SRCPKCNGPLRPVSKEEVKDRVPPYVYETYDE---FWRCPGCGKIYW  135 (147)
T ss_pred             CccCCCCcEeeechhhccccccCccccccCCe---EEECCCCCCEec
Confidence            569999887543221100        011222   468999998773


No 229
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=29.37  E-value=24  Score=17.24  Aligned_cols=8  Identities=38%  Similarity=1.169  Sum_probs=4.9

Q ss_pred             eeccCCCc
Q psy10278         80 YQCTFCSY   87 (110)
Q Consensus        80 ~~C~~C~~   87 (110)
                      |.|++|+-
T Consensus         1 y~C~KCg~    8 (64)
T PF09855_consen    1 YKCPKCGN    8 (64)
T ss_pred             CCCCCCCC
Confidence            45666664


No 230
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=29.35  E-value=29  Score=18.96  Aligned_cols=26  Identities=23%  Similarity=0.668  Sum_probs=14.4

Q ss_pred             cCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCc
Q psy10278         25 QCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKT   61 (110)
Q Consensus        25 ~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~   61 (110)
                      .||.|+..|..+           ....+.|+.|+...
T Consensus         4 ~CP~C~seytY~-----------dg~~~iCpeC~~EW   29 (109)
T TIGR00686         4 PCPKCNSEYTYH-----------DGTQLICPSCLYEW   29 (109)
T ss_pred             cCCcCCCcceEe-----------cCCeeECccccccc
Confidence            477776555433           22346777776443


No 231
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=29.00  E-value=44  Score=15.49  Aligned_cols=12  Identities=33%  Similarity=0.872  Sum_probs=5.8

Q ss_pred             ceeCCCCCCCcC
Q psy10278         51 PYACPTCEFKTG   62 (110)
Q Consensus        51 ~~~c~~c~~~~~   62 (110)
                      ...|+.|+..|.
T Consensus        40 ~v~C~~C~~~fC   51 (64)
T smart00647       40 RVTCPKCGFSFC   51 (64)
T ss_pred             eeECCCCCCeEC
Confidence            345555554443


No 232
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=28.86  E-value=36  Score=23.66  Aligned_cols=17  Identities=12%  Similarity=0.362  Sum_probs=11.3

Q ss_pred             CCCceeCCCCCCCcCCh
Q psy10278         48 REKPYACPTCEFKTGDH   64 (110)
Q Consensus        48 ~~~~~~c~~c~~~~~~~   64 (110)
                      ....|.|..|+..|...
T Consensus       422 ~~~~~~c~~c~~~yd~~  438 (479)
T PRK05452        422 LGPRMQCSVCQWIYDPA  438 (479)
T ss_pred             CCCeEEECCCCeEECCC
Confidence            34557888888776554


No 233
>PF14369 zf-RING_3:  zinc-finger
Probab=28.52  E-value=28  Score=14.63  Aligned_cols=10  Identities=30%  Similarity=0.507  Sum_probs=8.2

Q ss_pred             cCCccccccc
Q psy10278         25 QCPVCGFTTG   34 (110)
Q Consensus        25 ~C~~c~~~~~   34 (110)
                      .|+.|+..|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            5999998875


No 234
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=28.46  E-value=24  Score=16.76  Aligned_cols=7  Identities=43%  Similarity=1.236  Sum_probs=3.3

Q ss_pred             eeccCCC
Q psy10278         80 YQCTFCS   86 (110)
Q Consensus        80 ~~C~~C~   86 (110)
                      |-|..|.
T Consensus        32 YmC~eC~   38 (56)
T PF09963_consen   32 YMCDECK   38 (56)
T ss_pred             eeChhHH
Confidence            4454443


No 235
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=28.39  E-value=58  Score=20.56  Aligned_cols=15  Identities=13%  Similarity=0.301  Sum_probs=10.5

Q ss_pred             CCCceeccCCCcccc
Q psy10278         76 PVKKYQCTFCSYSCT   90 (110)
Q Consensus        76 ~~~p~~C~~C~~~f~   90 (110)
                      +..+..||.||+...
T Consensus       218 ~d~iv~CP~CgRILy  232 (239)
T COG1579         218 KDEIVFCPYCGRILY  232 (239)
T ss_pred             CCCCccCCccchHHH
Confidence            556678888887543


No 236
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=28.15  E-value=32  Score=16.74  Aligned_cols=18  Identities=11%  Similarity=0.242  Sum_probs=12.3

Q ss_pred             hcCCCCceeccCCCcccc
Q psy10278         73 RHMPVKKYQCTFCSYSCT   90 (110)
Q Consensus        73 ~h~~~~p~~C~~C~~~f~   90 (110)
                      .+..+.-..|+.|++.|.
T Consensus        47 ~~i~eg~L~Cp~c~r~YP   64 (68)
T PF03966_consen   47 VEIVEGELICPECGREYP   64 (68)
T ss_dssp             EETTTTEEEETTTTEEEE
T ss_pred             ccccCCEEEcCCCCCEEe
Confidence            345566678888887764


No 237
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=28.09  E-value=26  Score=16.56  Aligned_cols=10  Identities=20%  Similarity=0.421  Sum_probs=5.2

Q ss_pred             CceeccCCCc
Q psy10278         78 KKYQCTFCSY   87 (110)
Q Consensus        78 ~p~~C~~C~~   87 (110)
                      -|..|+.|..
T Consensus        27 fPlyCpKCK~   36 (55)
T PF14205_consen   27 FPLYCPKCKQ   36 (55)
T ss_pred             ccccCCCCCc
Confidence            3455555544


No 238
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=27.78  E-value=35  Score=14.86  Aligned_cols=8  Identities=25%  Similarity=0.837  Sum_probs=4.3

Q ss_pred             eccCCCcc
Q psy10278         81 QCTFCSYS   88 (110)
Q Consensus        81 ~C~~C~~~   88 (110)
                      .|+.|+..
T Consensus         2 ~Cp~Cg~~    9 (43)
T PF08271_consen    2 KCPNCGSK    9 (43)
T ss_dssp             SBTTTSSS
T ss_pred             CCcCCcCC
Confidence            45666543


No 239
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=27.75  E-value=42  Score=22.15  Aligned_cols=25  Identities=20%  Similarity=0.440  Sum_probs=17.8

Q ss_pred             CceeccCCCcccccHHHHHhhhhhc
Q psy10278         78 KKYQCTFCSYSCTERFRLKDHTLAK  102 (110)
Q Consensus        78 ~p~~C~~C~~~f~~~~~l~~H~~~~  102 (110)
                      -.|.|+.|...|-...+.-.|-..|
T Consensus       387 ~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         387 GRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             cceechhhhhhhhhhhHHHHHHHHh
Confidence            3488888888887777766665544


No 240
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.44  E-value=52  Score=15.97  Aligned_cols=7  Identities=71%  Similarity=1.958  Sum_probs=3.1

Q ss_pred             eeCCCCC
Q psy10278         52 YACPTCE   58 (110)
Q Consensus        52 ~~c~~c~   58 (110)
                      |.|+.|.
T Consensus        32 ymC~eC~   38 (68)
T COG4896          32 YMCPECE   38 (68)
T ss_pred             EechhhH
Confidence            4444443


No 241
>PRK10220 hypothetical protein; Provisional
Probab=27.26  E-value=35  Score=18.65  Aligned_cols=27  Identities=26%  Similarity=0.699  Sum_probs=15.8

Q ss_pred             cCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcC
Q psy10278         25 QCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTG   62 (110)
Q Consensus        25 ~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~   62 (110)
                      .|+.|...|...           ....+.|+.|+.-..
T Consensus         5 ~CP~C~seytY~-----------d~~~~vCpeC~hEW~   31 (111)
T PRK10220          5 HCPKCNSEYTYE-----------DNGMYICPECAHEWN   31 (111)
T ss_pred             cCCCCCCcceEc-----------CCCeEECCcccCcCC
Confidence            477777655433           223578888875443


No 242
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=27.23  E-value=61  Score=25.76  Aligned_cols=9  Identities=44%  Similarity=1.191  Sum_probs=6.8

Q ss_pred             ccCCccccc
Q psy10278         24 FQCPVCGFT   32 (110)
Q Consensus        24 ~~C~~c~~~   32 (110)
                      +.|+.||..
T Consensus       668 rkCPkCG~~  676 (1337)
T PRK14714        668 RRCPSCGTE  676 (1337)
T ss_pred             EECCCCCCc
Confidence            678888864


No 243
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=26.46  E-value=35  Score=15.92  Aligned_cols=11  Identities=45%  Similarity=0.945  Sum_probs=6.3

Q ss_pred             cCCcccccccC
Q psy10278         25 QCPVCGFTTGR   35 (110)
Q Consensus        25 ~C~~c~~~~~~   35 (110)
                      .||.||..+..
T Consensus         2 ~CPyCge~~~~   12 (52)
T PF14255_consen    2 QCPYCGEPIEI   12 (52)
T ss_pred             CCCCCCCeeEE
Confidence            46666665443


No 244
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=26.37  E-value=43  Score=17.72  Aligned_cols=26  Identities=35%  Similarity=0.925  Sum_probs=15.6

Q ss_pred             cCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcC
Q psy10278         25 QCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTG   62 (110)
Q Consensus        25 ~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~   62 (110)
                      .|+.|+..+...            ...+.|+.|+....
T Consensus         2 fC~~Cg~~l~~~------------~~~~~C~~C~~~~~   27 (104)
T TIGR01384         2 FCPKCGSLMTPK------------NGVYVCPSCGYEKE   27 (104)
T ss_pred             CCcccCcccccC------------CCeEECcCCCCccc
Confidence            377777665321            12577888886544


No 245
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=26.28  E-value=36  Score=14.62  Aligned_cols=9  Identities=33%  Similarity=0.877  Sum_probs=5.0

Q ss_pred             eeccCCCcc
Q psy10278         80 YQCTFCSYS   88 (110)
Q Consensus        80 ~~C~~C~~~   88 (110)
                      |.|..|+..
T Consensus        29 y~C~~C~~~   37 (39)
T PF01096_consen   29 YVCCNCGHR   37 (39)
T ss_dssp             EEESSSTEE
T ss_pred             EEeCCCCCe
Confidence            555555554


No 246
>COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=26.03  E-value=37  Score=16.66  Aligned_cols=10  Identities=20%  Similarity=0.883  Sum_probs=6.6

Q ss_pred             ceeccCCCcc
Q psy10278         79 KYQCTFCSYS   88 (110)
Q Consensus        79 p~~C~~C~~~   88 (110)
                      .++|+.||-.
T Consensus         4 ~~kCpKCgn~   13 (68)
T COG3478           4 AFKCPKCGNT   13 (68)
T ss_pred             cccCCCcCCc
Confidence            4568888753


No 247
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=25.98  E-value=35  Score=14.91  Aligned_cols=9  Identities=22%  Similarity=0.715  Sum_probs=6.8

Q ss_pred             ceeccCCCc
Q psy10278         79 KYQCTFCSY   87 (110)
Q Consensus        79 p~~C~~C~~   87 (110)
                      |..|+.||.
T Consensus         2 ~~~Cp~Cg~   10 (47)
T PF14690_consen    2 PPRCPHCGS   10 (47)
T ss_pred             CccCCCcCC
Confidence            567888884


No 248
>KOG0402|consensus
Probab=25.85  E-value=42  Score=17.39  Aligned_cols=8  Identities=38%  Similarity=1.327  Sum_probs=5.3

Q ss_pred             ccCCcccc
Q psy10278         24 FQCPVCGF   31 (110)
Q Consensus        24 ~~C~~c~~   31 (110)
                      |.|+.||+
T Consensus        37 y~CsfCGK   44 (92)
T KOG0402|consen   37 YTCSFCGK   44 (92)
T ss_pred             hhhhhcch
Confidence            66777665


No 249
>PF11290 DUF3090:  Protein of unknown function (DUF3090);  InterPro: IPR021441  This family of proteins with unknown function appears to be restricted to Actinobacteria. 
Probab=25.64  E-value=1.1e+02  Score=18.26  Aligned_cols=11  Identities=36%  Similarity=0.996  Sum_probs=6.9

Q ss_pred             cCCcccccccC
Q psy10278         25 QCPVCGFTTGR   35 (110)
Q Consensus        25 ~C~~c~~~~~~   35 (110)
                      .|+.|+....-
T Consensus       156 ~CPlCg~PlDP  166 (171)
T PF11290_consen  156 PCPLCGEPLDP  166 (171)
T ss_pred             CCCCCCCCCCC
Confidence            47777765443


No 250
>KOG3507|consensus
Probab=25.56  E-value=46  Score=16.01  Aligned_cols=11  Identities=27%  Similarity=0.754  Sum_probs=6.4

Q ss_pred             ceeccCCCccc
Q psy10278         79 KYQCTFCSYSC   89 (110)
Q Consensus        79 p~~C~~C~~~f   89 (110)
                      .+.|.+||...
T Consensus        37 ~irCReCG~RI   47 (62)
T KOG3507|consen   37 VIRCRECGYRI   47 (62)
T ss_pred             cEehhhcchHH
Confidence            46666666543


No 251
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=25.32  E-value=51  Score=17.35  Aligned_cols=23  Identities=17%  Similarity=0.393  Sum_probs=16.2

Q ss_pred             CCccCCcccccccCchhHHHHHH
Q psy10278         22 KPFQCPVCGFTTGRKATLQLHVR   44 (110)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~   44 (110)
                      +...|+.||+.+.+...+..-..
T Consensus        34 Pa~~C~~CGe~y~~dev~~eIE~   56 (89)
T TIGR03829        34 PSISCSHCGMEYQDDTTVKEIED   56 (89)
T ss_pred             CcccccCCCcEeecHHHHHHHHh
Confidence            34679999999888766554433


No 252
>PF12773 DZR:  Double zinc ribbon
Probab=24.75  E-value=47  Score=14.77  Aligned_cols=8  Identities=38%  Similarity=1.045  Sum_probs=3.9

Q ss_pred             eeCCCCCC
Q psy10278         52 YACPTCEF   59 (110)
Q Consensus        52 ~~c~~c~~   59 (110)
                      ..|+.|+.
T Consensus        30 ~~C~~Cg~   37 (50)
T PF12773_consen   30 KICPNCGA   37 (50)
T ss_pred             CCCcCCcC
Confidence            34555554


No 253
>PRK12722 transcriptional activator FlhC; Provisional
Probab=24.66  E-value=61  Score=19.64  Aligned_cols=28  Identities=25%  Similarity=0.539  Sum_probs=18.2

Q ss_pred             eeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCc
Q psy10278         52 YACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSY   87 (110)
Q Consensus        52 ~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~   87 (110)
                      ..|..|+..|.....        .....|.|+.|..
T Consensus       135 ~~C~~Cgg~fv~~~~--------e~~~~f~CplC~~  162 (187)
T PRK12722        135 SSCNCCGGHFVTHAH--------DPVGSFVCGLCQP  162 (187)
T ss_pred             ccCCCCCCCeecccc--------ccCCCCcCCCCCC
Confidence            468888887753322        2235689999865


No 254
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=24.64  E-value=43  Score=20.97  Aligned_cols=31  Identities=16%  Similarity=0.179  Sum_probs=18.8

Q ss_pred             CCCccCCcccccccCchhHHHHHHhcCCCCceeC
Q psy10278         21 LKPFQCPVCGFTTGRKATLQLHVRQHTREKPYAC   54 (110)
Q Consensus        21 ~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c   54 (110)
                      .++..|+.||..|.-...+.   ....|..|+.-
T Consensus       179 GkpqRCpECGqVFKLVr~~~---s~~dg~dp~~~  209 (268)
T PTZ00043        179 GFLYRCGECDQIFMLVRVLY---SLPDGEDPFPN  209 (268)
T ss_pred             CCCccCCCCCcEEEEEEEEe---ecCCCCCCCCC
Confidence            45788999999887643221   13445555543


No 255
>PRK01343 zinc-binding protein; Provisional
Probab=24.23  E-value=45  Score=15.94  Aligned_cols=11  Identities=27%  Similarity=0.561  Sum_probs=6.6

Q ss_pred             eeccCCCcccc
Q psy10278         80 YQCTFCSYSCT   90 (110)
Q Consensus        80 ~~C~~C~~~f~   90 (110)
                      ..|+.|++.+.
T Consensus        10 ~~CP~C~k~~~   20 (57)
T PRK01343         10 RPCPECGKPST   20 (57)
T ss_pred             CcCCCCCCcCc
Confidence            45666666554


No 256
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]
Probab=24.15  E-value=1.4e+02  Score=20.13  Aligned_cols=10  Identities=40%  Similarity=1.308  Sum_probs=6.2

Q ss_pred             CCccCCcccc
Q psy10278         22 KPFQCPVCGF   31 (110)
Q Consensus        22 ~~~~C~~c~~   31 (110)
                      ..|.|..||+
T Consensus       353 ~~YRC~~CGF  362 (389)
T COG2956         353 PRYRCQNCGF  362 (389)
T ss_pred             CCceecccCC
Confidence            3466777765


No 257
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=23.79  E-value=46  Score=13.61  Aligned_cols=12  Identities=25%  Similarity=0.830  Sum_probs=8.8

Q ss_pred             CceeccCCCccc
Q psy10278         78 KKYQCTFCSYSC   89 (110)
Q Consensus        78 ~p~~C~~C~~~f   89 (110)
                      +-|+|..|+...
T Consensus         3 ~~ykC~~CGniv   14 (34)
T cd00974           3 EVYKCEICGNIV   14 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            358888888655


No 258
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=23.78  E-value=30  Score=23.19  Aligned_cols=22  Identities=14%  Similarity=0.215  Sum_probs=15.2

Q ss_pred             eeccCCCcccccHHHHHhhhhh
Q psy10278         80 YQCTFCSYSCTERFRLKDHTLA  101 (110)
Q Consensus        80 ~~C~~C~~~f~~~~~l~~H~~~  101 (110)
                      +-|++|++-|...+.+..|+..
T Consensus       239 ~YC~~C~r~f~~~~VFe~Hl~g  260 (470)
T COG5188         239 VYCVKCGREFSRSKVFEYHLEG  260 (470)
T ss_pred             eeeHhhhhHhhhhHHHHHHHhh
Confidence            6677777777776777777653


No 259
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=23.55  E-value=1.8e+02  Score=17.86  Aligned_cols=54  Identities=15%  Similarity=0.272  Sum_probs=29.7

Q ss_pred             CCccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCChHHHHHHHHh----------cCCCCceeccCCCccccc
Q psy10278         22 KPFQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGDHNVLRKHVQR----------HMPVKKYQCTFCSYSCTE   91 (110)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~----------h~~~~p~~C~~C~~~f~~   91 (110)
                      ..+.|++|...+..               +.. ..|+-.|...-...+....          .....+..|+.|...++.
T Consensus        17 ~~~~CpICld~~~d---------------PVv-T~CGH~FC~~CI~~wl~~s~~s~~~~~~~~~~k~~~~CPvCR~~Is~   80 (193)
T PLN03208         17 GDFDCNICLDQVRD---------------PVV-TLCGHLFCWPCIHKWTYASNNSRQRVDQYDHKREPPKCPVCKSDVSE   80 (193)
T ss_pred             CccCCccCCCcCCC---------------cEE-cCCCchhHHHHHHHHHHhccccccccccccccCCCCcCCCCCCcCCh
Confidence            35889999765422               222 3467677666443321110          112345789999877654


No 260
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=23.19  E-value=38  Score=19.36  Aligned_cols=17  Identities=24%  Similarity=0.381  Sum_probs=13.2

Q ss_pred             hcCCCCceeccCCCcccc
Q psy10278         73 RHMPVKKYQCTFCSYSCT   90 (110)
Q Consensus        73 ~h~~~~p~~C~~C~~~f~   90 (110)
                      .+.+ +|..|+.||..|.
T Consensus       107 l~~g-~~~RCpeCG~~fk  123 (136)
T PF01215_consen  107 LHKG-KPQRCPECGQVFK  123 (136)
T ss_dssp             EETT-SEEEETTTEEEEE
T ss_pred             EeCC-CccCCCCCCeEEE
Confidence            4444 6899999998875


No 261
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=23.18  E-value=1.4e+02  Score=16.10  Aligned_cols=41  Identities=10%  Similarity=0.076  Sum_probs=27.1

Q ss_pred             CCccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCC
Q psy10278         22 KPFQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGD   63 (110)
Q Consensus        22 ~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~   63 (110)
                      +.|.|+.-++.|.+...+...+... ..+.+.|...|+.-..
T Consensus         2 eVf~i~~T~EiF~dYe~Y~~R~~~y-~~~vwtC~~TGk~~LT   42 (102)
T PF10537_consen    2 EVFYIPFTGEIFRDYEEYLKRMILY-NQRVWTCEITGKSNLT   42 (102)
T ss_pred             ceEEeCCCCcccCCHHHHHHHHHHH-hCCeeEEecCCCCCCC
Confidence            4567788888888877777665543 3356788877764433


No 262
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=22.87  E-value=46  Score=18.88  Aligned_cols=32  Identities=28%  Similarity=0.647  Sum_probs=18.9

Q ss_pred             ceeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCcccc
Q psy10278         51 PYACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSYSCT   90 (110)
Q Consensus        51 ~~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~~f~   90 (110)
                      .|.|..|+..+.....      .  ....+.|+.|+-.+.
T Consensus       123 ~~~C~~C~~~~~r~~~------~--~~~~~~C~~C~~~l~  154 (157)
T PF10263_consen  123 VYRCPSCGREYKRHRR------S--KRKRYRCGRCGGPLV  154 (157)
T ss_pred             EEEcCCCCCEeeeecc------c--chhhEECCCCCCEEE
Confidence            4788888866533322      1  123378888885543


No 263
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=22.84  E-value=82  Score=20.69  Aligned_cols=13  Identities=23%  Similarity=0.496  Sum_probs=7.7

Q ss_pred             CCCCceeCCCCCC
Q psy10278         47 TREKPYACPTCEF   59 (110)
Q Consensus        47 ~~~~~~~c~~c~~   59 (110)
                      .|.+-..|..|+.
T Consensus       206 ~G~RyL~CslC~t  218 (305)
T TIGR01562       206 TGLRYLSCSLCAT  218 (305)
T ss_pred             CCceEEEcCCCCC
Confidence            3445566777753


No 264
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=22.80  E-value=34  Score=13.78  Aligned_cols=11  Identities=27%  Similarity=0.751  Sum_probs=5.3

Q ss_pred             CCceeCCCCCC
Q psy10278         49 EKPYACPTCEF   59 (110)
Q Consensus        49 ~~~~~c~~c~~   59 (110)
                      +....|+.|+.
T Consensus        19 g~~r~C~~Cg~   29 (32)
T PF09297_consen   19 GWARRCPSCGH   29 (32)
T ss_dssp             SS-EEESSSS-
T ss_pred             cCEeECCCCcC
Confidence            44556666654


No 265
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=22.69  E-value=67  Score=19.13  Aligned_cols=20  Identities=10%  Similarity=0.288  Sum_probs=15.0

Q ss_pred             CCceeccCCCcccccHHHHH
Q psy10278         77 VKKYQCTFCSYSCTERFRLK   96 (110)
Q Consensus        77 ~~p~~C~~C~~~f~~~~~l~   96 (110)
                      -....|..||+.|.....+.
T Consensus       112 ~~~~~C~~Cg~~f~~~k~i~  131 (181)
T PRK08222        112 FHLQRCSRCERPFAPQKTVA  131 (181)
T ss_pred             cccCcCcccCCccCcHhHHH
Confidence            35789999999998654443


No 266
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=22.66  E-value=51  Score=13.46  Aligned_cols=12  Identities=25%  Similarity=0.814  Sum_probs=9.1

Q ss_pred             CceeccCCCccc
Q psy10278         78 KKYQCTFCSYSC   89 (110)
Q Consensus        78 ~p~~C~~C~~~f   89 (110)
                      +-|+|..|+..+
T Consensus         6 ~~ykC~~Cgniv   17 (34)
T TIGR00319         6 QVYKCEVCGNIV   17 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            468899988755


No 267
>PRK12860 transcriptional activator FlhC; Provisional
Probab=22.58  E-value=66  Score=19.53  Aligned_cols=27  Identities=22%  Similarity=0.422  Sum_probs=17.6

Q ss_pred             eeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCC
Q psy10278         52 YACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCS   86 (110)
Q Consensus        52 ~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~   86 (110)
                      ..|..|+..|.....        .....|.|+.|.
T Consensus       135 ~~C~~Cgg~fv~~~~--------e~~~~f~CplC~  161 (189)
T PRK12860        135 ARCCRCGGKFVTHAH--------DLRHNFVCGLCQ  161 (189)
T ss_pred             ccCCCCCCCeecccc--------ccCCCCcCCCCC
Confidence            468888887753322        223568899886


No 268
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=21.95  E-value=34  Score=14.56  Aligned_cols=6  Identities=50%  Similarity=1.547  Sum_probs=2.5

Q ss_pred             eeccCC
Q psy10278         80 YQCTFC   85 (110)
Q Consensus        80 ~~C~~C   85 (110)
                      |.|..|
T Consensus        30 yrC~~C   35 (36)
T PF03811_consen   30 YRCKDC   35 (36)
T ss_pred             EecCcC
Confidence            444433


No 269
>KOG2636|consensus
Probab=21.82  E-value=79  Score=22.05  Aligned_cols=27  Identities=19%  Similarity=0.559  Sum_probs=17.9

Q ss_pred             hcCCCCccCCccc-ccccCchhHHHHHH
Q psy10278         18 HKRLKPFQCPVCG-FTTGRKATLQLHVR   44 (110)
Q Consensus        18 ~~~~~~~~C~~c~-~~~~~~~~l~~h~~   44 (110)
                      |.-...|.|.+|| +++.-...+.+|..
T Consensus       396 HGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  396 HGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             cCCCcccceeeccCccccCcHHHHHHhH
Confidence            4444557788887 66666677777765


No 270
>PLN03239 histone acetyltransferase; Provisional
Probab=21.78  E-value=93  Score=20.93  Aligned_cols=25  Identities=16%  Similarity=0.121  Sum_probs=19.6

Q ss_pred             CCceeccCCCcccccHHHHHhhhhh
Q psy10278         77 VKKYQCTFCSYSCTERFRLKDHTLA  101 (110)
Q Consensus        77 ~~p~~C~~C~~~f~~~~~l~~H~~~  101 (110)
                      ..-|.|..|-+-|.....+..|+..
T Consensus       104 ~~lYiCE~Clky~~~~~~l~~H~~~  128 (351)
T PLN03239        104 DVLYVCEFSFGFFARKSELLRFQAK  128 (351)
T ss_pred             ceEEEeccchhhhcCHHHHHHHHHh
Confidence            3568888888888888888888753


No 271
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=21.78  E-value=41  Score=13.49  Aligned_cols=9  Identities=22%  Similarity=0.981  Sum_probs=4.5

Q ss_pred             eeccCCCcc
Q psy10278         80 YQCTFCSYS   88 (110)
Q Consensus        80 ~~C~~C~~~   88 (110)
                      |.|..|+..
T Consensus        28 f~C~~C~~~   36 (39)
T smart00132       28 FKCSKCGKP   36 (39)
T ss_pred             CCCcccCCc
Confidence            455555544


No 272
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=21.74  E-value=1.1e+02  Score=21.47  Aligned_cols=25  Identities=28%  Similarity=0.483  Sum_probs=20.0

Q ss_pred             CCceeccCCCcccccHHHHHhhhhh
Q psy10278         77 VKKYQCTFCSYSCTERFRLKDHTLA  101 (110)
Q Consensus        77 ~~p~~C~~C~~~f~~~~~l~~H~~~  101 (110)
                      ..-|.|..|-+-|.....|..|+..
T Consensus       196 ~~lyiCe~Cl~y~~~~~~~~~H~~~  220 (450)
T PLN00104        196 SKLYFCEFCLKFMKRKEQLQRHMKK  220 (450)
T ss_pred             CeEEEchhhhhhhcCHHHHHHHHhc
Confidence            3458888888888888888888863


No 273
>KOG2857|consensus
Probab=21.74  E-value=56  Score=18.84  Aligned_cols=22  Identities=18%  Similarity=0.599  Sum_probs=19.4

Q ss_pred             CccCCcccccccCchhHHHHHH
Q psy10278         23 PFQCPVCGFTTGRKATLQLHVR   44 (110)
Q Consensus        23 ~~~C~~c~~~~~~~~~l~~h~~   44 (110)
                      .|+|+.|...+.+-.-++.|..
T Consensus        17 KYKCpkC~vPYCSl~CfKiHk~   38 (157)
T KOG2857|consen   17 KYKCPKCSVPYCSLPCFKIHKS   38 (157)
T ss_pred             hccCCCCCCccccchhhhhccC
Confidence            5999999999999999988865


No 274
>TIGR03847 conserved hypothetical protein. The conserved hypothetical protein described here occurs as part of the trio of uncharacterized proteins common in the Actinobacteria.
Probab=21.61  E-value=1.5e+02  Score=17.78  Aligned_cols=11  Identities=36%  Similarity=1.038  Sum_probs=6.9

Q ss_pred             cCCcccccccC
Q psy10278         25 QCPVCGFTTGR   35 (110)
Q Consensus        25 ~C~~c~~~~~~   35 (110)
                      .|+.|+....-
T Consensus       158 ~CPlCg~PldP  168 (177)
T TIGR03847       158 PCPLCGRPIDP  168 (177)
T ss_pred             CCCCCCCCCCC
Confidence            47777765543


No 275
>KOG0696|consensus
Probab=21.40  E-value=26  Score=24.35  Aligned_cols=59  Identities=25%  Similarity=0.467  Sum_probs=31.2

Q ss_pred             CCCCccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCChHHHHHHHH-hcCCCCceeccCCCc
Q psy10278         20 RLKPFQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGDHNVLRKHVQ-RHMPVKKYQCTFCSY   87 (110)
Q Consensus        20 ~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~-~h~~~~p~~C~~C~~   87 (110)
                      |..-|+|.+|.        +..|.+.|.- ..+.|+.=++.+.....-..|-- .|+-..|--|..||.
T Consensus        70 gKQGfQCqvC~--------fvvHkrChef-VtF~CPGadkg~dtDdpr~kHkf~~~tYssPTFCDhCGs  129 (683)
T KOG0696|consen   70 GKQGFQCQVCC--------FVVHKRCHEF-VTFSCPGADKGPDTDDPRSKHKFKIHTYSSPTFCDHCGS  129 (683)
T ss_pred             ccCceeeeEEe--------ehhhhhhcce-EEEECCCCCCCCCCCCcccccceeeeecCCCchhhhHHH
Confidence            33346666664        3456565532 34667766666655544444433 444455555666654


No 276
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=21.39  E-value=66  Score=15.65  Aligned_cols=13  Identities=23%  Similarity=0.644  Sum_probs=8.5

Q ss_pred             CceeccCCCcccc
Q psy10278         78 KKYQCTFCSYSCT   90 (110)
Q Consensus        78 ~p~~C~~C~~~f~   90 (110)
                      .-..|+.|+..|.
T Consensus        47 gev~CPYC~t~y~   59 (62)
T COG4391          47 GEVVCPYCSTRYR   59 (62)
T ss_pred             CcEecCccccEEE
Confidence            3467777777664


No 277
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=21.33  E-value=74  Score=20.64  Aligned_cols=34  Identities=26%  Similarity=0.582  Sum_probs=19.7

Q ss_pred             ccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcCChHH
Q psy10278         24 FQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTGDHNV   66 (110)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~   66 (110)
                      .+|+.|+.....+. |.        ..-+.|+.|+.-|.....
T Consensus        27 ~~c~~c~~~~~~~~-l~--------~~~~vc~~c~~h~rl~ar   60 (285)
T TIGR00515        27 TKCPKCGQVLYTKE-LE--------RNLEVCPKCDHHMRMDAR   60 (285)
T ss_pred             eECCCCcchhhHHH-HH--------hhCCCCCCCCCcCcCCHH
Confidence            45888876554332 11        123578888877765544


No 278
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=21.33  E-value=59  Score=23.18  Aligned_cols=40  Identities=20%  Similarity=0.414  Sum_probs=20.8

Q ss_pred             eeCCCCCCCcCCh-HHHHHHHHhcCCCCceeccCCCccccc
Q psy10278         52 YACPTCEFKTGDH-NVLRKHVQRHMPVKKYQCTFCSYSCTE   91 (110)
Q Consensus        52 ~~c~~c~~~~~~~-~~l~~h~~~h~~~~p~~C~~C~~~f~~   91 (110)
                      ..|+.|+..+... ..+..........--|.|+.||.....
T Consensus       201 vpCPhCg~~~~l~~~~l~w~~~~~~~~a~y~C~~Cg~~i~e  241 (557)
T PF05876_consen  201 VPCPHCGEEQVLEWENLKWDKGEAPETARYVCPHCGCEIEE  241 (557)
T ss_pred             ccCCCCCCCccccccceeecCCCCccceEEECCCCcCCCCH
Confidence            4788888776544 222110000111223888888877654


No 279
>PHA02942 putative transposase; Provisional
Probab=20.94  E-value=1e+02  Score=20.85  Aligned_cols=14  Identities=21%  Similarity=0.757  Sum_probs=10.7

Q ss_pred             CCceeccCCCcccc
Q psy10278         77 VKKYQCTFCSYSCT   90 (110)
Q Consensus        77 ~~p~~C~~C~~~f~   90 (110)
                      .+.|.|+.||...-
T Consensus       340 ~r~f~C~~CG~~~d  353 (383)
T PHA02942        340 HRYFHCPSCGYEND  353 (383)
T ss_pred             CCEEECCCCCCEeC
Confidence            46799999997653


No 280
>KOG3214|consensus
Probab=20.80  E-value=23  Score=19.03  Aligned_cols=13  Identities=23%  Similarity=0.429  Sum_probs=8.0

Q ss_pred             eeCCCCCCCcCCh
Q psy10278         52 YACPTCEFKTGDH   64 (110)
Q Consensus        52 ~~c~~c~~~~~~~   64 (110)
                      ..|.+|+..|...
T Consensus        48 ~sC~iC~esFqt~   60 (109)
T KOG3214|consen   48 ASCRICEESFQTT   60 (109)
T ss_pred             eeeeehhhhhccc
Confidence            4677777666543


No 281
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=20.78  E-value=76  Score=14.91  Aligned_cols=21  Identities=14%  Similarity=0.368  Sum_probs=14.9

Q ss_pred             CCceeccCCCcccccHHHHHh
Q psy10278         77 VKKYQCTFCSYSCTERFRLKD   97 (110)
Q Consensus        77 ~~p~~C~~C~~~f~~~~~l~~   97 (110)
                      ..-+-|-+||-.|.....|..
T Consensus        25 ~~~~YC~~Cg~~Y~d~~dL~~   45 (55)
T PF13821_consen   25 EEHNYCFWCGTKYDDEEDLER   45 (55)
T ss_pred             hhCceeeeeCCccCCHHHHHh
Confidence            445678888888887766643


No 282
>PTZ00064 histone acetyltransferase; Provisional
Probab=20.76  E-value=1.3e+02  Score=21.53  Aligned_cols=25  Identities=16%  Similarity=0.073  Sum_probs=20.2

Q ss_pred             CCceeccCCCcccccHHHHHhhhhh
Q psy10278         77 VKKYQCTFCSYSCTERFRLKDHTLA  101 (110)
Q Consensus        77 ~~p~~C~~C~~~f~~~~~l~~H~~~  101 (110)
                      ..-|.|..|-+-|.....|..|+..
T Consensus       278 d~LYICEfCLkY~~s~~~l~rH~~~  302 (552)
T PTZ00064        278 DTLHFCEYCLDFFCFEDELIRHLSR  302 (552)
T ss_pred             CeEEEccchhhhhCCHHHHHHHHhc
Confidence            3458888888888888888888874


No 283
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=20.51  E-value=46  Score=17.03  Aligned_cols=10  Identities=40%  Similarity=1.222  Sum_probs=3.5

Q ss_pred             CCceeccCCC
Q psy10278         77 VKKYQCTFCS   86 (110)
Q Consensus        77 ~~p~~C~~C~   86 (110)
                      ++.|.|+.|+
T Consensus        20 ~~~F~CPfC~   29 (81)
T PF05129_consen   20 PKVFDCPFCN   29 (81)
T ss_dssp             SS----TTT-
T ss_pred             CceEcCCcCC
Confidence            3558888887


No 284
>PRK06260 threonine synthase; Validated
Probab=20.38  E-value=94  Score=20.99  Aligned_cols=27  Identities=30%  Similarity=0.625  Sum_probs=17.0

Q ss_pred             ccCCcccccccCchhHHHHHHhcCCCCceeCCCCCCCcC
Q psy10278         24 FQCPVCGFTTGRKATLQLHVRQHTREKPYACPTCEFKTG   62 (110)
Q Consensus        24 ~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~   62 (110)
                      +.|..|+..+...            ...+.|+.|+..+.
T Consensus         4 ~~C~~cg~~~~~~------------~~~~~Cp~cg~~l~   30 (397)
T PRK06260          4 LKCIECGKEYDPD------------EIIYTCPECGGLLE   30 (397)
T ss_pred             EEECCCCCCCCCC------------CccccCCCCCCeEE
Confidence            5788888766432            22467888875443


No 285
>PRK04351 hypothetical protein; Provisional
Probab=20.28  E-value=69  Score=18.53  Aligned_cols=32  Identities=25%  Similarity=0.556  Sum_probs=20.7

Q ss_pred             ceeCCCCCCCcCChHHHHHHHHhcCCCCceeccCCCcccc
Q psy10278         51 PYACPTCEFKTGDHNVLRKHVQRHMPVKKYQCTFCSYSCT   90 (110)
Q Consensus        51 ~~~c~~c~~~~~~~~~l~~h~~~h~~~~p~~C~~C~~~f~   90 (110)
                      .|.|..|+..+...       +.+ ....|.|..|+-.+.
T Consensus       112 ~Y~C~~Cg~~~~r~-------Rr~-n~~~yrCg~C~g~L~  143 (149)
T PRK04351        112 LYECQSCGQQYLRK-------RRI-NTKRYRCGKCRGKLK  143 (149)
T ss_pred             EEECCCCCCEeeee-------eec-CCCcEEeCCCCcEee
Confidence            48898898765332       122 236699999986554


No 286
>PRK14138 NAD-dependent deacetylase; Provisional
Probab=20.21  E-value=1.7e+02  Score=18.32  Aligned_cols=13  Identities=23%  Similarity=0.506  Sum_probs=8.2

Q ss_pred             eeCCCCCCCcCCh
Q psy10278         52 YACPTCEFKTGDH   64 (110)
Q Consensus        52 ~~c~~c~~~~~~~   64 (110)
                      ..|..|+..+...
T Consensus       120 ~~C~~C~~~~~~~  132 (244)
T PRK14138        120 YYCVRCGKRYTVE  132 (244)
T ss_pred             eEECCCCCcccHH
Confidence            4677777766543


No 287
>KOG4602|consensus
Probab=20.12  E-value=36  Score=21.69  Aligned_cols=10  Identities=40%  Similarity=1.175  Sum_probs=5.9

Q ss_pred             ceeCCCCCCC
Q psy10278         51 PYACPTCEFK   60 (110)
Q Consensus        51 ~~~c~~c~~~   60 (110)
                      .|.|++||..
T Consensus       268 ~YVCPiCGAT  277 (318)
T KOG4602|consen  268 SYVCPICGAT  277 (318)
T ss_pred             hhcCcccccc
Confidence            3666666643


No 288
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=20.12  E-value=50  Score=15.76  Aligned_cols=12  Identities=17%  Similarity=0.523  Sum_probs=5.0

Q ss_pred             eeccCCCccccc
Q psy10278         80 YQCTFCSYSCTE   91 (110)
Q Consensus        80 ~~C~~C~~~f~~   91 (110)
                      ..|+.|++.+..
T Consensus         3 v~CP~C~k~~~~   14 (57)
T PF03884_consen    3 VKCPICGKPVEW   14 (57)
T ss_dssp             EE-TTT--EEE-
T ss_pred             ccCCCCCCeecc
Confidence            357777776554


Done!