RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy10279
         (80 letters)



>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA
          branch site protein p14 (SF3B14) and similar proteins. 
          This subfamily corresponds to the RRM of SF3B14 (also
          termed p14), a 14 kDa protein subunit of SF3B which is
          a multiprotein complex that is an integral part of the
          U2 small nuclear ribonucleoprotein (snRNP) and the
          U11/U12 di-snRNP. SF3B is essential for the accurate
          excision of introns from pre-messenger RNA and has been
          involved in the recognition of the pre-mRNA's branch
          site within the major and minor spliceosomes. SF3B14
          associates directly with another SF3B subunit called
          SF3B155. It is also present in both U2- and
          U12-dependent spliceosomes and may contribute to branch
          site positioning in both the major and minor
          spliceosome. Moreover, SF3B14 interacts directly with
          the pre-mRNA branch adenosine early in spliceosome
          assembly and within the fully assembled spliceosome.
          SF3B14 contains one well conserved RNA recognition
          motif (RRM), also termed RBD (RNA binding domain) or
          RNP (ribonucleoprotein domain). .
          Length = 77

 Score = 88.1 bits (219), Expect = 5e-25
 Identities = 31/41 (75%), Positives = 39/41 (95%)

Query: 16 VNRVLYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTR 56
          VNR+LY+RNLP+KI+ +E+YD+FGKYGAIRQIRIGNT +TR
Sbjct: 1  VNRILYVRNLPFKISSEELYDLFGKYGAIRQIRIGNTKETR 41


>gnl|CDD|214636 smart00360, RRM, RNA recognition motif. 
          Length = 73

 Score = 44.5 bits (106), Expect = 7e-08
 Identities = 11/38 (28%), Positives = 22/38 (57%)

Query: 19 VLYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTR 56
           L++ NLP   T +E+ ++F K+G +  +R+    +T 
Sbjct: 1  TLFVGNLPPDTTEEELRELFSKFGKVESVRLVRDKETG 38


>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal
          pre-messenger RNA splicing protein 24 (Prp24) and
          similar proteins.  This subfamily corresponds to the
          RRM3 of Prp24, also termed U4/U6
          snRNA-associated-splicing factor PRP24 (U4/U6 snRNP),
          an RNA-binding protein with four well conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          It facilitates U6 RNA base-pairing with U4 RNA during
          spliceosome assembly. Prp24 specifically binds free U6
          RNA primarily with RRMs 1 and 2 and facilitates pairing
          of U6 RNA bases with U4 RNA bases. Additionally, it may
          also be involved in dissociation of the U4/U6 complex
          during spliceosome activation. .
          Length = 78

 Score = 41.9 bits (99), Expect = 9e-07
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTRYLTKSLVMKCMIFLV 71
          R +Y+RNL +K+  D++  IF K+G +  IRI   P  +   +  +     F+ 
Sbjct: 1  REIYVRNLDFKLDEDDLRGIFSKFGEVESIRI---PKKQDEKQGRLNNGFAFVT 51


>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif. (a.k.a. RRM, RBD, or RNP
          domain).  The RRM motif is probably diagnostic of an
          RNA binding protein. RRMs are found in a variety of RNA
          binding proteins, including various hnRNP proteins,
          proteins implicated in regulation of alternative
          splicing, and protein components of snRNPs. The motif
          also appears in a few single stranded DNA binding
          proteins. The RRM structure consists of four strands
          and two helices arranged in an alpha/beta sandwich,
          with a third helix present during RNA binding in some
          cases The C-terminal beta strand (4th strand) and final
          helix are hard to align and have been omitted in the
          SEED alignment The LA proteins have an N terminal rrm
          which is included in the seed. There is a second region
          towards the C terminus that has some features
          characteristic of a rrm but does not appear to have the
          important structural core of a rrm. The LA proteins are
          one of the main autoantigens in Systemic lupus
          erythematosus (SLE), an autoimmune disease.
          Length = 70

 Score = 40.7 bits (96), Expect = 2e-06
 Identities = 13/30 (43%), Positives = 20/30 (66%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          L++ NLP   T +++ D+F K+G I  IRI
Sbjct: 1  LFVGNLPPDTTEEDLKDLFSKFGPIESIRI 30


>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General
           function prediction only].
          Length = 306

 Score = 43.0 bits (100), Expect = 2e-06
 Identities = 14/53 (26%), Positives = 32/53 (60%)

Query: 3   MSQRRANVRLPPEVNRVLYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDT 55
            S+   + +   E N  L++ NLPY +T +++ ++F K+G ++++R+    +T
Sbjct: 101 SSESPKSRQKSKEENNTLFVGNLPYDVTEEDLRELFKKFGPVKRVRLVRDRET 153


>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily.  RRM,
          also known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), is a highly abundant domain
          in eukaryotes found in proteins involved in
          post-transcriptional gene expression processes
          including mRNA and rRNA processing, RNA export, and RNA
          stability. This domain is 90 amino acids in length and
          consists of a four-stranded beta-sheet packed against
          two alpha-helices. RRM usually interacts with ssRNA,
          but is also known to interact with ssDNA as well as
          proteins. RRM binds a variable number of nucleotides,
          ranging from two to eight. The active site includes
          three aromatic side-chains located within the conserved
          RNP1 and RNP2 motifs of the domain. The RRM domain is
          found in a variety heterogeneous nuclear
          ribonucleoproteins (hnRNPs), proteins implicated in
          regulation of alternative splicing, and protein
          components of small nuclear ribonucleoproteins
          (snRNPs).
          Length = 72

 Score = 40.4 bits (95), Expect = 3e-06
 Identities = 12/37 (32%), Positives = 22/37 (59%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTR 56
          L++ NLP   T +++ ++F K+G I  +RI    D +
Sbjct: 1  LFVGNLPPDTTEEDLRELFSKFGEIESVRIVRDKDGK 37


>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2
          and similar proteins.  This subfamily corresponds to
          the RRM2 of yeast protein gar2, a novel nucleolar
          protein required for 18S rRNA and 40S ribosomal subunit
          accumulation. It shares similar domain architecture
          with nucleolin from vertebrates and NSR1 from
          Saccharomyces cerevisiae. The highly phosphorylated
          N-terminal domain of gar2 is made up of highly acidic
          regions separated from each other by basic sequences,
          and contains multiple phosphorylation sites. The
          central domain of gar2 contains two closely adjacent
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains). The C-terminal RGG (or GAR) domain of gar2 is
          rich in glycine, arginine and phenylalanine residues. .
          Length = 73

 Score = 39.7 bits (93), Expect = 5e-06
 Identities = 13/36 (36%), Positives = 22/36 (61%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDT 55
          L++ NL +    D +Y+ FG+YG I  +R+   PD+
Sbjct: 1  LFVGNLSFDADEDSIYEAFGEYGEISSVRLPTDPDS 36


>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding
          protein 28 (RBM28) and similar proteins.  This
          subfamily corresponds to the RRM3 of RBM28 and Nop4p.
          RBM28 is a specific nucleolar component of the
          spliceosomal small nuclear ribonucleoproteins (snRNPs),
          possibly coordinating their transition through the
          nucleolus. It specifically associates with U1, U2, U4,
          U5, and U6 small nuclear RNAs (snRNAs), and may play a
          role in the maturation of both small nuclear and
          ribosomal RNAs. RBM28 has four RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an extremely acidic
          region between RRM2 and RRM3. The family also includes
          nucleolar protein 4 (Nop4p or Nop77p) encoded by
          YPL043W from Saccharomyces cerevisiae. It is an
          essential nucleolar protein involved in processing and
          maturation of 27S pre-rRNA and biogenesis of 60S
          ribosomal subunits. Nop4p also contains four RRMs.  .
          Length = 82

 Score = 37.6 bits (88), Expect = 4e-05
 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 9/58 (15%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDT---------RYLTKSLVMKC 66
          R ++IRNLP+  T +E+ ++F ++G ++  RI     T         ++ TK    KC
Sbjct: 1  RTVFIRNLPFDATEEELKELFSQFGEVKYARIVKDKLTGHSKGTAFVKFKTKESAQKC 58


>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell
          carcinoma antigen recognized by T-cells 3 (SART3) and
          similar proteins.  This subfamily corresponds to the
          RRM2 of SART3, also termed Tat-interacting protein of
          110 kDa (Tip110), is an RNA-binding protein expressed
          in the nucleus of the majority of proliferating cells,
          including normal cells and malignant cells, but not in
          normal tissues except for the testes and fetal liver.
          It is involved in the regulation of mRNA splicing
          probably via its complex formation with RNA-binding
          protein with a serine-rich domain (RNPS1), a
          pre-mRNA-splicing factor. SART3 has also been
          identified as a nuclear Tat-interacting protein that
          regulates Tat transactivation activity through direct
          interaction and functions as an important cellular
          factor for HIV-1 gene expression and viral replication.
          In addition, SART3 is required for U6 snRNP targeting
          to Cajal bodies. It binds specifically and directly to
          the U6 snRNA, interacts transiently with the U6 and
          U4/U6 snRNPs, and promotes the reassembly of U4/U6
          snRNPs after splicing in vitro. SART3 contains an
          N-terminal half-a-tetratricopeptide repeat (HAT)-rich
          domain, a nuclearlocalization signal (NLS) domain, and
          two C-terminal RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). .
          Length = 81

 Score = 37.4 bits (87), Expect = 5e-05
 Identities = 9/30 (30%), Positives = 21/30 (70%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          L++  LP+ +T +E+  +F K+G ++ +R+
Sbjct: 5  LFVSGLPFSVTKEELEKLFKKHGVVKSVRL 34


>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in
          RNA-binding protein 19 (RBM19) and RNA recognition
          motif 2 found in multiple RNA-binding domain-containing
          protein 1 (MRD1).  This subfamily corresponds to the
          RRM3 of RBM19 and RRM2 of MRD1. RBM19, also termed
          RNA-binding domain-1 (RBD-1), is a nucleolar protein
          conserved in eukaryotes involved in ribosome biogenesis
          by processing rRNA and is essential for preimplantation
          development. It has a unique domain organization
          containing 6 conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). MRD1 is encoded by a novel
          yeast gene MRD1 (multiple RNA-binding domain). It is
          well conserved in yeast and its homologs exist in all
          eukaryotes. MRD1 is present in the nucleolus and the
          nucleoplasm. It interacts with the 35 S precursor rRNA
          (pre-rRNA) and U3 small nucleolar RNAs (snoRNAs). It is
          essential for the initial processing at the A0-A2
          cleavage sites in the 35 S pre-rRNA. MRD1 contains 5
          conserved RRMs, which may play an important structural
          role in organizing specific rRNA processing events. .
          Length = 74

 Score = 36.9 bits (86), Expect = 6e-05
 Identities = 10/30 (33%), Positives = 21/30 (70%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          L++RNLP+  T +E+ ++F  +G I ++ +
Sbjct: 2  LFVRNLPFTTTEEELRELFEAFGEISEVHL 31


>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins
          family, Drosophila sex-lethal (SXL), and similar
          proteins.  This subfamily corresponds to the RRM2 of Hu
          proteins and SXL. The Hu proteins family represents a
          group of RNA-binding proteins involved in diverse
          biological processes. Since the Hu proteins share high
          homology with the Drosophila embryonic lethal abnormal
          vision (ELAV) protein, the Hu family is sometimes
          referred to as the ELAV family. Drosophila ELAV is
          exclusively expressed in neurons and is required for
          the correct differentiation and survival of neurons in
          flies. The neuronal members of the Hu family include
          Hu-antigen B (HuB or ELAV-2 or Hel-N1), Hu-antigen C
          (HuC or ELAV-3 or PLE21), and Hu-antigen D (HuD or
          ELAV-4), which play important roles in neuronal
          differentiation, plasticity and memory. HuB is also
          expressed in gonads. Hu-antigen R (HuR or ELAV-1 or
          HuA) is the ubiquitously expressed Hu family member. It
          has a variety of biological functions mostly related to
          the regulation of cellular response to DNA damage and
          other types of stress. Hu proteins perform their
          cytoplasmic and nuclear molecular functions by
          coordinately regulating functionally related mRNAs. In
          the cytoplasm, Hu proteins recognize and bind to
          AU-rich RNA elements (AREs) in the 3' untranslated
          regions (UTRs) of certain target mRNAs, such as GAP-43,
          vascular epithelial growth factor (VEGF), the glucose
          transporter GLUT1, eotaxin and c-fos, and stabilize
          those ARE-containing mRNAs. They also bind and regulate
          the translation of some target mRNAs, such as
          neurofilament M, GLUT1, and p27. In the nucleus, Hu
          proteins function as regulators of polyadenylation and
          alternative splicing. Each Hu protein contains three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an ARE. RRM3
          may help to maintain the stability of the RNA-protein
          complex, and might also bind to poly(A) tails or be
          involved in protein-protein interactions. Also included
          in this subfamily is the sex-lethal protein (SXL) from
          Drosophila melanogaster. SXL governs sexual
          differentiation and X chromosome dosage compensation in
          flies. It induces female-specific alternative splicing
          of the transformer (tra) pre-mRNA by binding to the tra
          uridine-rich polypyrimidine tract at the
          non-sex-specific 3' splice site during the
          sex-determination process. SXL binds also to its own
          pre-mRNA and promotes female-specific alternative
          splicing. SXL contains an N-terminal Gly/Asn-rich
          domain that may be responsible for the protein-protein
          interaction, and tandem RRMs that show high preference
          to bind single-stranded, uridine-rich target RNA
          transcripts. .
          Length = 79

 Score = 37.2 bits (86), Expect = 6e-05
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          LY+  LP  +T  E+  +F +YG I   RI
Sbjct: 3  LYVSGLPKTMTQKELEQLFSQYGRIITSRI 32


>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila
          sex-lethal (SXL) and similar proteins.  This subfamily
          corresponds to the RRM2 of the sex-lethal protein (SXL)
          which governs sexual differentiation and X chromosome
          dosage compensation in Drosophila melanogaster. It
          induces female-specific alternative splicing of the
          transformer (tra) pre-mRNA by binding to the tra
          uridine-rich polypyrimidine tract at the
          non-sex-specific 3' splice site during the
          sex-determination process. SXL binds also to its own
          pre-mRNA and promotes female-specific alternative
          splicing. SXL contains an N-terminal Gly/Asn-rich
          domain that may be responsible for the protein-protein
          interaction, and tandem RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), that show high preference
          to bind single-stranded, uridine-rich target RNA
          transcripts. .
          Length = 79

 Score = 36.8 bits (85), Expect = 8e-05
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          LY+ NLP ++T DE+  IF  YG I Q  +
Sbjct: 3  LYVTNLPRQLTEDELRKIFEAYGNIVQCNL 32


>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger
          CCHC-type and RNA-binding motif-containing protein 1
          (ZCRB1) and similar proteins.  This subfamily
          corresponds to the RRM of ZCRB1, also termed MADP-1, or
          U11/U12 small nuclear ribonucleoprotein 31 kDa protein
          (U11/U12 snRNP 31 or U11/U12-31K), a novel
          multi-functional nuclear factor, which may be involved
          in morphine dependence, cold/heat stress, and
          hepatocarcinoma. It is located in the nucleoplasm, but
          outside the nucleolus. ZCRB1 is one of the components
          of U11/U12 snRNPs that bind to U12-type pre-mRNAs and
          form a di-snRNP complex, simultaneously recognizing the
          5' splice site and branchpoint sequence. ZCRB1 is
          characterized by an RNA recognition motif (RRM), also
          termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and a CCHC-type Zinc finger
          motif. In addition, it contains core nucleocapsid
          motifs, and Lys- and Glu-rich domains.  .
          Length = 78

 Score = 36.1 bits (84), Expect = 1e-04
 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 9/65 (13%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTR---------YLTKSLVMKCMIFL 70
          +Y+ NLP+ +T ++++ IF KYG + ++ I    +TR         +L +    KC+  L
Sbjct: 4  VYVSNLPFSLTNNDLHKIFSKYGKVVKVTIVKDKETRKSKGVAFILFLDREDAHKCVKAL 63

Query: 71 VNMEL 75
           N EL
Sbjct: 64 NNKEL 68


>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor.  This
           model describes the sex-lethal family of splicing
           factors found in Dipteran insects. The sex-lethal
           phenotype, however, may be limited to the Melanogasters
           and closely related species. In Drosophila the protein
           acts as an inhibitor of splicing. This subfamily is most
           closely related to the ELAV/HUD subfamily of splicing
           factors (TIGR01661).
          Length = 346

 Score = 37.7 bits (87), Expect = 1e-04
 Identities = 17/30 (56%), Positives = 20/30 (66%)

Query: 20  LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
           LY+ NLP  IT D++  IFGKYG I Q  I
Sbjct: 196 LYVTNLPRTITDDQLDTIFGKYGQIVQKNI 225


>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter
          pylori HP0827 protein and similar proteins.  This
          subfamily corresponds to the RRM of H. pylori HP0827, a
          putative ssDNA-binding protein 12rnp2 precursor,
          containing one RNA recognition motif (RRM), also termed
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain). The ssDNA binding may be important in
          activation of HP0827. .
          Length = 78

 Score = 36.1 bits (84), Expect = 1e-04
 Identities = 13/36 (36%), Positives = 24/36 (66%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDT 55
          LY+ NLPY +T +++ D+FG++G +   R+    +T
Sbjct: 2  LYVGNLPYNVTEEDLKDLFGQFGEVTSARVITDRET 37


>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras
          GTPase-activating protein-binding protein G3BP1, G3BP2
          and similar proteins.  This subfamily corresponds to
          the RRM domain in the G3BP family of RNA-binding and
          SH3 domain-binding proteins. G3BP acts at the level of
          RNA metabolism in response to cell signaling, possibly
          as RNA transcript stabilizing factors or an RNase.
          Members include G3BP1, G3BP2 and similar proteins.
          These proteins associate directly with the SH3 domain
          of GTPase-activating protein (GAP), which functions as
          an inhibitor of Ras. They all contain an N-terminal
          nuclear transfer factor 2 (NTF2)-like domain, an acidic
          domain, a domain containing PXXP motif(s), an RNA
          recognition motif (RRM), and an Arg-Gly-rich region
          (RGG-rich region, or arginine methylation motif).
          Length = 81

 Score = 35.4 bits (82), Expect = 3e-04
 Identities = 12/33 (36%), Positives = 23/33 (69%)

Query: 17 NRVLYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          +  L++ NLP+ IT DE+ + F ++G + ++RI
Sbjct: 3  SHQLFVGNLPHDITEDELKEFFKEFGNVLEVRI 35


>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in
          serine/arginine-rich splicing factor 1 (SRSF1) and
          similar proteins.  This subgroup corresponds to the
          RRM1 in three serine/arginine (SR) proteins:
          serine/arginine-rich splicing factor 1 (SRSF1 or
          ASF-1), serine/arginine-rich splicing factor 9 (SRSF9
          or SRp30C), and plant pre-mRNA-splicing factor SF2
          (SR1). SRSF1 is a shuttling SR protein involved in
          constitutive and alternative splicing,
          nonsense-mediated mRNA decay (NMD), mRNA export and
          translation. It also functions as a splicing-factor
          oncoprotein that regulates apoptosis and proliferation
          to promote mammary epithelial cell transformation.
          SRSF9 has been implicated in the activity of many
          elements that control splice site selection, the
          alternative splicing of the glucocorticoid receptor
          beta in neutrophils and in the gonadotropin-releasing
          hormone pre-mRNA. It can also interact with other
          proteins implicated in alternative splicing, including
          YB-1, rSLM-1, rSLM-2, E4-ORF4, Nop30, and p32. Both,
          SRSF1 and SRSF9, contain two N-terminal RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and a C-terminal
          RS domains rich in serine-arginine dipeptides. In
          contrast, SF2 contains two N-terminal RRMs and a
          C-terminal PSK domain rich in proline, serine and
          lysine residues.  .
          Length = 72

 Score = 35.4 bits (82), Expect = 3e-04
 Identities = 13/34 (38%), Positives = 20/34 (58%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTP 53
          +Y+ NLP  I   ++ D+F KYG I+ I + N  
Sbjct: 2  IYVGNLPGDIRERDIEDLFYKYGPIKAIDLKNRR 35


>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding
          protein 28 (RBM28) and similar proteins.  This
          subfamily corresponds to the RRM2 of RBM28 and Nop4p.
          RBM28 is a specific nucleolar component of the
          spliceosomal small nuclear ribonucleoproteins (snRNPs),
          possibly coordinating their transition through the
          nucleolus. It specifically associates with U1, U2, U4,
          U5, and U6 small nuclear RNAs (snRNAs), and may play a
          role in the maturation of both small nuclear and
          ribosomal RNAs. RBM28 has four RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an extremely acidic
          region between RRM2 and RRM3. The family also includes
          nucleolar protein 4 (Nop4p or Nop77p) encoded by
          YPL043W from Saccharomyces cerevisiae. It is an
          essential nucleolar protein involved in processing and
          maturation of 27S pre-rRNA and biogenesis of 60S
          ribosomal subunits. Nop4p also contains four RRMs.  .
          Length = 76

 Score = 35.3 bits (82), Expect = 3e-04
 Identities = 12/37 (32%), Positives = 22/37 (59%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTR 56
          L +RNLP+K T  ++  +F  +G + ++ I   PD +
Sbjct: 2  LIVRNLPFKCTEADLKKLFSPFGFVWEVTIPRKPDGK 38


>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast
          nucleolar protein 13 (Nop13p) and similar proteins.
          This subfamily corresponds to the RRM2 of Nop13p
          encoded by YNL175c from Saccharomyces cerevisiae. It
          shares high sequence similarity with nucleolar protein
          12 (Nop12p). Both Nop12p and Nop13p are not essential
          for growth. However, unlike Nop12p that is localized to
          the nucleolus, Nop13p localizes primarily to the
          nucleolus but is also present in the nucleoplasm to a
          lesser extent. Nop13p contains two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains). .
          Length = 73

 Score = 35.1 bits (81), Expect = 4e-04
 Identities = 13/36 (36%), Positives = 23/36 (63%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDT 55
          L++ NL ++ T DE+   FG+ G IR++R+    D+
Sbjct: 1  LFVGNLSFETTEDELRAHFGRVGRIRRVRMMTFEDS 36


>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple
          RNA-binding domain-containing protein 1 (MRD1) and
          similar proteins.  This subgroup corresponds to the
          RRM2 of MRD1 which is encoded by a novel yeast gene
          MRD1 (multiple RNA-binding domain). It is
          well-conserved in yeast and its homologs exist in all
          eukaryotes. MRD1 is present in the nucleolus and the
          nucleoplasm. It interacts with the 35 S precursor rRNA
          (pre-rRNA) and U3 small nucleolar RNAs (snoRNAs). It is
          essential for the initial processing at the A0-A2
          cleavage sites in the 35 S pre-rRNA. MRD1 contains 5
          conserved RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), which may play an important structural role
          in organizing specific rRNA processing events. .
          Length = 79

 Score = 35.1 bits (81), Expect = 4e-04
 Identities = 10/36 (27%), Positives = 21/36 (58%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDT 55
          L++RNLPY    D++  +F K+G + ++ +     +
Sbjct: 5  LFVRNLPYSCKEDDLEKLFSKFGELSEVHVAIDKKS 40


>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in
          granule-associated RNA binding proteins (p40-TIA-1 and
          TIAR), and yeast nuclear and cytoplasmic polyadenylated
          RNA-binding protein PUB1.  This subfamily corresponds
          to the RRM3 of TIA-1, TIAR, and PUB1. Nucleolysin TIA-1
          isoform p40 (p40-TIA-1 or TIA-1) and nucleolysin
          TIA-1-related protein (TIAR) are granule-associated RNA
          binding proteins involved in inducing apoptosis in
          cytotoxic lymphocyte (CTL) target cells. They share
          high sequence similarity and are expressed in a wide
          variety of cell types. TIA-1 can be phosphorylated by a
          serine/threonine kinase that is activated during
          Fas-mediated apoptosis.TIAR is mainly localized in the
          nucleus of hematopoietic and nonhematopoietic cells. It
          is translocated from the nucleus to the cytoplasm in
          response to exogenous triggers of apoptosis. Both TIA-1
          and TIAR bind specifically to poly(A) but not to
          poly(C) homopolymers. They are composed of three
          N-terminal highly homologous RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a glutamine-rich
          C-terminal auxiliary domain containing a
          lysosome-targeting motif. TIA-1 and TIAR interact with
          RNAs containing short stretches of uridylates and their
          RRM2 can mediate the specific binding to uridylate-rich
          RNAs. The C-terminal auxiliary domain may be
          responsible for interacting with other proteins. In
          addition, TIA-1 and TIAR share a potential serine
          protease-cleavage site (Phe-Val-Arg) localized at the
          junction between their RNA binding domains and their
          C-terminal auxiliary domains. This subfamily also
          includes a yeast nuclear and cytoplasmic polyadenylated
          RNA-binding protein PUB1, termed ARS consensus-binding
          protein ACBP-60, or poly uridylate-binding protein, or
          poly(U)-binding protein, which has been identified as
          both a heterogeneous nuclear RNA-binding protein
          (hnRNP) and a cytoplasmic mRNA-binding protein (mRNP).
          It may be stably bound to a translationally inactive
          subpopulation of mRNAs within the cytoplasm. PUB1 is
          distributed in both, the nucleus and the cytoplasm, and
          binds to poly(A)+ RNA (mRNA or pre-mRNA). Although it
          is one of the major cellular proteins cross-linked by
          UV light to polyadenylated RNAs in vivo, PUB1 is
          nonessential for cell growth in yeast. PUB1 also binds
          to T-rich single stranded DNA (ssDNA); however, there
          is no strong evidence implicating PUB1 in the mechanism
          of DNA replication. PUB1 contains three RRMs, and a GAR
          motif (glycine and arginine rich stretch) that is
          located between RRM2 and RRM3. .
          Length = 73

 Score = 34.9 bits (81), Expect = 4e-04
 Identities = 11/30 (36%), Positives = 21/30 (70%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          +Y+ NLP+ +T +E+   F  +GAI ++R+
Sbjct: 3  VYVGNLPHGLTEEELQRTFSPFGAIEEVRV 32


>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous
          nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA
          recognition motif 1 (hRBMY), testis-specific
          heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T)
          and similar proteins.  This subfamily corresponds to
          the RRM domain of hnRNP G, also termed glycoprotein p43
          or RBMX, an RNA-binding motif protein located on the X
          chromosome. It is expressed ubiquitously and has been
          implicated in the splicing control of several
          pre-mRNAs. Moreover, hnRNP G may function as a
          regulator of transcription for SREBP-1c and GnRH1.
          Research has shown that hnRNP G may also act as a
          tumor-suppressor since it upregulates the Txnip gene
          and promotes the fidelity of DNA end-joining activity.
          In addition, hnRNP G appears to play a critical role in
          proper neural development of zebrafish and frog
          embryos. The family also includes several paralogs of
          hnRNP G, such as hRBMY and hnRNP G-T (also termed
          RNA-binding motif protein, X-linked-like-2). Both,
          hRBMY and hnRNP G-T, are exclusively expressed in
          testis and critical for male fertility. Like hnRNP G,
          hRBMY and hnRNP G-T interact with factors implicated in
          the regulation of pre-mRNA splicing, such as
          hTra2-beta1 and T-STAR. Although members in this family
          share a high conserved N-terminal RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), they appear to recognize
          different RNA targets. For instance, hRBMY interacts
          specifically with a stem-loop structure in which the
          loop is formed by the sequence CA/UCAA. In contrast,
          hnRNP G associates with single stranded RNA sequences
          containing a CCA/C motif. In addition to the RRM, hnRNP
          G contains a nascent transcripts targeting domain (NTD)
          in the middle region and a novel auxiliary RNA-binding
          domain (RBD) in its C-terminal region. The C-terminal
          RBD exhibits distinct RNA binding specificity, and
          would play a critical role in the regulation of
          alternative splicing by hnRNP G. .
          Length = 80

 Score = 34.9 bits (81), Expect = 4e-04
 Identities = 9/37 (24%), Positives = 20/37 (54%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTR 56
          L++  L  + T  E+  +F K+G + ++ +   P+T 
Sbjct: 4  LFVSGLSTRTTEKELEALFSKFGRVEEVLLMKDPETG 40


>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding
          protein 28 (RBM28) and similar proteins.  This
          subfamily corresponds to the RRM1 of RBM28 and Nop4p.
          RBM28 is a specific nucleolar component of the
          spliceosomal small nuclear ribonucleoproteins (snRNPs),
          possibly coordinating their transition through the
          nucleolus. It specifically associates with U1, U2, U4,
          U5, and U6 small nuclear RNAs (snRNAs), and may play a
          role in the maturation of both small nuclear and
          ribosomal RNAs. RBM28 has four RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an extremely acidic
          region between RRM2 and RRM3. The family also includes
          nucleolar protein 4 (Nop4p or Nop77p) encoded by
          YPL043W from Saccharomyces cerevisiae. It is an
          essential nucleolar protein involved in processing and
          maturation of 27S pre-rRNA and biogenesis of 60S
          ribosomal subunits. Nop4p also contains four RRMs.  .
          Length = 79

 Score = 34.9 bits (81), Expect = 5e-04
 Identities = 10/28 (35%), Positives = 19/28 (67%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQI 47
          L++RNLPY  T +++ + F + G I++ 
Sbjct: 2  LFVRNLPYDTTDEQLEEFFSEVGPIKRC 29


>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the
          U1A/U2B"/SNF protein family.  This subfamily
          corresponds to the RRM1 of U1A/U2B"/SNF protein family
          which contains Drosophila sex determination protein SNF
          and its two mammalian counterparts, U1 small nuclear
          ribonucleoprotein A (U1 snRNP A or U1-A or U1A) and U2
          small nuclear ribonucleoprotein B" (U2 snRNP B" or
          U2B"), all of which consist of two RNA recognition
          motifs (RRMs), connected by a variable, flexible
          linker. SNF is an RNA-binding protein found in the U1
          and U2 snRNPs of Drosophila where it is essential in
          sex determination and possesses a novel dual RNA
          binding specificity. SNF binds with high affinity to
          both Drosophila U1 snRNA stem-loop II (SLII) and U2
          snRNA stem-loop IV (SLIV). It can also bind to poly(U)
          RNA tracts flanking the alternatively spliced
          Sex-lethal (Sxl) exon, as does Drosophila Sex-lethal
          protein (SXL). U1A is an RNA-binding protein associated
          with the U1 snRNP, a small RNA-protein complex involved
          in pre-mRNA splicing. U1A binds with high affinity and
          specificity to stem-loop II (SLII) of U1 snRNA. It is
          predominantly a nuclear protein that shuttles between
          the nucleus and the cytoplasm independently of
          interactions with U1 snRNA. Moreover, U1A may be
          involved in RNA 3'-end processing, specifically
          cleavage, splicing and polyadenylation, through
          interacting with a large number of non-snRNP proteins.
          U2B", initially identified to bind to stem-loop IV
          (SLIV) at the 3' end of U2 snRNA, is a unique protein
          that comprises of the U2 snRNP. Additional research
          indicates U2B" binds to U1 snRNA stem-loop II (SLII) as
          well and shows no preference for SLIV or SLII on the
          basis of binding affinity. Moreover, U2B" does not
          require an auxiliary protein for binding to RNA, and
          its nuclear transport is independent of U2 snRNA
          binding. .
          Length = 78

 Score = 34.4 bits (80), Expect = 6e-04
 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 4/41 (9%)

Query: 20 LYIRNLPYKITGDEM----YDIFGKYGAIRQIRIGNTPDTR 56
          LYI NL  KI  DE+    Y +F ++G +  I    T   R
Sbjct: 2  LYINNLNEKIKKDELKRSLYALFSQFGPVLDIVASKTLKMR 42


>gnl|CDD|240973 cd12529, RRM2_MEI2_like, RNA recognition motif 2 in plant
          Mei2-like proteins.  This subgroup corresponds to the
          RRM2 of Mei2-like proteins that represent an ancient
          eukaryotic RNA-binding proteins family. Their
          corresponding Mei2-like genes appear to have arisen
          early in eukaryote evolution, been lost from some
          lineages such as Saccharomyces cerevisiae and
          metazoans, and diversified in the plant lineage. The
          plant Mei2-like genes may function in cell fate
          specification during development, rather than as
          stimulators of meiosis. Members in this family contain
          three RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains). The C-terminal RRM (RRM3) is unique to
          Mei2-like proteins and is highly conserved between
          plants and fungi. To date, the intracellular
          localization, RNA target(s), cellular interactions and
          phosphorylation states of Mei2-like proteins in plants
          remain unclear. .
          Length = 71

 Score = 34.4 bits (79), Expect = 6e-04
 Identities = 15/38 (39%), Positives = 25/38 (65%), Gaps = 2/38 (5%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTRY 57
          L + NL   ++ D+++ IFG YG I++IR   TP+ R+
Sbjct: 4  LVVFNLDPSVSNDDLHQIFGAYGEIKEIR--ETPNKRH 39


>gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding
          protein MRN1 and similar proteins.  This subgroup
          corresponds to the RRM2 of MRN1, also termed multicopy
          suppressor of RSC-NHP6 synthetic lethality protein 1,
          or post-transcriptional regulator of 69 kDa, which is a
          RNA-binding protein found in yeast. Although its
          specific biological role remains unclear, MRN1 might be
          involved in translational regulation. Members in this
          family contain four copies of conserved RNA recognition
          motif (RRM), also known as RBD (RNA binding domain) or
          RNP (ribonucleoprotein domain). .
          Length = 78

 Score = 34.3 bits (79), Expect = 7e-04
 Identities = 13/32 (40%), Positives = 20/32 (62%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          R +YI NLP   + +E+ +   K+G I QI+I
Sbjct: 4  RNVYIGNLPESYSEEELREDLEKFGPIDQIKI 35


>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar
          protein 4 (Nop4p) and similar proteins.  This subgroup
          corresponds to the RRM3 of Nop4p (also known as
          Nop77p), encoded by YPL043W from Saccharomyces
          cerevisiae. It is an essential nucleolar protein
          involved in processing and maturation of 27S pre-rRNA
          and biogenesis of 60S ribosomal subunits. Nop4p has
          four RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains). .
          Length = 107

 Score = 34.9 bits (80), Expect = 7e-04
 Identities = 11/30 (36%), Positives = 18/30 (60%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          L++RNLPY  T + +   F K+G++R    
Sbjct: 4  LFVRNLPYDATEESLAPHFSKFGSVRYALP 33


>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I
          polyadenylate-binding proteins.  This subfamily
          corresponds to the RRM3 of type I poly(A)-binding
          proteins (PABPs), highly conserved proteins that bind
          to the poly(A) tail present at the 3' ends of most
          eukaryotic mRNAs. They have been implicated in the
          regulation of poly(A) tail length during the
          polyadenylation reaction, translation initiation, mRNA
          stabilization by influencing the rate of deadenylation
          and inhibition of mRNA decapping. The family represents
          type I polyadenylate-binding proteins (PABPs),
          including polyadenylate-binding protein 1 (PABP-1 or
          PABPC1), polyadenylate-binding protein 3 (PABP-3 or
          PABPC3), polyadenylate-binding protein 4 (PABP-4 or
          APP-1 or iPABP), polyadenylate-binding protein 5
          (PABP-5 or PABPC5), polyadenylate-binding protein
          1-like (PABP-1-like or PABPC1L), polyadenylate-binding
          protein 1-like 2 (PABPC1L2 or RBM32),
          polyadenylate-binding protein 4-like (PABP-4-like or
          PABPC4L), yeast polyadenylate-binding protein,
          cytoplasmic and nuclear (PABP or ACBP-67), and similar
          proteins. PABP-1 is an ubiquitously expressed
          multifunctional protein that may play a role in 3' end
          formation of mRNA, translation initiation, mRNA
          stabilization, protection of poly(A) from nuclease
          activity, mRNA deadenylation, inhibition of mRNA
          decapping, and mRNP maturation. Although PABP-1 is
          thought to be a cytoplasmic protein, it is also found
          in the nucleus. PABP-1 may be involved in
          nucleocytoplasmic trafficking and utilization of mRNP
          particles. PABP-1 contains four copies of RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains), a
          less well conserved linker region, and a proline-rich
          C-terminal conserved domain (CTD). PABP-3 is a
          testis-specific poly(A)-binding protein specifically
          expressed in round spermatids. It is mainly found in
          mammalian and may play an important role in the
          testis-specific regulation of mRNA homeostasis. PABP-3
          shows significant sequence similarity to PABP-1.
          However, it binds to poly(A) with a lower affinity than
          PABP-1. PABP-1 possesses an A-rich sequence in its
          5'-UTR and allows binding of PABP and blockage of
          translation of its own mRNA. In contrast, PABP-3 lacks
          the A-rich sequence in its 5'-UTR. PABP-4 is an
          inducible poly(A)-binding protein (iPABP) that is
          primarily localized to the cytoplasm. It shows
          significant sequence similarity to PABP-1 as well. The
          RNA binding properties of PABP-1 and PABP-4 appear to
          be identical. PABP-5 is encoded by PABPC5 gene within
          the X-specific subinterval, and expressed in fetal
          brain and in a range of adult tissues in mammalian,
          such as ovary and testis. It may play an important role
          in germ cell development. Moreover, unlike other PABPs,
          PABP-5 contains only four RRMs, but lacks both the
          linker region and the CTD. PABP-1-like and PABP-1-like
          2 are the orthologs of PABP-1. PABP-4-like is the
          ortholog of PABP-5. Their cellular functions remain
          unclear. The family also includes the yeast PABP, a
          conserved poly(A) binding protein containing poly(A)
          tails that can be attached to the 3'-ends of mRNAs. The
          yeast PABP and its homologs may play important roles in
          the initiation of translation and in mRNA decay. Like
          vertebrate PABP-1, the yeast PABP contains four RRMs, a
          linker region, and a proline-rich CTD as well. The
          first two RRMs are mainly responsible for specific
          binding to poly(A). The proline-rich region may be
          involved in protein-protein interactions. .
          Length = 80

 Score = 34.1 bits (79), Expect = 8e-04
 Identities = 9/25 (36%), Positives = 18/25 (72%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAI 44
          +Y++NL   +  +++ ++FGKYG I
Sbjct: 4  VYVKNLGEDMDDEKLKELFGKYGKI 28


>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a.k.a. RRM, RBD, or RNP
          domain). 
          Length = 69

 Score = 34.1 bits (79), Expect = 8e-04
 Identities = 11/30 (36%), Positives = 20/30 (66%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          LY+RNLP  +T +++ + F  YG +  +R+
Sbjct: 1  LYVRNLPPSVTEEDLREFFSPYGKVEGVRL 30


>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding
          protein 19 (RBM19) and similar proteins.  This subgroup
          corresponds to the RRM3 of RBM19, also termed
          RNA-binding domain-1 (RBD-1), which is a nucleolar
          protein conserved in eukaryotes. It is involved in
          ribosome biogenesis by processing rRNA. In addition, it
          is essential for preimplantation development. RBM19 has
          a unique domain organization containing 6 conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains). .
          Length = 79

 Score = 33.9 bits (78), Expect = 0.001
 Identities = 11/30 (36%), Positives = 20/30 (66%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          L+IRNL Y  T +++  +F KYG + ++ +
Sbjct: 5  LFIRNLAYTCTEEDLEKLFSKYGPLSEVHL 34


>gnl|CDD|240763 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition motif 4 in
          RNA-binding protein 19 (RBM19) and RNA recognition
          motif 3 in multiple RNA-binding domain-containing
          protein 1 (MRD1).  This subfamily corresponds to the
          RRM4 of RBM19 and the RRM3 of MRD1. RBM19, also termed
          RNA-binding domain-1 (RBD-1), is a nucleolar protein
          conserved in eukaryotes involved in ribosome biogenesis
          by processing rRNA and is essential for preimplantation
          development. It has a unique domain organization
          containing 6 conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). MRD1 is encoded by a novel
          yeast gene MRD1 (multiple RNA-binding domain). It is
          well conserved in yeast and its homologues exist in all
          eukaryotes. MRD1 is present in the nucleolus and the
          nucleoplasm. It interacts with the 35 S precursor rRNA
          (pre-rRNA) and U3 small nucleolar RNAs (snoRNAs). MRD1
          is essential for the initial processing at the A0-A2
          cleavage sites in the 35 S pre-rRNA. MRD1 contains 5
          conserved RRMs, which may play an important structural
          role in organizing specific rRNA processing events. .
          Length = 72

 Score = 33.7 bits (78), Expect = 0.001
 Identities = 9/30 (30%), Positives = 22/30 (73%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAIRQI 47
           V+ ++NLP+  T +E+ ++F K+G++ ++
Sbjct: 1  TVILVKNLPFGTTEEELRELFEKFGSLGRL 30


>gnl|CDD|240727 cd12281, RRM1_TatSF1_like, RNA recognition motif 1 in HIV
          Tat-specific factor 1 (Tat-SF1) and similar proteins.
          This subfamily corresponds to the RRM1 of Tat-SF1 and
          CUS2. Tat-SF1 is the cofactor for stimulation of
          transcriptional elongation by human immunodeficiency
          virus-type 1 (HIV-1) Tat. It is a substrate of an
          associated cellular kinase. Tat-SF1 contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and a highly acidic carboxyl-terminal half. The family
          also includes CUS2, a yeast homolog of human Tat-SF1.
          CUS2 interacts with U2 RNA in splicing extracts and
          functions as a splicing factor that aids assembly of
          the splicing-competent U2 snRNP in vivo. CUS2 also
          associates with PRP11 that is a subunit of the
          conserved splicing factor SF3a. Like Tat-SF1, CUS2
          contains two RRMs as well. .
          Length = 92

 Score = 33.7 bits (78), Expect = 0.002
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 17 NRVLYIRNLPYKITGDEMYDIFGKYGAIR 45
          N  +Y+  LP  IT +E  ++F K G I+
Sbjct: 1  NTNVYVSGLPLDITVEEFVEVFSKCGIIK 29


>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in
          serine/arginine-rich splicing factor SRSF10, SRSF12 and
          similar proteins.  This subfamily corresponds to the
          RRM of SRSF10 and SRSF12. SRSF10, also termed 40 kDa
          SR-repressor protein (SRrp40), or FUS-interacting
          serine-arginine-rich protein 1 (FUSIP1), or splicing
          factor SRp38, or splicing factor, arginine/serine-rich
          13A (SFRS13A), or TLS-associated protein with Ser-Arg
          repeats (TASR). It is a serine-arginine (SR) protein
          that acts as a potent and general splicing repressor
          when dephosphorylated. It mediates global inhibition of
          splicing both in M phase of the cell cycle and in
          response to heat shock. SRSF10 emerges as a modulator
          of cholesterol homeostasis through the regulation of
          low-density lipoprotein receptor (LDLR) splicing
          efficiency. It also regulates cardiac-specific
          alternative splicing of triadin pre-mRNA and is
          required for proper Ca2+ handling during embryonic
          heart development. In contrast, the phosphorylated
          SRSF10 functions as a sequence-specific splicing
          activator in the presence of a nuclear cofactor. It
          activates distal alternative 5' splice site of
          adenovirus E1A pre-mRNA in vivo. Moreover, SRSF10
          strengthens pre-mRNA recognition by U1 and U2 snRNPs.
          SRSF10 localizes to the nuclear speckles and can
          shuttle between nucleus and cytoplasm. SRSF12, also
          termed 35 kDa SR repressor protein (SRrp35), or
          splicing factor, arginine/serine-rich 13B (SFRS13B), or
          splicing factor, arginine/serine-rich 19 (SFRS19), is a
          serine/arginine (SR) protein-like alternative splicing
          regulator that antagonizes authentic SR proteins in the
          modulation of alternative 5' splice site choice. For
          instance, it activates distal alternative 5' splice
          site of the adenovirus E1A pre-mRNA in vivo. Both,
          SRSF10 and SRSF12, contain a single N-terminal RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), followed by
          a C-terminal RS domain rich in serine-arginine
          dipeptides. .
          Length = 84

 Score = 33.5 bits (77), Expect = 0.002
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          LY+RN+      D++  +FGKYG I  + I
Sbjct: 3  LYVRNVADATRPDDLRRLFGKYGPIVDVYI 32


>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces
          cerevisiae nucleolar protein 6 (Nop6) and similar
          proteins.  This subfamily corresponds to the RRM of
          Nop6, also known as Ydl213c, a component of 90S
          pre-ribosomal particles in yeast S. cerevisiae. It is
          enriched in the nucleolus and is required for 40S
          ribosomal subunit biogenesis. Nop6 is a non-essential
          putative RNA-binding protein with two N-terminal
          putative nuclear localisation sequences (NLS-1 and
          NLS-2) and an RNA recognition motif (RRM), also termed
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain). It binds to the pre-rRNA early during
          transcription and plays an essential role in pre-rRNA
          processing. .
          Length = 74

 Score = 33.1 bits (76), Expect = 0.002
 Identities = 11/37 (29%), Positives = 19/37 (51%)

Query: 19 VLYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDT 55
          +L++ NLPY  T +++   F   GA   +R+     T
Sbjct: 2  ILFVGNLPYDTTAEDLLAHFKNAGAPPSVRLLTDKKT 38


>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing
          regulatory glutamine/lysine-rich protein 1 (SREK1) and
          similar proteins.  This subfamily corresponds to the
          RRM2 of SREK1, also termed
          serine/arginine-rich-splicing regulatory protein 86-kDa
          (SRrp86), or splicing factor arginine/serine-rich 12
          (SFRS12), or splicing regulatory protein 508 amino acid
          (SRrp508). SREK1 belongs to a family of proteins
          containing regions rich in serine-arginine dipeptides
          (SR proteins family), which is involved in
          bridge-complex formation and splicing by mediating
          protein-protein interactions across either introns or
          exons. It is a unique SR family member and it may play
          a crucial role in determining tissue specific patterns
          of alternative splicing. SREK1 can alter splice site
          selection by both positively and negatively modulating
          the activity of other SR proteins. For instance, SREK1
          can activate SRp20 and repress SC35 in a dose-dependent
          manner both in vitro and in vivo. In addition, SREK1
          contains two (some contain only one) RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and two
          serine-arginine (SR)-rich domains (SR domains)
          separated by an unusual glutamic acid-lysine (EK) rich
          region. The RRM and SR domains are highly conserved
          among other members of the SR superfamily. However, the
          EK domain is unique to SREK1. It plays a modulatory
          role controlling SR domain function by involvement in
          the inhibition of both constitutive and alternative
          splicing and in the selection of splice-site. .
          Length = 85

 Score = 33.4 bits (77), Expect = 0.002
 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 15 EVNRVLYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPD--TRY 57
          E+ R +Y+ NL    T D++ + F + G ++ +R+       TRY
Sbjct: 2  EIRRTIYVGNLDPTTTADQLLEFFSQAGEVKYVRMAGDETQPTRY 46


>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple
          RNA-binding domain-containing protein 1 (MRD1) and
          similar proteins.  This subgroup corresponds to the
          RRM5 of MRD1 which is encoded by a novel yeast gene
          MRD1 (multiple RNA-binding domain). It is
          well-conserved in yeast and its homologs exist in all
          eukaryotes. MRD1 is present in the nucleolus and the
          nucleoplasm. It interacts with the 35 S precursor rRNA
          (pre-rRNA) and U3 small nucleolar RNAs (snoRNAs). MRD1
          is essential for the initial processing at the A0-A2
          cleavage sites in the 35 S pre-rRNA. It contains 5
          conserved RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), which may play an important structural role
          in organizing specific rRNA processing events. .
          Length = 76

 Score = 33.3 bits (76), Expect = 0.002
 Identities = 8/30 (26%), Positives = 20/30 (66%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          + ++NLP++ T  ++  +F  YG ++ +R+
Sbjct: 3  ILVKNLPFEATKKDVRTLFSSYGQLKSVRV 32


>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in
          heterogeneous nuclear ribonucleoprotein R (hnRNP R) and
          similar proteins.  This subfamily corresponds to the
          RRM3 in hnRNP R, hnRNP Q, and APOBEC-1 complementation
          factor (ACF). hnRNP R is a ubiquitously expressed
          nuclear RNA-binding protein that specifically bind
          mRNAs with a preference for poly(U) stretches and has
          been implicated in mRNA processing and mRNA transport,
          and also acts as a regulator to modify binding to
          ribosomes and RNA translation. hnRNP Q is also a
          ubiquitously expressed nuclear RNA-binding protein. It
          has been identified as a component of the spliceosome
          complex, as well as a component of the apobec-1
          editosome, and has been implicated in the regulation of
          specific mRNA transport. ACF is an RNA-binding subunit
          of a core complex that interacts with apoB mRNA to
          facilitate C to U RNA editing. It may also act as an
          apoB mRNA recognition factor and chaperone and play a
          key role in cell growth and differentiation. This
          family also includes two functionally unknown
          RNA-binding proteins, RBM46 and RBM47. All members
          contain three conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains).
          Length = 72

 Score = 33.0 bits (76), Expect = 0.002
 Identities = 11/27 (40%), Positives = 20/27 (74%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAI 44
          +VLY+RNLP   T +++ ++F +YG +
Sbjct: 2  KVLYVRNLPLSTTEEQLRELFSEYGEV 28


>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in
          Pre-mRNA-splicing factor RBM22 and similar proteins.
          This subgroup corresponds to the RRM of RBM22 (also
          known as RNA-binding motif protein 22, or Zinc finger
          CCCH domain-containing protein 16), a newly discovered
          RNA-binding motif protein which belongs to the SLT11
          gene family. SLT11 gene encoding protein (Slt11p) is a
          splicing factor in yeast, which is required for
          spliceosome assembly. Slt11p has two distinct
          biochemical properties: RNA-annealing and RNA-binding
          activities. RBM22 is the homolog of SLT11 in
          vertebrate. It has been reported to be involved in
          pre-splicesome assembly and to interact with the
          Ca2+-signaling protein ALG-2. It also plays an
          important role in embryogenesis. RBM22 contains a
          conserved RNA recognition motif (RRM), also known as
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain), a zinc finger of the unusual type
          C-x8-C-x5-C-x3-H, and a C-terminus that is unusually
          rich in the amino acids Gly and Pro, including
          sequences of tetraprolines.
          Length = 74

 Score = 33.0 bits (76), Expect = 0.002
 Identities = 10/30 (33%), Positives = 18/30 (60%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          LY+  L  ++T  ++ D F ++G IR I +
Sbjct: 4  LYVGGLGERVTEKDLRDHFYQFGEIRSITV 33


>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated
          protein SR140 and similar proteins.  This subgroup
          corresponds to the RRM of SR140 (also termed U2
          snRNP-associated SURP motif-containing protein
          orU2SURP, or 140 kDa Ser/Arg-rich domain protein) which
          is a putative splicing factor mainly found in higher
          eukaryotes. Although it is initially identified as one
          of the 17S U2 snRNP-associated proteins, the molecular
          and physiological function of SR140 remains unclear.
          SR140 contains an N-terminal RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), a SWAP/SURP domain that is
          found in a number of pre-mRNA splicing factors in the
          middle region, and a C-terminal arginine/serine-rich
          domain (RS domain).
          Length = 84

 Score = 33.0 bits (76), Expect = 0.002
 Identities = 10/30 (33%), Positives = 19/30 (63%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          LY+ NL  K+T + +   FG++G +  ++I
Sbjct: 4  LYVGNLNPKVTEEVLCQEFGRFGPLASVKI 33


>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant
          Mei2-like proteins.  This subgroup corresponds to the
          RRM1 of Mei2-like proteins that represent an ancient
          eukaryotic RNA-binding proteins family. Their
          corresponding Mei2-like genes appear to have arisen
          early in eukaryote evolution, been lost from some
          lineages such as Saccharomyces cerevisiae and
          metazoans, and diversified in the plant lineage. The
          plant Mei2-like genes may function in cell fate
          specification during development, rather than as
          stimulators of meiosis. Members in this family contain
          three RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains). The C-terminal RRM (RRM3) is unique to
          Mei2-like proteins and it is highly conserved between
          plants and fungi. Up to date, the intracellular
          localization, RNA target(s), cellular interactions and
          phosphorylation states of Mei2-like proteins in plants
          remain unclear. .
          Length = 77

 Score = 33.0 bits (76), Expect = 0.003
 Identities = 9/30 (30%), Positives = 19/30 (63%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAIRQI 47
          R L++RN+   +  +E+  +F ++G IR +
Sbjct: 2  RTLFVRNINSNVEDEELRALFEQFGDIRTL 31


>gnl|CDD|240685 cd12239, RRM2_RBM40_like, RNA recognition motif 2 in RNA-binding
          protein 40 (RBM40) and similar proteins.  This
          subfamily corresponds to the RRM2 of RBM40 and the RRM
          of RBM41. RBM40, also known as RNA-binding
          region-containing protein 3 (RNPC3) or U11/U12 small
          nuclear ribonucleoprotein 65 kDa protein (U11/U12-65K
          protein). It serves as a bridging factor between the
          U11 and U12 snRNPs. It contains two RNA recognition
          motifs (RRMs), also known as RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), connected by a
          linker that includes a proline-rich region. It binds to
          the U11-associated 59K protein via its RRM1 and employs
          the RRM2 to bind hairpin III of the U12 small nuclear
          RNA (snRNA). The proline-rich region might be involved
          in protein-protein interactions. RBM41 contains only
          one RRM. Its biological function remains unclear. .
          Length = 82

 Score = 32.5 bits (75), Expect = 0.003
 Identities = 8/25 (32%), Positives = 19/25 (76%)

Query: 17 NRVLYIRNLPYKITGDEMYDIFGKY 41
          ++ LY++NL  ++T +++  IFG++
Sbjct: 1  SKRLYVKNLSKRVTEEDLVYIFGRF 25


>gnl|CDD|240850 cd12404, RRM2_NCL, RNA recognition motif 2 in vertebrate
          nucleolin.  This subfamily corresponds to the RRM2 of
          ubiquitously expressed protein nucleolin, also termed
          protein C23, a multifunctional major nucleolar
          phosphoprotein that has been implicated in various
          metabolic processes, such as ribosome biogenesis,
          cytokinesis, nucleogenesis, cell proliferation and
          growth, cytoplasmic-nucleolar transport of ribosomal
          components, transcriptional repression, replication,
          signal transduction, inducing chromatin decondensation,
          etc. Nucleolin exhibits intrinsic self-cleaving, DNA
          helicase, RNA helicase and DNA-dependent ATPase
          activities. It can be phosphorylated by many protein
          kinases, such as the major mitotic kinase Cdc2, casein
          kinase 2 (CK2), and protein kinase C-zeta. Nucleolin
          shares similar domain architecture with gar2 from
          Schizosaccharomyces pombe and NSR1 from Saccharomyces
          cerevisiae. The highly phosphorylated N-terminal domain
          of nucleolin is made up of highly acidic regions
          separated from each other by basic sequences, and
          contains multiple phosphorylation sites. The central
          domain of nucleolin contains four closely adjacent
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), which suggests that nucleolin is potentially
          able to interact with multiple RNA targets. The
          C-terminal RGG (or GAR) domain of nucleolin is rich in
          glycine, arginine and phenylalanine residues, and
          contains high levels of NG,NG-dimethylarginines.RRM2,
          together with RRM1, binds specifically to RNA
          stem-loops containing the sequence (U/G)CCCG(A/G) in
          the loop.  .
          Length = 77

 Score = 32.5 bits (74), Expect = 0.004
 Identities = 13/28 (46%), Positives = 19/28 (67%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAIR 45
          R L+++NLPY IT DE+ ++F     IR
Sbjct: 4  RTLFVKNLPYNITVDELKEVFEDAVDIR 31


>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous
          nuclear ribonucleoprotein C (hnRNP C)-related proteins.
           This subfamily corresponds to the RRM in the hnRNP
          C-related protein family, including hnRNP C proteins,
          Raly, and Raly-like protein (RALYL). hnRNP C proteins,
          C1 and C2, are produced by a single coding sequence.
          They are the major constituents of the heterogeneous
          nuclear RNA (hnRNA) ribonucleoprotein (hnRNP) complex
          in vertebrates. They bind hnRNA tightly, suggesting a
          central role in the formation of the ubiquitous hnRNP
          complex; they are involved in the packaging of the
          hnRNA in the nucleus and in processing of pre-mRNA such
          as splicing and 3'-end formation. Raly, also termed
          autoantigen p542, is an RNA-binding protein that may
          play a critical role in embryonic development. The
          biological role of RALYL remains unclear. It shows high
          sequence homology with hnRNP C proteins and Raly.
          Members of this family are characterized by an
          N-terminal RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain),
          and a C-terminal auxiliary domain. The Raly proteins
          contain a glycine/serine-rich stretch within the
          C-terminal regions, which is absent in the hnRNP C
          proteins. Thus, the Raly proteins represent a newly
          identified class of evolutionarily conserved
          autoepitopes. .
          Length = 68

 Score = 32.2 bits (74), Expect = 0.004
 Identities = 10/31 (32%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 20 LYIRNLP-YKITGDEMYDIFGKYGAIRQIRI 49
          +++ NL   K++ +++ +IF KYG I  I +
Sbjct: 3  VFVGNLNTDKVSKEDLEEIFSKYGKILGISL 33


>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage
          stimulation factor subunit 2 (CSTF2), yeast ortholog
          mRNA 3'-end-processing protein RNA15 and similar
          proteins.  This subfamily corresponds to the RRM domain
          of CSTF2, its tau variant and eukaryotic homologs.
          CSTF2, also termed cleavage stimulation factor 64 kDa
          subunit (CstF64), is the vertebrate conterpart of yeast
          mRNA 3'-end-processing protein RNA15. It is expressed
          in all somatic tissues and is one of three cleavage
          stimulatory factor (CstF) subunits required for
          polyadenylation. CstF64 contains an N-terminal RNA
          recognition motif (RRM), also known as RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), a
          CstF77-binding domain, a repeated MEARA helical region
          and a conserved C-terminal domain reported to bind the
          transcription factor PC-4. During polyadenylation, CstF
          interacts with the pre-mRNA through the RRM of CstF64
          at U- or GU-rich sequences within 10 to 30 nucleotides
          downstream of the cleavage site. CSTF2T, also termed
          tauCstF64, is a paralog of the X-linked cleavage
          stimulation factor CstF64 protein that supports
          polyadenylation in most somatic cells. It is expressed
          during meiosis and subsequent haploid differentiation
          in a more limited set of tissues and cell types,
          largely in meiotic and postmeiotic male germ cells, and
          to a lesser extent in brain. The loss of CSTF2T will
          cause male infertility, as it is necessary for
          spermatogenesis and fertilization. Moreover, CSTF2T is
          required for expression of genes involved in
          morphological differentiation of spermatids, as well as
          for genes having products that function during
          interaction of motile spermatozoa with eggs. It
          promotes germ cell-specific patterns of polyadenylation
          by using its RRM to bind to different sequence elements
          downstream of polyadenylation sites than does CstF64.
          The family also includes yeast ortholog mRNA
          3'-end-processing protein RNA15 and similar proteins.
          RNA15 is a core subunit of cleavage factor IA (CFIA),
          an essential transcriptional 3'-end processing factor
          from Saccharomyces cerevisiae. RNA recognition by CFIA
          is mediated by an N-terminal RRM, which is contained in
          the RNA15 subunit of the complex. The RRM of RNA15 has
          a strong preference for GU-rich RNAs, mediated by a
          binding pocket that is entirely conserved in both yeast
          and vertebrate RNA15 orthologs.
          Length = 75

 Score = 32.2 bits (74), Expect = 0.004
 Identities = 10/35 (28%), Positives = 20/35 (57%)

Query: 21 YIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDT 55
          ++ N+PY  T +++ +IF + G +   R+    DT
Sbjct: 2  FVGNIPYDATEEQLIEIFSEVGPVVSFRLVTDRDT 36


>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding
          protein 19 (RBM19 or RBD-1) and similar proteins.  This
          subfamily corresponds to the RRM5 of RBM19 and RRM4 of
          MRD1. RBM19, also termed RNA-binding domain-1 (RBD-1),
          is a nucleolar protein conserved in eukaryotes involved
          in ribosome biogenesis by processing rRNA and is
          essential for preimplantation development. It has a
          unique domain organization containing 6 conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains). .
          Length = 82

 Score = 32.2 bits (74), Expect = 0.004
 Identities = 14/47 (29%), Positives = 23/47 (48%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTRYLTKSLVM 64
            L+++NL +K T + +   F K G +R + I    D +   K L M
Sbjct: 1  TTLFVKNLNFKTTEETLKKHFEKCGGVRSVTIAKKKDPKGPGKLLSM 47


>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split
          end) protein family.  This subfamily corresponds to the
          RRM2 domain in the Spen (split end) protein family
          which includes RNA binding motif protein 15 (RBM15),
          putative RNA binding motif protein 15B (RBM15B), and
          similar proteins found in Metazoa. RBM15, also termed
          one-twenty two protein 1 (OTT1), conserved in
          eukaryotes, is a novel mRNA export factor and component
          of the NXF1 pathway. It binds to NXF1 and serves as
          receptor for the RNA export element RTE. It also
          possess mRNA export activity and can facilitate the
          access of DEAD-box protein DBP5 to mRNA at the nuclear
          pore complex (NPC). RNA-binding protein 15B (RBM15B),
          also termed one twenty-two 3 (OTT3), is a paralog of
          RBM15 and therefore has post-transcriptional regulatory
          activity. It is a nuclear protein sharing with RBM15
          the association with the splicing factor compartment
          and the nuclear envelope as well as the binding to mRNA
          export factors NXF1 and Aly/REF. Members in this family
          belong to the Spen (split end) protein family, which
          share a domain architecture comprising of three
          N-terminal RNA recognition motifs (RRMs), also known as
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain), and a C-terminal SPOC (Spen paralog and
          ortholog C-terminal) domain. .
          Length = 79

 Score = 32.4 bits (74), Expect = 0.004
 Identities = 12/37 (32%), Positives = 19/37 (51%)

Query: 17 NRVLYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTP 53
           R L++ NL   IT +E+   F +YG +  + I   P
Sbjct: 2  TRTLFVGNLEITITEEELRRAFERYGVVEDVDIKRPP 38


>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell
          carcinoma antigen recognized by T-cells 3 (SART3) and
          similar proteins.  This subfamily corresponds to the
          RRM1 of SART3, also termed Tat-interacting protein of
          110 kDa (Tip110), an RNA-binding protein expressed in
          the nucleus of the majority of proliferating cells,
          including normal cells and malignant cells, but not in
          normal tissues except for the testes and fetal liver.
          It is involved in the regulation of mRNA splicing
          probably via its complex formation with RNA-binding
          protein with a serine-rich domain (RNPS1), a
          pre-mRNA-splicing factor. SART3 has also been
          identified as a nuclear Tat-interacting protein that
          regulates Tat transactivation activity through direct
          interaction and functions as an important cellular
          factor for HIV-1 gene expression and viral replication.
          In addition, SART3 is required for U6 snRNP targeting
          to Cajal bodies. It binds specifically and directly to
          the U6 snRNA, interacts transiently with the U6 and
          U4/U6 snRNPs, and promotes the reassembly of U4/U6
          snRNPs after splicing in vitro. SART3 contains an
          N-terminal half-a-tetratricopeptide repeat (HAT)-rich
          domain, a nuclearlocalization signal (NLS) domain, and
          two C-terminal RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). .
          Length = 72

 Score = 31.9 bits (73), Expect = 0.005
 Identities = 10/30 (33%), Positives = 18/30 (60%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          +++ NL Y +  DE+  +F K G I  +R+
Sbjct: 2  VFVSNLDYSVPEDELRKLFSKCGEITDVRL 31


>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding
          protein 43 (TDP-43) and similar proteins.  This
          subfamily corresponds to the RRM1 of TDP-43 (also
          termed TARDBP), a ubiquitously expressed pathogenic
          protein whose normal function and abnormal aggregation
          are directly linked to the genetic disease cystic
          fibrosis, and two neurodegenerative disorders:
          frontotemporal lobar degeneration (FTLD) and
          amyotrophic lateral sclerosis (ALS). TDP-43 binds both
          DNA and RNA, and has been implicated in transcriptional
          repression, pre-mRNA splicing and translational
          regulation. TDP-43 is a dimeric protein with two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and a C-terminal glycine-rich domain. The RRMs are
          responsible for DNA and RNA binding; they bind to TAR
          DNA and RNA sequences with UG-repeats. The glycine-rich
          domain can interact with the hnRNP family proteins to
          form the hnRNP-rich complex involved in splicing
          inhibition. It is also essential for the cystic
          fibrosis transmembrane conductance regulator (CFTR)
          exon 9-skipping activity. .
          Length = 77

 Score = 32.0 bits (73), Expect = 0.005
 Identities = 10/37 (27%), Positives = 19/37 (51%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTR 56
          L +  LP+K T  ++ D F  +G +  +++   P T 
Sbjct: 2  LIVLGLPWKTTEQDLKDYFSTFGELLMVQVKKDPKTG 38


>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar
          protein 4 (Nop4p) and similar proteins.  This subgroup
          corresponds to the RRM2 of Nop4p (also known as
          Nop77p), encoded by YPL043W from Saccharomyces
          cerevisiae. It is an essential nucleolar protein
          involved in processing and maturation of 27S pre-rRNA
          and biogenesis of 60S ribosomal subunits. Nop4p has
          four RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains). .
          Length = 83

 Score = 32.1 bits (73), Expect = 0.005
 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 20 LYIRNLPYKITGDE-MYDIFGKYGAIRQIRIGNTPDTR 56
          L IRNLP+ I     +  IFG+YG +R+  I      +
Sbjct: 3  LIIRNLPWSIKKPVKLKKIFGRYGKVREATIPRKRGGK 40


>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar
          protein 4 (Nop4p) and similar proteins.  This subgroup
          corresponds to the RRM1 of Nop4p (also known as
          Nop77p), encoded by YPL043W from Saccharomyces
          cerevisiae. It is an essential nucleolar protein
          involved in processing and maturation of 27S pre-rRNA
          and biogenesis of 60S ribosomal subunits. Nop4p has
          four RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains). .
          Length = 79

 Score = 32.1 bits (73), Expect = 0.006
 Identities = 10/37 (27%), Positives = 20/37 (54%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTR 56
          L++RNL + +T +++ D F     I+   +   P+T 
Sbjct: 2  LFVRNLAFSVTQEDLTDFFSDVAPIKHAVVVTDPETG 38


>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in
          RNA-binding protein 19 (RBM19 or RBD-1) and RNA
          recognition motif 5 in multiple RNA-binding
          domain-containing protein 1 (MRD1).  This subfamily
          corresponds to the RRM6 of RBM19 and RRM5 of MRD1.
          RBM19, also termed RNA-binding domain-1 (RBD-1), is a
          nucleolar protein conserved in eukaryotes. It is
          involved in ribosome biogenesis by processing rRNA and
          is essential for preimplantation development. It has a
          unique domain organization containing 6 conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          MRD1 is encoded by a novel yeast gene MRD1 (multiple
          RNA-binding domain). It is well-conserved in yeast and
          its homologs exist in all eukaryotes. MRD1 is present
          in the nucleolus and the nucleoplasm. It interacts with
          the 35 S precursor rRNA (pre-rRNA) and U3 small
          nucleolar RNAs (snoRNAs). It is essential for the
          initial processing at the A0-A2 cleavage sites in the
          35 S pre-rRNA. MRD1 contains 5 conserved RRMs, which
          may play an important structural role in organizing
          specific rRNA processing events. .
          Length = 76

 Score = 31.8 bits (73), Expect = 0.006
 Identities = 9/30 (30%), Positives = 21/30 (70%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          L +RN+P++ T  E+ ++F  +G ++ +R+
Sbjct: 3  LIVRNVPFEATKKELRELFSPFGQVKSVRL 32


>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding
          protein 7 (RBM7) and similar proteins.  This subfamily
          corresponds to the RRM of RBM7, RBM11 and their
          eukaryotic homologous. RBM7 is an ubiquitously
          expressed pre-mRNA splicing factor that enhances
          messenger RNA (mRNA) splicing in a cell-specific manner
          or in a certain developmental process, such as
          spermatogenesis. It interacts with splicing factors
          SAP145 (the spliceosomal splicing factor 3b subunit 2)
          and SRp20, and may play a more specific role in meiosis
          entry and progression. Together with additional
          testis-specific RNA-binding proteins, RBM7 may regulate
          the splicing of specific pre-mRNA species that are
          important in the meiotic cell cycle. RBM11 is a novel
          tissue-specific splicing regulator that is selectively
          expressed in brain, cerebellum and testis, and to a
          lower extent in kidney. It is localized in the
          nucleoplasm and enriched in SRSF2-containing splicing
          speckles. It may play a role in the modulation of
          alternative splicing during neuron and germ cell
          differentiation. Both, RBM7 and RBM11, contain an
          N-terminal RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain),
          and a region lacking known homology at the C-terminus.
          The RRM is responsible for RNA binding, whereas the
          C-terminal region permits nuclear localization and
          homodimerization. .
          Length = 75

 Score = 31.5 bits (72), Expect = 0.007
 Identities = 10/40 (25%), Positives = 25/40 (62%)

Query: 17 NRVLYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTR 56
          +R L++ NL  ++T + +Y++F + G +  ++I   P+ +
Sbjct: 1  DRTLFVGNLDARVTEEILYELFLQAGPLEGVKIPKDPNGK 40


>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in
          nucleolin-like proteins mainly from plants.  This
          subfamily corresponds to the RRM1 of a group of plant
          nucleolin-like proteins, including nucleolin 1 (also
          termed protein nucleolin like 1) and nucleolin 2 (also
          termed protein nucleolin like 2, or protein parallel
          like 1). They play roles in the regulation of ribosome
          synthesis and in the growth and development of plants.
          Like yeast nucleolin, nucleolin-like proteins possess
          two RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains).  .
          Length = 77

 Score = 31.5 bits (72), Expect = 0.008
 Identities = 10/37 (27%), Positives = 19/37 (51%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTR 56
          L++ NL +    D++ + F + G +  +RI    D R
Sbjct: 2  LFVGNLSWSAEQDDLEEFFKECGEVVDVRIAQDDDGR 38


>gnl|CDD|241042 cd12598, RRM1_SRSF9, RNA recognition motif 1 in vertebrate
          serine/arginine-rich splicing factor 9 (SRSF9).  This
          subgroup corresponds to the RRM1 of SRSF9, also termed
          pre-mRNA-splicing factor SRp30C. SRSF9 is an essential
          splicing regulatory serine/arginine (SR) protein that
          has been implicated in the activity of many elements
          that control splice site selection, the alternative
          splicing of the glucocorticoid receptor beta in
          neutrophils and in the gonadotropin-releasing hormone
          pre-mRNA. SRSF9 can also interact with other proteins
          implicated in alternative splicing, including YB-1,
          rSLM-1, rSLM-2, E4-ORF4, Nop30, and p32. SRSF9 contains
          two N-terminal RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), followed by an unusually
          short C-terminal RS domains rich in serine-arginine
          dipeptides. .
          Length = 72

 Score = 31.3 bits (71), Expect = 0.008
 Identities = 13/32 (40%), Positives = 20/32 (62%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGN 51
          +Y+ NLP  +   ++ D+F KYG IR I + N
Sbjct: 2  IYVGNLPSDVREKDLEDLFYKYGRIRDIELKN 33


>gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding
          protein 19 (RBM19) and similar proteins.  This subgroup
          corresponds to the RRM6 of RBM19, also termed
          RNA-binding domain-1 (RBD-1), which is a nucleolar
          protein conserved in eukaryotes. It is involved in
          ribosome biogenesis by processing rRNA. In addition, it
          is essential for preimplantation development. RBM19 has
          a unique domain organization containing 6 conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains). .
          Length = 79

 Score = 31.6 bits (72), Expect = 0.010
 Identities = 8/28 (28%), Positives = 20/28 (71%)

Query: 22 IRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          +RN+P++ T  E+ ++F  +G ++ +R+
Sbjct: 5  VRNIPFEATVKELRELFSTFGELKTVRL 32


>gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding
          protein 34 (RBM34) and similar proteins.  This
          subfamily corresponds to the RRM1 of RBM34, a putative
          RNA-binding protein containing two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains). Although the
          function of RBM34 remains unclear currently, its RRM
          domains may participate in mRNA processing. RBM34 may
          act as an mRNA processing-related protein. .
          Length = 91

 Score = 31.5 bits (72), Expect = 0.010
 Identities = 11/48 (22%), Positives = 23/48 (47%), Gaps = 1/48 (2%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTP-DTRYLTKSLVM 64
          R +++ NLP      ++  +F ++G I  +R  + P   + L K +  
Sbjct: 1  RTVFVGNLPLTTKKKDLKKLFKQFGPIESVRFRSVPVKEKKLPKKVAA 48


>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast
          nucleolar protein 3 (Npl3p) and similar proteins.  This
          subfamily corresponds to the RRM1 of Npl3p, also termed
          mitochondrial targeting suppressor 1 protein, or
          nuclear polyadenylated RNA-binding protein 1. Npl3p is
          a major yeast RNA-binding protein that competes with
          3'-end processing factors, such as Rna15, for binding
          to the nascent RNA, protecting the transcript from
          premature termination and coordinating transcription
          termination and the packaging of the fully processed
          transcript for export. It specifically recognizes a
          class of G/U-rich RNAs. Npl3p is a multi-domain protein
          containing two central RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), separated by a short
          linker and a C-terminal domain rich in glycine,
          arginine and serine residues. .
          Length = 67

 Score = 31.2 bits (71), Expect = 0.010
 Identities = 9/33 (27%), Positives = 20/33 (60%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNT 52
          LY+R  P   +   + +IF  YGA++++++ + 
Sbjct: 2  LYVRPFPPDTSESAIREIFSPYGAVKEVKMISN 34


>gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in
          polypyrimidine tract-binding protein 1 (PTB or hnRNP
          I), heterogeneous nuclear ribonucleoprotein L
          (hnRNP-L), and similar proteins.  This subfamily
          corresponds to the RRM2 of polypyrimidine tract-binding
          protein 1 (PTB or hnRNP I), polypyrimidine
          tract-binding protein 2 (PTBP2 or nPTB), regulator of
          differentiation 1 (Rod1), heterogeneous nuclear
          ribonucleoprotein L (hnRNP-L), heterogeneous nuclear
          ribonucleoprotein L-like (hnRNP-LL), polypyrimidine
          tract-binding protein homolog 3 (PTBPH3),
          polypyrimidine tract-binding protein homolog 1 and 2
          (PTBPH1 and PTBPH2), and similar proteins, and RRM3 of
          PTBPH1 and PTBPH2. PTB is an important negative
          regulator of alternative splicing in mammalian cells
          and also functions at several other aspects of mRNA
          metabolism, including mRNA localization, stabilization,
          polyadenylation, and translation. PTBP2 is highly
          homologous to PTB and is perhaps specific to the
          vertebrates. Unlike PTB, PTBP2 is enriched in the brain
          and in some neural cell lines. It binds more stably to
          the downstream control sequence (DCS) RNA than PTB does
          but is a weaker repressor of splicing in vitro. PTBP2
          also greatly enhances the binding of two other
          proteins, heterogeneous nuclear ribonucleoprotein
          (hnRNP) H and KH-type splicing-regulatory protein
          (KSRP), to the DCS RNA. The binding properties of PTBP2
          and its reduced inhibitory activity on splicing imply
          roles in controlling the assembly of other
          splicing-regulatory proteins. Rod1 is a mammalian
          polypyrimidine tract binding protein (PTB) homolog of a
          regulator of differentiation in the fission yeast
          Schizosaccharomyces pombe, where the nrd1 gene encodes
          an RNA binding protein negatively regulates the onset
          of differentiation. ROD1 is predominantly expressed in
          hematopoietic cells or organs. It might play a role
          controlling differentiation in mammals. hnRNP-L is a
          higher eukaryotic specific subunit of human KMT3a (also
          known as HYPB or hSet2) complex required for histone H3
          Lys-36 trimethylation activity. It plays both, nuclear
          and cytoplasmic, roles in mRNA export of intronless
          genes, IRES-mediated translation, mRNA stability, and
          splicing. hnRNP-LL protein plays a critical and unique
          role in the signal-induced regulation of CD45 and acts
          as a global regulator of alternative splicing in
          activated T cells. This family also includes
          polypyrimidine tract binding protein homolog 3 (PTBPH3)
          found in plant. Although its biological roles remain
          unclear, PTBPH3 shows significant sequence similarity
          to other family members, all of which contain four RNA
          recognition motifs (RRM), also known as RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain).
          Although their biological roles remain unclear, both
          PTBPH1 and PTBPH2 show significant sequence similarity
          to PTB. However, in contrast to PTB, they have three
          RRMs. .
          Length = 85

 Score = 31.0 bits (71), Expect = 0.015
 Identities = 12/28 (42%), Positives = 18/28 (64%)

Query: 22 IRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          I NL Y +T D ++ +F  YGA+ +I I
Sbjct: 6  ISNLLYPVTVDVLHQVFSPYGAVEKILI 33


>gnl|CDD|240788 cd12342, RRM_Nab3p, RNA recognition motif in yeast nuclear
          polyadenylated RNA-binding protein 3 (Nab3p) and
          similar proteins.  This subfamily corresponds to the
          RRM of Nab3p, an acidic nuclear polyadenylated
          RNA-binding protein encoded by Saccharomyces cerevisiae
          NAB3 gene that is essential for cell viability. Nab3p
          is predominantly localized within the nucleoplasm and
          essential for growth in yeast. It may play an important
          role in packaging pre-mRNAs into ribonucleoprotein
          structures amenable to efficient nuclear RNA
          processing. Nab3p contains an N-terminal
          aspartic/glutamic acid-rich region, a central RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), and a
          C-terminal region rich in glutamine and proline
          residues. .
          Length = 71

 Score = 30.9 bits (70), Expect = 0.016
 Identities = 13/33 (39%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 20 LYIRNLPYK-ITGDEMYDIFGKYGAIRQIRIGN 51
          L+I NLP K ++ ++++ IF  YG + QI + N
Sbjct: 2  LFIGNLPTKRVSKEDLFRIFSTYGELAQIVLKN 34


>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1,
          RRM2) in Arabidopsis thaliana CTC-interacting domain
          protein CID8, CID9, CID10, CID11, CID12, CID 13 and
          similar proteins.  This subgroup corresponds to the RRM
          domains found in A. thaliana CID8, CID9, CID10, CID11,
          CID12, CID 13 and mainly their plant homologs. These
          highly related RNA-binding proteins contain an
          N-terminal PAM2 domain (PABP-interacting motif 2), two
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and a basic region that resembles a bipartite nuclear
          localization signal. The biological role of this family
          remains unclear.
          Length = 77

 Score = 30.8 bits (70), Expect = 0.016
 Identities = 7/57 (12%), Positives = 25/57 (43%), Gaps = 6/57 (10%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTRYLTKSLVMKCMIFLVNME 74
          R +++  +   ++ D++ + F   G + ++R+    D ++  +       +   + E
Sbjct: 1  RTIHVGGIDGSLSEDDLKEFFSNCGEVTRVRLCG--DRQHSARF----AFVEFADAE 51


>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding
          protein 34 (RBM34) and similar proteins.  This
          subfamily corresponds to the RRM2 of RBM34, a putative
          RNA-binding protein containing two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains). Although the
          function of RBM34 remains unclear currently, its RRM
          domains may participate in mRNA processing. RBM34 may
          act as an mRNA processing-related protein. .
          Length = 73

 Score = 30.6 bits (70), Expect = 0.018
 Identities = 10/35 (28%), Positives = 17/35 (48%)

Query: 21 YIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDT 55
          ++ NLP+ I  +E+   F   G +  +RI     T
Sbjct: 3  FVGNLPFDIEEEELRKHFEDCGDVEAVRIVRDRKT 37


>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear
          cap-binding protein subunit 2 (CBP20) and similar
          proteins.  This subfamily corresponds to the RRM of
          CBP20, also termed nuclear cap-binding protein subunit
          2 (NCBP2), or cell proliferation-inducing gene 55
          protein, or NCBP-interacting protein 1 (NIP1). CBP20 is
          the small subunit of the nuclear cap binding complex
          (CBC), which is a conserved eukaryotic heterodimeric
          protein complex binding to 5'-capped polymerase II
          transcripts and plays a central role in the maturation
          of pre-mRNA and uracil-rich small nuclear RNA (U
          snRNA). CBP20 is most likely responsible for the
          binding of capped RNA. It contains an RNA recognition
          motif (RRM), also termed RBD (RNA binding domain) or
          RNP (ribonucleoprotein domain), and interacts with the
          second and third domains of CBP80, the large subunit of
          CBC. .
          Length = 78

 Score = 30.6 bits (70), Expect = 0.019
 Identities = 11/31 (35%), Positives = 22/31 (70%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIG 50
          LY+ NL +  T +++Y++F + G I++I +G
Sbjct: 1  LYVGNLSFYTTEEQIYELFSRCGDIKRIIMG 31


>gnl|CDD|241041 cd12597, RRM1_SRSF1, RNA recognition motif 1 in
          serine/arginine-rich splicing factor 1 (SRSF1) and
          similar proteins.  This subgroup corresponds to the
          RRM1 of SRSF1, also termed alternative-splicing factor
          1 (ASF-1), or pre-mRNA-splicing factor SF2, P33
          subunit. SRSF1 is a splicing regulatory serine/arginine
          (SR) protein involved in constitutive and alternative
          splicing, nonsense-mediated mRNA decay (NMD), mRNA
          export and translation. It also functions as a
          splicing-factor oncoprotein that regulates apoptosis
          and proliferation to promote mammary epithelial cell
          transformation. SRSF1 is a shuttling SR protein and
          contains two N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), separated by a long
          glycine-rich spacer, and a C-terminal RS domains rich
          in serine-arginine dipeptides. .
          Length = 73

 Score = 30.5 bits (69), Expect = 0.020
 Identities = 15/32 (46%), Positives = 21/32 (65%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGN 51
          +Y+ NLP  I   ++ D+F KYGAIR I + N
Sbjct: 2  IYVGNLPPDIRTKDIEDLFYKYGAIRDIDLKN 33


>gnl|CDD|240909 cd12463, RRM_G3BP1, RNA recognition motif found in ras
          GTPase-activating protein-binding protein 1 (G3BP1) and
          similar proteins.  This subgroup corresponds to the RRM
          of G3BP1, also termed ATP-dependent DNA helicase VIII
          (DH VIII), or GAP SH3 domain-binding protein 1, which
          has been identified as a phosphorylation-dependent
          endoribonuclease that interacts with the SH3 domain of
          RasGAP, a multi-functional protein controlling Ras
          activity. The acidic RasGAP binding domain of G3BP1
          harbors an arsenite-regulated phosphorylation site and
          dominantly inhibits stress granule (SG) formation.
          G3BP1 also contains an N-terminal nuclear transfer
          factor 2 (NTF2)-like domain, an RNA recognition motif
          (RRM domain), and an Arg-Gly-rich region (RGG-rich
          region, or arginine methylation motif). The RRM domain
          and RGG-rich region are canonically associated with RNA
          binding. G3BP1 co-immunoprecipitates with mRNAs. It
          binds to and cleaves the 3'-untranslated region
          (3'-UTR) of the c-myc mRNA in a
          phosphorylation-dependent manner. Thus, G3BP1 may play
          a role in coupling extra-cellular stimuli to mRNA
          stability. It has been shown that G3BP1 is a novel
          Dishevelled-associated protein that is methylated upon
          Wnt3a stimulation and that arginine methylation of
          G3BP1 regulates both Ctnnb1 mRNA and canonical
          Wnt/beta-catenin signaling. Furthermore, G3BP1 can be
          associated with the 3'-UTR of beta-F1 mRNA in
          cytoplasmic RNA-granules, demonstrating that G3BP1 may
          specifically repress the translation of the transcript.
          Length = 80

 Score = 30.7 bits (69), Expect = 0.022
 Identities = 10/30 (33%), Positives = 20/30 (66%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          L++ NLP+ +   E+ + F +YG + ++RI
Sbjct: 6  LFVGNLPHDVDKSELKEFFQQYGNVVELRI 35


>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant
          pre-mRNA-splicing factor SF2 and similar proteins.
          This subgroup corresponds to the RRM1 of SF2, also
          termed SR1 protein, a plant serine/arginine (SR)-rich
          phosphoprotein similar to the mammalian splicing factor
          SF2/ASF. It promotes splice site switching in mammalian
          nuclear extracts. SF2 contains two N-terminal RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          followed by a C-terminal domain rich in proline, serine
          and lysine residues (PSK domain), a composition
          reminiscent of histones. This PSK domain harbors a
          putative phosphorylation site for the mitotic kinase
          cyclin/p34cdc2. .
          Length = 72

 Score = 30.5 bits (69), Expect = 0.023
 Identities = 13/28 (46%), Positives = 17/28 (60%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQI 47
          +Y+ NLP  I   E+ D+F KYG I  I
Sbjct: 2  VYVGNLPGDIREREVEDLFYKYGPIVDI 29


>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in
          serine/arginine-rich splicing factor 3 (SRSF3) and
          similar proteins.  This subfamily corresponds to the
          RRM of two serine/arginine (SR) proteins,
          serine/arginine-rich splicing factor 3 (SRSF3) and
          serine/arginine-rich splicing factor 7 (SRSF7). SRSF3,
          also termed pre-mRNA-splicing factor SRp20, modulates
          alternative splicing by interacting with RNA
          cis-elements in a concentration- and cell
          differentiation-dependent manner. It is also involved
          in termination of transcription, alternative RNA
          polyadenylation, RNA export, and protein translation.
          SRSF3 is critical for cell proliferation, and tumor
          induction and maintenance. It can shuttle between the
          nucleus and cytoplasm. SRSF7, also termed splicing
          factor 9G8, plays a crucial role in both constitutive
          splicing and alternative splicing of many pre-mRNAs.
          Its localization and functions are tightly regulated by
          phosphorylation. SRSF7 is predominantly present in the
          nuclear and can shuttle between nucleus and cytoplasm.
          It cooperates with the export protein, Tap/NXF1, helps
          mRNA export to the cytoplasm, and enhances the
          expression of unspliced mRNA. Moreover, SRSF7 inhibits
          tau E10 inclusion through directly interacting with the
          proximal downstream intron of E10, a clustering region
          for frontotemporal dementia with Parkinsonism (FTDP)
          mutations. Both SRSF3 and SRSF7 contain a single
          N-terminal RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain),
          and a C-terminal RS domain rich in serine-arginine
          dipeptides. The RRM domain is involved in RNA binding,
          and the RS domain has been implicated in protein
          shuttling and protein-protein interactions. .
          Length = 73

 Score = 30.3 bits (69), Expect = 0.025
 Identities = 12/34 (35%), Positives = 19/34 (55%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTP 53
          +Y+ NL  + T  E+ D F KYG +R + +   P
Sbjct: 2  VYVGNLGPRATKRELEDEFEKYGPLRSVWVARNP 35


>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in
          eukaryotic RNA-binding protein RBM24, RBM38 and similar
          proteins.  This subfamily corresponds to the RRM of
          RBM24 and RBM38 from vertebrate, SUPpressor family
          member SUP-12 from Caenorhabditis elegans and similar
          proteins. Both, RBM24 and RBM38, are preferentially
          expressed in cardiac and skeletal muscle tissues. They
          regulate myogenic differentiation by controlling the
          cell cycle in a p21-dependent or -independent manner.
          RBM24, also termed RNA-binding region-containing
          protein 6, interacts with the 3'-untranslated region
          (UTR) of myogenin mRNA and regulates its stability in
          C2C12 cells. RBM38, also termed CLL-associated antigen
          KW-5, or HSRNASEB, or RNA-binding region-containing
          protein 1(RNPC1), or ssDNA-binding protein SEB4, is a
          direct target of the p53 family. It is required for
          maintaining the stability of the basal and
          stress-induced p21 mRNA by binding to their 3'-UTRs. It
          also binds the AU-/U-rich elements in p63 3'-UTR and
          regulates p63 mRNA stability and activity. SUP-12 is a
          novel tissue-specific splicing factor that controls
          muscle-specific splicing of the ADF/cofilin pre-mRNA in
          C. elegans. All family members contain a conserved RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain). .
          Length = 76

 Score = 29.9 bits (68), Expect = 0.030
 Identities = 8/25 (32%), Positives = 14/25 (56%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAI 44
          +++  LPY  T D +   F ++G I
Sbjct: 3  IFVGGLPYHTTDDSLRKYFSQFGEI 27


>gnl|CDD|240691 cd12245, RRM_scw1_like, RNA recognition motif in yeast cell wall
          integrity protein scw1 and similar proteins.  This
          subfamily corresponds to the RRM of the family
          including yeast cell wall integrity protein scw1, yeast
          Whi3 protein, yeast Whi4 protein and similar proteins.
          The strong cell wall protein 1, scw1, is a nonessential
          cytoplasmic RNA-binding protein that regulates
          septation and cell-wall structure in fission yeast. It
          may function as an inhibitor of septum formation, such
          that its loss of function allows weak SIN signaling to
          promote septum formation. It's RRM domain shows high
          homology to two budding yeast proteins, Whi3 and Whi4.
          Whi3 is a dose-dependent modulator of cell size and has
          been implicated in cell cycle control in the yeast
          Saccharomyces cerevisiae. It functions as a negative
          regulator of ceroid-lipofuscinosis, neuronal 3 (Cln3),
          a G1 cyclin that promotes transcription of many genes
          to trigger the G1/S transition in budding yeast. It
          specifically binds the CLN3 mRNA and localizes it into
          discrete cytoplasmic loci that may locally restrict
          Cln3 synthesis to modulate cell cycle progression.
          Moreover, Whi3 plays a key role in cell fate
          determination in budding yeast. The RRM domain is
          essential for Whi3 function. Whi4 is a partially
          redundant homolog of Whi3, also containing one RRM.
          Some uncharacterized family members of this subfamily
          contain two RRMs; their RRM1 shows high sequence
          homology to the RRM of RNA-binding protein with
          multiple splicing (RBP-MS)-like proteins.
          Length = 79

 Score = 30.3 bits (69), Expect = 0.031
 Identities = 9/37 (24%), Positives = 19/37 (51%), Gaps = 3/37 (8%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI---GNTP 53
          L++ NL    T +E+  +F +    R++++   G  P
Sbjct: 5  LFVANLGPNTTEEELRQLFSRQPGFRRLKMHNKGGGP 41


>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I
          polyadenylate-binding proteins.  This subfamily
          corresponds to the RRM1 of type I poly(A)-binding
          proteins (PABPs), highly conserved proteins that bind
          to the poly(A) tail present at the 3' ends of most
          eukaryotic mRNAs. They have been implicated in the
          regulation of poly(A) tail length during the
          polyadenylation reaction, translation initiation, mRNA
          stabilization by influencing the rate of deadenylation
          and inhibition of mRNA decapping. The family represents
          type I polyadenylate-binding proteins (PABPs),
          including polyadenylate-binding protein 1 (PABP-1 or
          PABPC1), polyadenylate-binding protein 3 (PABP-3 or
          PABPC3), polyadenylate-binding protein 4 (PABP-4 or
          APP-1 or iPABP), polyadenylate-binding protein 5
          (PABP-5 or PABPC5), polyadenylate-binding protein
          1-like (PABP-1-like or PABPC1L), polyadenylate-binding
          protein 1-like 2 (PABPC1L2 or RBM32),
          polyadenylate-binding protein 4-like (PABP-4-like or
          PABPC4L), yeast polyadenylate-binding protein,
          cytoplasmic and nuclear (PABP or ACBP-67), and similar
          proteins. PABP-1 is a ubiquitously expressed
          multifunctional protein that may play a role in 3' end
          formation of mRNA, translation initiation, mRNA
          stabilization, protection of poly(A) from nuclease
          activity, mRNA deadenylation, inhibition of mRNA
          decapping, and mRNP maturation. Although PABP-1 is
          thought to be a cytoplasmic protein, it is also found
          in the nucleus. PABP-1 may be involved in
          nucleocytoplasmic trafficking and utilization of mRNP
          particles. PABP-1 contains four copies of RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains), a
          less well conserved linker region, and a proline-rich
          C-terminal conserved domain (CTD). PABP-3 is a
          testis-specific poly(A)-binding protein specifically
          expressed in round spermatids. It is mainly found in
          mammalian and may play an important role in the
          testis-specific regulation of mRNA homeostasis. PABP-3
          shows significant sequence similarity to PABP-1.
          However, it binds to poly(A) with a lower affinity than
          PABP-1. Moreover, PABP-1 possesses an A-rich sequence
          in its 5'-UTR and allows binding of PABP and blockage
          of translation of its own mRNA. In contrast, PABP-3
          lacks the A-rich sequence in its 5'-UTR. PABP-4 is an
          inducible poly(A)-binding protein (iPABP) that is
          primarily localized to the cytoplasm. It shows
          significant sequence similarity to PABP-1 as well. The
          RNA binding properties of PABP-1 and PABP-4 appear to
          be identical. PABP-5 is encoded by PABPC5 gene within
          the X-specific subinterval, and expressed in fetal
          brain and in a range of adult tissues in mammals, such
          as ovary and testis. It may play an important role in
          germ cell development. Moreover, unlike other PABPs,
          PABP-5 contains only four RRMs, but lacks both the
          linker region and the CTD. PABP-1-like and PABP-1-like
          2 are the orthologs of PABP-1. PABP-4-like is the
          ortholog of PABP-5. Their cellular functions remain
          unclear. The family also includes yeast PABP, a
          conserved poly(A) binding protein containing poly(A)
          tails that can be attached to the 3'-ends of mRNAs. The
          yeast PABP and its homologs may play important roles in
          the initiation of translation and in mRNA decay. Like
          vertebrate PABP-1, the yeast PABP contains four RRMs, a
          linker region, and a proline-rich CTD as well. The
          first two RRMs are mainly responsible for specific
          binding to poly(A). The proline-rich region may be
          involved in protein-protein interactions. .
          Length = 80

 Score = 30.2 bits (69), Expect = 0.033
 Identities = 10/30 (33%), Positives = 17/30 (56%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          LY+ +L   +T   +Y+IF   G +  IR+
Sbjct: 2  LYVGDLHPDVTEAMLYEIFSPAGPVLSIRV 31


>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic
          RNA-binding protein 18 and similar proteins.  This
          subfamily corresponds to the RRM of RBM18, a putative
          RNA-binding protein containing a well-conserved RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain). The
          biological role of RBM18 remains unclear. .
          Length = 80

 Score = 29.9 bits (68), Expect = 0.041
 Identities = 10/28 (35%), Positives = 17/28 (60%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQI 47
          L+I NL  ++T   +  +F KYG I++ 
Sbjct: 2  LWIGNLDSRLTEFHLLKLFSKYGKIKKF 29


>gnl|CDD|241130 cd12686, RRM1_PTBPH1_PTBPH2, RNA recognition motif 1 in plant
          polypyrimidine tract-binding protein homolog 1 and 2
          (PTBPH1 and PTBPH2).  This subfamily corresponds to the
          RRM1 of PTBPH1 and PTBPH2. Although their biological
          roles remain unclear, PTBPH1 and PTBPH2 show
          significant sequence similarity to polypyrimidine tract
          binding protein (PTB) that is an important negative
          regulator of alternative splicing in mammalian cells
          and also functions at several other aspects of mRNA
          metabolism, including mRNA localization, stabilization,
          polyadenylation, and translation. Both, PTBPH1 and
          PTBPH2, contain three RNA recognition motifs (RRM),
          also known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain). .
          Length = 81

 Score = 29.9 bits (67), Expect = 0.045
 Identities = 10/32 (31%), Positives = 22/32 (68%)

Query: 17 NRVLYIRNLPYKITGDEMYDIFGKYGAIRQIR 48
          ++VL++RNLP++ T +E+ ++   +G I   +
Sbjct: 2  SKVLHLRNLPWECTEEELIELCKPFGKIVNTK 33


>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in
          serine/arginine-rich splicing factor SRSF2, SRSF8 and
          similar proteins.  This subfamily corresponds to the
          RRM of SRSF2 and SRSF8. SRSF2, also termed protein
          PR264, or splicing component, 35 kDa (splicing factor
          SC35 or SC-35), is a prototypical SR protein that plays
          important roles in the alternative splicing of
          pre-mRNA. It is also involved in transcription
          elongation by directly or indirectly mediating the
          recruitment of elongation factors to the C-terminal
          domain of polymerase II. SRSF2 is exclusively localized
          in the nucleus and is restricted to nuclear processes.
          It contains a single N-terminal RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), followed by a C-terminal RS
          domain rich in serine-arginine dipeptides. The RRM is
          responsible for the specific recognition of 5'-SSNG-3'
          (S=C/G) RNA. In the regulation of alternative splicing
          events, it specifically binds to cis-regulatory
          elements on the pre-mRNA. The RS domain modulates SRSF2
          activity through phosphorylation, directly contacts
          RNA, and promotes protein-protein interactions with the
          spliceosome. SRSF8, also termed SRP46 or SFRS2B, is a
          novel mammalian SR splicing factor encoded by a
          PR264/SC35 functional retropseudogene. SRSF8 is
          localized in the nucleus and does not display the same
          activity as PR264/SC35. It functions as an essential
          splicing factor in complementing a HeLa cell S100
          extract deficient in SR proteins. Like SRSF2, SRSF8
          contains a single N-terminal RRM and a C-terminal RS
          domain. .
          Length = 73

 Score = 29.6 bits (67), Expect = 0.046
 Identities = 13/37 (35%), Positives = 20/37 (54%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTR 56
          L + NL Y+ T D++  +F KYG +  + I     TR
Sbjct: 1  LKVDNLTYRTTPDDLRRVFEKYGEVGDVYIPRDRYTR 37


>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in
          serine/arginine-rich splicing factor 4 (SRSF4) and
          similar proteins.  This subfamily corresponds to the
          RRM1 in three serine/arginine (SR) proteins:
          serine/arginine-rich splicing factor 4 (SRSF4 or SRp75
          or SFRS4), serine/arginine-rich splicing factor 5
          (SRSF5 or SRp40 or SFRS5 or HRS), serine/arginine-rich
          splicing factor 6 (SRSF6 or SRp55). SRSF4 plays an
          important role in both, constitutive  and alternative,
          splicing of many pre-mRNAs. It can shuttle between the
          nucleus and cytoplasm. SRSF5 regulates both alternative
          splicing and basal splicing. It is the only SR protein
          efficiently selected from nuclear extracts (NE) by the
          splicing enhancer (ESE) and essential for enhancer
          activation. SRSF6 preferentially interacts with a
          number of purine-rich splicing enhancers (ESEs) to
          activate splicing of the ESE-containing exon. It is the
          only protein from HeLa nuclear extract or purified SR
          proteins that specifically binds B element RNA after UV
          irradiation. SRSF6 may also recognize different types
          of RNA sites. Members in this family contain two
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), followed by a C-terminal RS domains rich in
          serine-arginine dipeptides. .
          Length = 70

 Score = 29.2 bits (66), Expect = 0.052
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGN 51
          +YI  LPY+    ++   F  YG IR+I + N
Sbjct: 2  VYIGRLPYRARERDVERFFKGYGRIREINLKN 33


>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I
          polyadenylate-binding proteins.  This subfamily
          corresponds to the RRM2 of type I poly(A)-binding
          proteins (PABPs), highly conserved proteins that bind
          to the poly(A) tail present at the 3' ends of most
          eukaryotic mRNAs. They have been implicated in the
          regulation of poly(A) tail length during the
          polyadenylation reaction, translation initiation, mRNA
          stabilization by influencing the rate of deadenylation
          and inhibition of mRNA decapping. The family represents
          type I polyadenylate-binding proteins (PABPs),
          including polyadenylate-binding protein 1 (PABP-1 or
          PABPC1), polyadenylate-binding protein 3 (PABP-3 or
          PABPC3), polyadenylate-binding protein 4 (PABP-4 or
          APP-1 or iPABP), polyadenylate-binding protein 5
          (PABP-5 or PABPC5), polyadenylate-binding protein
          1-like (PABP-1-like or PABPC1L), polyadenylate-binding
          protein 1-like 2 (PABPC1L2 or RBM32),
          polyadenylate-binding protein 4-like (PABP-4-like or
          PABPC4L), yeast polyadenylate-binding protein,
          cytoplasmic and nuclear (PABP or ACBP-67), and similar
          proteins. PABP-1 is a ubiquitously expressed
          multifunctional protein that may play a role in 3' end
          formation of mRNA, translation initiation, mRNA
          stabilization, protection of poly(A) from nuclease
          activity, mRNA deadenylation, inhibition of mRNA
          decapping, and mRNP maturation. Although PABP-1 is
          thought to be a cytoplasmic protein, it is also found
          in the nucleus. PABP-1 may be involved in
          nucleocytoplasmic trafficking and utilization of mRNP
          particles. PABP-1 contains four copies of RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains), a
          less well conserved linker region, and a proline-rich
          C-terminal conserved domain (CTD). PABP-3 is a
          testis-specific poly(A)-binding protein specifically
          expressed in round spermatids. It is mainly found in
          mammalian and may play an important role in the
          testis-specific regulation of mRNA homeostasis. PABP-3
          shows significant sequence similarity to PABP-1.
          However, it binds to poly(A) with a lower affinity than
          PABP-1. Moreover, PABP-1 possesses an A-rich sequence
          in its 5'-UTR and allows binding of PABP and blockage
          of translation of its own mRNA. In contrast, PABP-3
          lacks the A-rich sequence in its 5'-UTR. PABP-4 is an
          inducible poly(A)-binding protein (iPABP) that is
          primarily localized to the cytoplasm. It shows
          significant sequence similarity to PABP-1 as well. The
          RNA binding properties of PABP-1 and PABP-4 appear to
          be identical. PABP-5 is encoded by PABPC5 gene within
          the X-specific subinterval, and expressed in fetal
          brain and in a range of adult tissues in mammalian,
          such as ovary and testis. It may play an important role
          in germ cell development. Unlike other PABPs, PABP-5
          contains only four RRMs, but lacks both the linker
          region and the CTD. PABP-1-like and PABP-1-like 2 are
          the orthologs of PABP-1. PABP-4-like is the ortholog of
          PABP-5. Their cellular functions remain unclear. The
          family also includes the yeast PABP, a conserved
          poly(A) binding protein containing poly(A) tails that
          can be attached to the 3'-ends of mRNAs. The yeast PABP
          and its homologs may play important roles in the
          initiation of translation and in mRNA decay. Like
          vertebrate PABP-1, the yeast PABP contains four RRMs, a
          linker region, and a proline-rich CTD as well. The
          first two RRMs are mainly responsible for specific
          binding to poly(A). The proline-rich region may be
          involved in protein-protein interactions. .
          Length = 77

 Score = 29.4 bits (67), Expect = 0.055
 Identities = 9/25 (36%), Positives = 14/25 (56%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAI 44
          ++I+NL   I    +YD F  +G I
Sbjct: 5  IFIKNLDKSIDNKALYDTFSAFGNI 29


>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in
          Mei2-like proteins and terminal EAR1-like proteins.
          This subfamily corresponds to the RRM2 of Mei2-like
          proteins from plant and fungi, terminal EAR1-like
          proteins from plant, and other eukaryotic homologs.
          Mei2-like proteins represent an ancient eukaryotic
          RNA-binding proteins family whose corresponding
          Mei2-like genes appear to have arisen early in
          eukaryote evolution, been lost from some lineages such
          as Saccharomyces cerevisiae and metazoans, and
          diversified in the plant lineage. The plant Mei2-like
          genes may function in cell fate specification during
          development, rather than as stimulators of meiosis. In
          the fission yeast Schizosaccharomyces pombe, the Mei2
          protein is an essential component of the switch from
          mitotic to meiotic growth. S. pombe Mei2 stimulates
          meiosis in the nucleus upon binding a specific
          non-coding RNA. The terminal EAR1-like protein 1 and 2
          (TEL1 and TEL2) are mainly found in land plants. They
          may play a role in the regulation of leaf initiation.
          All members in this family are putative RNA-binding
          proteins carrying three RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). In addition to the RRMs,
          the terminal EAR1-like proteins also contain TEL
          characteristic motifs that allow sequence and putative
          functional discrimination between them and Mei2-like
          proteins. .
          Length = 71

 Score = 29.1 bits (66), Expect = 0.061
 Identities = 10/39 (25%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIR-IGNTPDTRY 57
          L + NL   I+  E+  +F ++G ++ IR     P  ++
Sbjct: 4  LLVFNLDSPISDQELRSLFSQFGEVKDIRETPLRPSQKF 42


>gnl|CDD|241204 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA-binding
          protein Musashi homolog 2 (Musashi-2 ) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          Musashi-2 (also termed Msi2) which has been identified
          as a regulator of the hematopoietic stem cell (HSC)
          compartment and of leukemic stem cells after
          transplantation of cells with loss and gain of function
          of the gene. It influences proliferation and
          differentiation of HSCs and myeloid progenitors, and
          further modulates normal hematopoiesis and promotes
          aggressive myeloid leukemia. Musashi-2 contains two
          conserved N-terminal tandem RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), along with other domains
          of unknown function. .
          Length = 76

 Score = 29.3 bits (65), Expect = 0.062
 Identities = 11/37 (29%), Positives = 21/37 (56%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTR 56
          ++I  L ++ + D + D F K+G IR+  +   P T+
Sbjct: 2  MFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTK 38


>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins
          family.  This subfamily corresponds to the RRM2 of Hu
          proteins family which represents a group of RNA-binding
          proteins involved in diverse biological processes.
          Since the Hu proteins share high homology with the
          Drosophila embryonic lethal abnormal vision (ELAV)
          protein, the Hu family is sometimes referred to as the
          ELAV family. Drosophila ELAV is exclusively expressed
          in neurons and is required for the correct
          differentiation and survival of neurons in flies. The
          neuronal members of the Hu family include Hu-antigen B
          (HuB or ELAV-2 or Hel-N1), Hu-antigen C (HuC or ELAV-3
          or PLE21), and Hu-antigen D (HuD or ELAV-4), which play
          important roles in neuronal differentiation, plasticity
          and memory. HuB is also expressed in gonads. Hu-antigen
          R (HuR or ELAV-1 or HuA) is the ubiquitously expressed
          Hu family member. It has a variety of biological
          functions mostly related to the regulation of cellular
          response to DNA damage and other types of stress.
          Moreover, HuR has an anti-apoptotic function during
          early cell stress response. It binds to mRNAs and
          enhances the expression of several anti-apoptotic
          proteins, such as p21waf1, p53, and prothymosin alpha.
          HuR also has pro-apoptotic function by promoting
          apoptosis when cell death is unavoidable. Furthermore,
          HuR may be important in muscle differentiation,
          adipogenesis, suppression of inflammatory response and
          modulation of gene expression in response to chronic
          ethanol exposure and amino acid starvation. Hu proteins
          perform their cytoplasmic and nuclear molecular
          functions by coordinately regulating functionally
          related mRNAs. In the cytoplasm, Hu proteins recognize
          and bind to AU-rich RNA elements (AREs) in the 3'
          untranslated regions (UTRs) of certain target mRNAs,
          such as GAP-43, vascular epithelial growth factor
          (VEGF), the glucose transporter GLUT1, eotaxin and
          c-fos, and stabilize those ARE-containing mRNAs. They
          also bind and regulate the translation of some target
          mRNAs, such as neurofilament M, GLUT1, and p27. In the
          nucleus, Hu proteins function as regulators of
          polyadenylation and alternative splicing. Each Hu
          protein contains three RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). RRM1 and RRM2 may
          cooperate in binding to an ARE. RRM3 may help to
          maintain the stability of the RNA-protein complex, and
          might also bind to poly(A) tails or be involved in
          protein-protein interactions. .
          Length = 79

 Score = 29.2 bits (66), Expect = 0.070
 Identities = 12/30 (40%), Positives = 16/30 (53%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          LY+  LP  +T  E+  +F  YG I   RI
Sbjct: 3  LYVSGLPKTMTQQELEALFSPYGRIITSRI 32


>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins
          family, Drosophila sex-lethal (SXL), and similar
          proteins.  This subfamily corresponds to the RRM1 of Hu
          proteins and SXL. The Hu proteins family represents a
          group of RNA-binding proteins involved in diverse
          biological processes. Since the Hu proteins share high
          homology with the Drosophila embryonic lethal abnormal
          vision (ELAV) protein, the Hu family is sometimes
          referred to as the ELAV family. Drosophila ELAV is
          exclusively expressed in neurons and is required for
          the correct differentiation and survival of neurons in
          flies. The neuronal members of the Hu family include
          Hu-antigen B (HuB or ELAV-2 or Hel-N1), Hu-antigen C
          (HuC or ELAV-3 or PLE21), and Hu-antigen D (HuD or
          ELAV-4), which play important roles in neuronal
          differentiation, plasticity and memory. HuB is also
          expressed in gonads. Hu-antigen R (HuR or ELAV-1 or
          HuA) is ubiquitously expressed Hu family member. It has
          a variety of biological functions mostly related to the
          regulation of cellular response to DNA damage and other
          types of stress. Hu proteins perform their cytoplasmic
          and nuclear molecular functions by coordinately
          regulating functionally related mRNAs. In the
          cytoplasm, Hu proteins recognize and bind to AU-rich
          RNA elements (AREs) in the 3' untranslated regions
          (UTRs) of certain target mRNAs, such as GAP-43,
          vascular epithelial growth factor (VEGF), the glucose
          transporter GLUT1, eotaxin and c-fos, and stabilize
          those ARE-containing mRNAs. They also bind and regulate
          the translation of some target mRNAs, such as
          neurofilament M, GLUT1, and p27. In the nucleus, Hu
          proteins function as regulators of polyadenylation and
          alternative splicing. Each Hu protein contains three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an ARE. RRM3
          may help to maintain the stability of the RNA-protein
          complex, and might also bind to poly(A) tails or be
          involved in protein-protein interactions. This family
          also includes the sex-lethal protein (SXL) from
          Drosophila melanogaster. SXL governs sexual
          differentiation and X chromosome dosage compensation in
          flies. It induces female-specific alternative splicing
          of the transformer (tra) pre-mRNA by binding to the tra
          uridine-rich polypyrimidine tract at the
          non-sex-specific 3' splice site during the
          sex-determination process. SXL binds to its own
          pre-mRNA and promotes female-specific alternative
          splicing. It contains an N-terminal Gly/Asn-rich domain
          that may be responsible for the protein-protein
          interaction, and tandem RRMs that show high preference
          to bind single-stranded, uridine-rich target RNA
          transcripts. .
          Length = 77

 Score = 29.2 bits (66), Expect = 0.071
 Identities = 9/30 (30%), Positives = 15/30 (50%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          L +  LP  +T +E+  +F   G I   +I
Sbjct: 3  LIVNYLPQDMTQEELRSLFEAIGPIESCKI 32


>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8
          (NOL8) and similar proteins.  This model corresponds to
          the RRM of NOL8 (also termed Nop132) encoded by a novel
          NOL8 gene that is up-regulated in the majority of
          diffuse-type, but not intestinal-type, gastric cancers.
          Thus, NOL8 may be a good molecular target for treatment
          of diffuse-type gastric cancer. Also, NOL8 is a
          phosphorylated protein that contains an N-terminal RNA
          recognition motif (RRM), also known as RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), suggesting
          NOL8 is likely to function as a novel RNA-binding
          protein. It may be involved in regulation of gene
          expression at the post-transcriptional level or in
          ribosome biogenesis in cancer cells.
          Length = 78

 Score = 29.1 bits (66), Expect = 0.072
 Identities = 7/35 (20%), Positives = 17/35 (48%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPD 54
          L++  L   +T  ++ + F ++G +  + I    D
Sbjct: 2  LFVGGLSPSVTESDLEERFSRFGTVSDVEIIKKKD 36


>gnl|CDD|240803 cd12357, RRM_PPARGC1A_like, RNA recognition motif in the
          peroxisome proliferator-activated receptor gamma
          coactivator 1A (PGC-1alpha) family of regulated
          coactivators.  This subfamily corresponds to the RRM of
          PGC-1alpha, PGC-1beta, and PGC-1-related coactivator
          (PRC), which serve as mediators between environmental
          or endogenous signals and the transcriptional machinery
          governing mitochondrial biogenesis. They play an
          important integrative role in the control of
          respiratory gene expression through interacting with a
          number of transcription factors, such as NRF-1, NRF-2,
          ERR, CREB and YY1. All family members are multi-domain
          proteins containing the N-terminal activation domain,
          an LXXLL coactivator signature, a tetrapeptide motif
          (DHDY) responsible for HCF binding, and an RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain). In contrast
          to PGC-1alpha and PRC, PGC-1beta possesses two
          glutamic/aspartic acid-rich acidic domains, but lacks
          most of the arginine/serine (SR)-rich domain that is
          responsible for the regulation of RNA processing. .
          Length = 89

 Score = 29.2 bits (66), Expect = 0.080
 Identities = 10/32 (31%), Positives = 17/32 (53%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          RV+Y+  +P   T  E+   F  +G I +I +
Sbjct: 3  RVIYVGKIPIDTTRSELRQRFQPFGEIEEITL 34


>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis
          thaliana phragmoplastin interacting protein 1 (PHIP1)
          and similar proteins.  This subfamily corresponds to
          the RRM1 of PHIP1. A. thaliana PHIP1 and its homologs
          represent a novel class of plant-specific RNA-binding
          proteins that may play a unique role in the polarized
          mRNA transport to the vicinity of the cell plate. The
          family members consist of multiple functional domains,
          including a lysine-rich domain (KRD domain) that
          contains three nuclear localization motifs (KKKR/NK),
          two RNA recognition motifs (RRMs), and three CCHC-type
          zinc fingers. PHIP1 is a peripheral membrane protein
          and is localized at the cell plate during cytokinesis
          in plants. In addition to phragmoplastin, PHIP1
          interacts with two Arabidopsis small GTP-binding
          proteins, Rop1 and Ran2. However, PHIP1 interacted only
          with the GTP-bound form of Rop1 but not the GDP-bound
          form. It also binds specifically to Ran2 mRNA. .
          Length = 72

 Score = 28.9 bits (65), Expect = 0.083
 Identities = 12/36 (33%), Positives = 19/36 (52%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDT 55
          +Y+  +PY  T DE+   F   G I ++ +   PDT
Sbjct: 1  VYVGGIPYYSTEDEIRSYFSYCGEIEELDLMTFPDT 36


>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate
          RNA-binding protein RBM23, RBM39 and similar proteins. 
          This subfamily corresponds to the RRM2 of RBM39 (also
          termed HCC1), a nuclear autoantigen that contains an
          N-terminal arginine/serine rich (RS) motif and three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          An octapeptide sequence called the RS-ERK motif is
          repeated six times in the RS region of RBM39. Although
          the cellular function of RBM23 remains unclear, it
          shows high sequence homology to RBM39 and contains two
          RRMs. It may possibly function as a pre-mRNA splicing
          factor. .
          Length = 73

 Score = 28.8 bits (65), Expect = 0.086
 Identities = 13/36 (36%), Positives = 22/36 (61%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDT 55
          LY+ NL + IT D++  IF  +G I  +++   P+T
Sbjct: 1  LYVGNLHFNITEDDLRGIFEPFGEIEFVQLQRDPET 36


>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA
          stem-loop-interacting RNA-binding protein (SLIRP) and
          similar proteins.  This subfamily corresponds to the
          RRM of SLIRP, a widely expressed small steroid receptor
          RNA activator (SRA) binding protein, which binds to
          STR7, a functional substructure of SRA. SLIRP is
          localized predominantly to the mitochondria and plays a
          key role in modulating several nuclear receptor (NR)
          pathways. It functions as a co-repressor to repress
          SRA-mediated nuclear receptor coactivation. It
          modulates SHARP- and SKIP-mediated co-regulation of NR
          activity. SLIRP contains an RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), which is required for
          SLIRP's corepression activities. .
          Length = 73

 Score = 28.8 bits (65), Expect = 0.097
 Identities = 7/31 (22%), Positives = 18/31 (58%)

Query: 19 VLYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
           L++ NLP+ +   E+ + F ++G ++   +
Sbjct: 1  KLFVGNLPWTVGSKELKEYFSQFGKVKSCNV 31


>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome
          biogenesis protein 15 (Nop15p) and similar proteins.
          This subgroup corresponds to the RRM of Nop15p, also
          termed nucleolar protein 15, which is encoded by
          YNL110C from Saccharomyces cerevisiae, and localizes to
          the nucleoplasm and nucleolus. Nop15p has been
          identified as a component of a pre-60S particle. It
          interacts with RNA components of the early pre-60S
          particles. Furthermore, Nop15p binds directly to a
          pre-rRNA transcript in vitro and is required for
          pre-rRNA processing. It functions as a ribosome
          synthesis factor required for the 5' to 3' exonuclease
          digestion that generates the 5' end of the major, short
          form of the 5.8S rRNA as well as for processing of 27SB
          to 7S pre-rRNA. Nop15p also play a specific role in
          cell cycle progression. Nop15p contains an RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain). .
          Length = 77

 Score = 28.6 bits (64), Expect = 0.097
 Identities = 10/37 (27%), Positives = 21/37 (56%)

Query: 19 VLYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDT 55
          V+YI +LP+     E+   F ++G ++ +R+  +  T
Sbjct: 1  VIYIGHLPHGFLEKELKKYFSQFGTVKNVRVARSKKT 37


>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1,
           2, 3, 4 family.  These eukaryotic proteins recognize the
           poly-A of mRNA and consists of four tandem RNA
           recognition domains at the N-terminus (rrm: pfam00076)
           followed by a PABP-specific domain (pfam00658) at the
           C-terminus. The protein is involved in the transport of
           mRNA's from the nucleus to the cytoplasm. There are four
           paralogs in Homo sapiens which are expressed in testis
           (GP:11610605_PABP3 ), platelets (SP:Q13310_PABP4 ),
           broadly expressed (SP:P11940_PABP1) and of unknown
           tissue range (SP:Q15097_PABP2).
          Length = 562

 Score = 29.8 bits (67), Expect = 0.10
 Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 2/40 (5%)

Query: 5   QRRANVRLPPEVNRVLYIRNLPYKITGDEMYDIFGKYGAI 44
             R    L    N  LY++NL   +  D++ ++F K+G I
Sbjct: 168 HEREAAPLKKFTN--LYVKNLDPSVNEDKLRELFAKFGEI 205



 Score = 27.8 bits (62), Expect = 0.48
 Identities = 12/44 (27%), Positives = 23/44 (52%), Gaps = 2/44 (4%)

Query: 1   MAMSQRRANVRLPPEVNRVLYIRNLPYKITGDEMYDIFGKYGAI 44
           +  SQR  ++R     N  ++++NL   +    ++D F K+G I
Sbjct: 74  IMWSQRDPSLRRSGVGN--IFVKNLDKSVDNKALFDTFSKFGNI 115



 Score = 25.5 bits (56), Expect = 3.6
 Identities = 8/30 (26%), Positives = 19/30 (63%)

Query: 20  LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
           LY++NL   +T +++ ++F + G I   ++
Sbjct: 288 LYVKNLDDTVTDEKLRELFSECGEITSAKV 317


>gnl|CDD|241031 cd12587, RRM1_PSF, RNA recognition motif 1 in vertebrate
          polypyrimidine tract-binding protein
          (PTB)-associated-splicing factor (PSF).  This subgroup
          corresponds to the RRM1 of PSF, also termed proline-
          and glutamine-rich splicing factor, or 100 kDa
          DNA-pairing protein (POMp100), or 100 kDa subunit of
          DNA-binding p52/p100 complex, a multifunctional protein
          that mediates diverse activities in the cell. It is
          ubiquitously expressed and highly conserved in
          vertebrates. PSF binds not only RNA but also both
          single-stranded DNA (ssDNA) and double-stranded DNA
          (dsDNA) and facilitates the renaturation of
          complementary ssDNAs. Besides, it promotes the
          formation of D-loops in superhelical duplex DNA, and is
          involved in cell proliferation. PSF can also interact
          with multiple factors. It is an RNA-binding component
          of spliceosomes and binds to insulin-like growth factor
          response element (IGFRE). PSF functions as a
          transcriptional repressor interacting with Sin3A and
          mediating silencing through the recruitment of histone
          deacetylases (HDACs) to the DNA binding domain (DBD) of
          nuclear hormone receptors. Additionally, PSF is an
          essential pre-mRNA splicing factor and is dissociated
          from PTB and binds to U1-70K and serine-arginine (SR)
          proteins during apoptosis. PSF forms a heterodimer with
          the nuclear protein p54nrb, also known as non-POU
          domain-containing octamer-binding protein (NonO). The
          PSF/p54nrb complex displays a variety of functions,
          such as DNA recombination and RNA synthesis,
          processing, and transport. PSF contains two conserved
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          which are responsible for interactions with RNA and for
          the localization of the protein in speckles. It also
          contains an N-terminal region rich in proline, glycine,
          and glutamine residues, which may play a role in
          interactions recruiting other molecules. .
          Length = 71

 Score = 28.7 bits (64), Expect = 0.10
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          L++ NLP  IT DE   +F KYG   ++ I
Sbjct: 4  LFVGNLPADITEDEFKKLFAKYGEPGEVFI 33


>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I
          polyadenylate-binding proteins.  This subfamily
          corresponds to the RRM4 of type I poly(A)-binding
          proteins (PABPs), highly conserved proteins that bind
          to the poly(A) tail present at the 3' ends of most
          eukaryotic mRNAs. They have been implicated in theThe
          CD corresponds to the RRM. regulation of poly(A) tail
          length during the polyadenylation reaction, translation
          initiation, mRNA stabilization by influencing the rate
          of deadenylation and inhibition of mRNA decapping. The
          family represents type I polyadenylate-binding proteins
          (PABPs), including polyadenylate-binding protein 1
          (PABP-1 or PABPC1), polyadenylate-binding protein 3
          (PABP-3 or PABPC3), polyadenylate-binding protein 4
          (PABP-4 or APP-1 or iPABP), polyadenylate-binding
          protein 5 (PABP-5 or PABPC5), polyadenylate-binding
          protein 1-like (PABP-1-like or PABPC1L),
          polyadenylate-binding protein 1-like 2 (PABPC1L2 or
          RBM32), polyadenylate-binding protein 4-like
          (PABP-4-like or PABPC4L), yeast polyadenylate-binding
          protein, cytoplasmic and nuclear (PABP or ACBP-67), and
          similar proteins. PABP-1 is an ubiquitously expressed
          multifunctional protein that may play a role in 3' end
          formation of mRNA, translation initiation, mRNA
          stabilization, protection of poly(A) from nuclease
          activity, mRNA deadenylation, inhibition of mRNA
          decapping, and mRNP maturation. Although PABP-1 is
          thought to be a cytoplasmic protein, it is also found
          in the nucleus. PABP-1 may be involved in
          nucleocytoplasmic trafficking and utilization of mRNP
          particles. PABP-1 contains four copies of RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains), a
          less well conserved linker region, and a proline-rich
          C-terminal conserved domain (CTD). PABP-3 is a
          testis-specific poly(A)-binding protein specifically
          expressed in round spermatids. It is mainly found in
          mammalian and may play an important role in the
          testis-specific regulation of mRNA homeostasis. PABP-3
          shows significant sequence similarity to PABP-1.
          However, it binds to poly(A) with a lower affinity than
          PABP-1. Moreover, PABP-1 possesses an A-rich sequence
          in its 5'-UTR and allows binding of PABP and blockage
          of translation of its own mRNA. In contrast, PABP-3
          lacks the A-rich sequence in its 5'-UTR. PABP-4 is an
          inducible poly(A)-binding protein (iPABP) that is
          primarily localized to the cytoplasm. It shows
          significant sequence similarity to PABP-1 as well. The
          RNA binding properties of PABP-1 and PABP-4 appear to
          be identical. PABP-5 is encoded by PABPC5 gene within
          the X-specific subinterval, and expressed in fetal
          brain and in a range of adult tissues in mammalian,
          such as ovary and testis. It may play an important role
          in germ cell development. Moreover, unlike other PABPs,
          PABP-5 contains only four RRMs, but lacks both the
          linker region and the CTD. PABP-1-like and PABP-1-like
          2 are the orthologs of PABP-1. PABP-4-like is the
          ortholog of PABP-5. Their cellular functions remain
          unclear. The family also includes the yeast PABP, a
          conserved poly(A) binding protein containing poly(A)
          tails that can be attached to the 3'-ends of mRNAs. The
          yeast PABP and its homologs may play important roles in
          the initiation of translation and in mRNA decay. Like
          vertebrate PABP-1, the yeast PABP contains four RRMs, a
          linker region, and a proline-rich CTD as well. The
          first two RRMs are mainly responsible for specific
          binding to poly(A). The proline-rich region may be
          involved in protein-protein interactions. .
          Length = 79

 Score = 28.7 bits (65), Expect = 0.12
 Identities = 10/29 (34%), Positives = 16/29 (55%), Gaps = 2/29 (6%)

Query: 16 VNRVLYIRNLPYKITGDEMYDIFGKYGAI 44
          VN  LY++NL   I  + + + F  +G I
Sbjct: 2  VN--LYVKNLDDSIDDERLREEFSPFGTI 28


>gnl|CDD|240999 cd12555, RRM2_RBM15, RNA recognition motif 2 in vertebrate RNA
          binding motif protein 15 (RBM15).  This subgroup
          corresponds to the RRM2 of RBM15, also termed
          one-twenty two protein 1 (OTT1), conserved in
          eukaryotes, a novel mRNA export factor and component of
          the NXF1 pathway. It binds to NXF1 and serves as
          receptor for the RNA export element RTE. It also
          possesses mRNA export activity and can facilitate the
          access of DEAD-box protein DBP5 to mRNA at the nuclear
          pore complex (NPC). RBM15 belongs to the Spen (split
          end) protein family, which contain three N-terminal RNA
          recognition motifs (RRMs), also known as RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain), and
          a C-terminal SPOC (Spen paralog and ortholog
          C-terminal) domain. This family also includes a
          RBM15-MKL1 (OTT-MAL) fusion protein that RBM15 is
          N-terminally fused to megakaryoblastic leukemia 1
          protein (MKL1) at the C-terminus in a translocation
          involving chromosome 1 and 22, resulting in acute
          megakaryoblastic leukemia. The fusion protein could
          interact with the mRNA export machinery. Although it
          maintains the specific transactivator function of MKL1,
          the fusion protein cannot activate RTE-mediated mRNA
          expression and has lost the post-transcriptional
          activator function of RBM15. However, it has
          transdominant suppressor function contributing to its
          oncogenic properties. .
          Length = 87

 Score = 28.8 bits (64), Expect = 0.13
 Identities = 10/33 (30%), Positives = 19/33 (57%)

Query: 17 NRVLYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          NR L++ NL   +T  ++   F ++G I ++ I
Sbjct: 7  NRTLFLGNLDITVTETDLRRAFDRFGVITEVDI 39


>gnl|CDD|233508 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus splicing factor
           family.  Included in this family of heterogeneous
           ribonucleoproteins are PTB (polypyrimidine tract binding
           protein ) and hnRNP-L. These proteins contain four RNA
           recognition motifs (rrm: pfam00067).
          Length = 481

 Score = 29.4 bits (66), Expect = 0.15
 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 2/42 (4%)

Query: 16  VNRVLY--IRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDT 55
            N+VL   + N  Y IT D +Y IF  YG + +I      + 
Sbjct: 93  PNKVLRVIVENPMYPITLDVLYQIFNPYGKVLRIVTFTKNNV 134



 Score = 27.9 bits (62), Expect = 0.43
 Identities = 10/41 (24%), Positives = 21/41 (51%), Gaps = 2/41 (4%)

Query: 17  NRVLYIRNL-PYKITGDEMYDIFGKYGAIRQIRI-GNTPDT 55
             VL +  L   K+  D ++++F  YG + +++   N  +T
Sbjct: 275 GSVLMVSGLHQEKVNCDRLFNLFCVYGNVERVKFMKNKKET 315


>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54
          kDa nuclear RNA- and DNA-binding protein (p54nrb).
          This subgroup corresponds to the RRM1 of p54nrb, also
          termed non-POU domain-containing octamer-binding
          protein (NonO), or 55 kDa nuclear protein (NMT55), or
          DNA-binding p52/p100 complex 52 kDa subunit. p54nrb is
          a multifunctional protein involved in numerous nuclear
          processes including transcriptional regulation,
          splicing, DNA unwinding, nuclear retention of
          hyperedited double-stranded RNA, viral RNA processing,
          control of cell proliferation, and circadian rhythm
          maintenance. It is ubiquitously expressed and highly
          conserved in vertebrates. p54nrb binds both, single-
          and double-stranded RNA and DNA, and also possesses
          inherent carbonic anhydrase activity. It forms a
          heterodimer with paraspeckle component 1 (PSPC1 or
          PSP1), localizing to paraspeckles in an RNA-dependent
          manneras well as with polypyrimidine tract-binding
          protein-associated-splicing factor (PSF). p54nrb
          contains two conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), at the N-terminus. .
          Length = 71

 Score = 28.3 bits (63), Expect = 0.16
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          L++ NLP  IT +EM  +F KYG   +I I
Sbjct: 4  LFVGNLPPDITEEEMRKLFEKYGKAGEIFI 33


>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in
          RNA-binding protein 5 (RBM5) and similar proteins.
          This subfamily includes the RRM1 and RRM2 of
          RNA-binding protein 5 (RBM5 or LUCA15 or H37) and
          RNA-binding protein 10 (RBM10 or S1-1), and the RRM2 of
          RNA-binding protein 6 (RBM6 or NY-LU-12 or g16 or
          DEF-3). These RBMs share high sequence homology and may
          play an important role in regulating apoptosis. RBM5 is
          a known modulator of apoptosis. It may also act as a
          tumor suppressor or an RNA splicing factor. RBM6 has
          been predicted to be a nuclear factor based on its
          nuclear localization signal. Both, RBM6 and RBM5,
          specifically bind poly(G) RNA. RBM10 is a paralog of
          RBM5. It may play an important role in mRNA generation,
          processing and degradation in several cell types. The
          rat homolog of human RBM10 is protein S1-1, a
          hypothetical RNA binding protein with poly(G) and
          poly(U) binding capabilities. All family members
          contain two RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), two C2H2-type zinc fingers, and a
          G-patch/D111 domain. .
          Length = 84

 Score = 28.3 bits (64), Expect = 0.17
 Identities = 7/41 (17%), Positives = 15/41 (36%), Gaps = 2/41 (4%)

Query: 17 NRVLYIRNLPYKITGDEMYDIFGKYGA--IRQIRIGNTPDT 55
             L +R L    T +++        +  I+ +R+     T
Sbjct: 2  TNTLILRGLDLLTTEEDILQALSAIASVPIKDVRLIRDKLT 42


>gnl|CDD|240802 cd12356, RRM_PPARGC1B, RNA recognition motif in peroxisome
          proliferator-activated receptor gamma coactivator
          1-beta (PGC-1-beta) and similar proteins.  This
          subfamily corresponds to the RRM of PGC-1beta, also
          termed PPAR-gamma coactivator 1-beta, or PPARGC-1-beta,
          or PGC-1-related estrogen receptor alpha coactivator,
          which is one of the members of PGC-1 transcriptional
          coactivators family, including PGC-1alpha and
          PGC-1-related coactivator (PRC). PGC-1beta plays a
          nonredundant role in controlling mitochondrial
          oxidative energy metabolism and affects both, insulin
          sensitivity and mitochondrial biogenesis, and functions
          in a number of oxidative tissues. It is involved in
          maintaining baseline mitochondrial function and cardiac
          contractile function following pressure overload
          hypertrophy by preserving glucose metabolism and
          preventing oxidative stress. PGC-1beta induces
          hypertriglyceridemia in response to dietary fats
          through activating hepatic lipogenesis and lipoprotein
          secretion. It can stimulate apolipoprotein C3 (APOC3)
          expression, further mediating hypolipidemic effect of
          nicotinic acid. PGC-1beta also drives nuclear
          respiratory factor 1 (NRF-1) target gene expression and
          NRF-1 and estrogen related receptor alpha
          (ERRalpha)-dependent mitochondrial biogenesis. The
          modulation of the expression of PGC-1beta can trigger
          ERRalpha-induced adipogenesis. PGC-1beta is also a
          potent regulator inducing angiogenesis in skeletal
          muscle. The transcriptional activity of PGC-1beta can
          be increased through binding to host cell factor (HCF),
          a cellular protein involved in herpes simplex virus
          (HSV) infection and cell cycle regulation. PGC-1beta is
          a multi-domain protein containing an N-terminal
          activation domain, an LXXLL coactivator signature, a
          tetrapeptide motif (DHDY) responsible for HCF binding,
          two glutamic/aspartic acid-rich acidic domains, and an
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain). In
          contrast to PGC-1alpha, PGC-1beta lacks most of the
          arginine/serine (SR)-rich domain that is responsible
          for the regulation of RNA processing. .
          Length = 79

 Score = 28.3 bits (63), Expect = 0.17
 Identities = 11/32 (34%), Positives = 19/32 (59%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          RV+YIRNL   ++  E+   F  +G I + ++
Sbjct: 3  RVIYIRNLSSSMSSTELKKRFEVFGEIEECKV 34


>gnl|CDD|240693 cd12247, RRM2_U1A_like, RNA recognition motif 2 in the
          U1A/U2B"/SNF protein family.  This subfamily
          corresponds to the RRM2 of U1A/U2B"/SNF protein family,
          containing Drosophila sex determination protein SNF and
          its two mammalian counterparts, U1 small nuclear
          ribonucleoprotein A (U1 snRNP A or U1-A or U1A) and U2
          small nuclear ribonucleoprotein B" (U2 snRNP B" or
          U2B"), all of which consist of two RNA recognition
          motifs (RRMs) connected by a variable, flexible linker.
          SNF is an RNA-binding protein found in the U1 and U2
          snRNPs of Drosophila where it is essential in sex
          determination and possesses a novel dual RNA binding
          specificity. SNF binds with high affinity to both
          Drosophila U1 snRNA stem-loop II (SLII) and U2 snRNA
          stem-loop IV (SLIV). It can also bind to poly(U) RNA
          tracts flanking the alternatively spliced Sex-lethal
          (Sxl) exon, as does Drosophila Sex-lethal protein
          (SXL). U1A is an RNA-binding protein associated with
          the U1 snRNP, a small RNA-protein complex involved in
          pre-mRNA splicing. U1A binds with high affinity and
          specificity to stem-loop II (SLII) of U1 snRNA. It is
          predominantly a nuclear protein that shuttles between
          the nucleus and the cytoplasm independently of
          interactions with U1 snRNA. Moreover, U1A may be
          involved in RNA 3'-end processing, specifically
          cleavage, splicing and polyadenylation, through
          interacting with a large number of non-snRNP proteins.
          U2B", initially identified to bind to stem-loop IV
          (SLIV) at the 3' end of U2 snRNA, is a unique protein
          that comprises of the U2 snRNP. Additional research
          indicates U2B" binds to U1 snRNA stem-loop II (SLII) as
          well and shows no preference for SLIV or SLII on the
          basis of binding affinity. U2B" does not require an
          auxiliary protein for binding to RNA and its nuclear
          transport is independent on U2 snRNA binding. .
          Length = 72

 Score = 27.9 bits (63), Expect = 0.18
 Identities = 8/32 (25%), Positives = 22/32 (68%)

Query: 17 NRVLYIRNLPYKITGDEMYDIFGKYGAIRQIR 48
          N++L+++NLP + T + +  +F ++   +++R
Sbjct: 2  NKILFLQNLPEETTKEMLEMLFNQFPGFKEVR 33


>gnl|CDD|240910 cd12464, RRM_G3BP2, RNA recognition motif in ras
          GTPase-activating protein-binding protein 2 (G3BP2) and
          similar proteins.  This subgroup corresponds to the RRM
          of G3BP2, also termed GAP SH3 domain-binding protein 2,
          a cytoplasmic protein that interacts with both
          IkappaBalpha and IkappaBalpha/NF-kappaB complexes,
          indicating that G3BP2 may play a role in the control of
          nucleocytoplasmic distribution of IkappaBalpha and
          cytoplasmic anchoring of the IkappaBalpha/NF-kappaB
          complex. G3BP2 contains an N-terminal nuclear transfer
          factor 2 (NTF2)-like domain, an acidic domain, a domain
          containing five PXXP motifs, an RNA recognition motif
          (RRM domain), and an Arg-Gly-rich region (RGG-rich
          region, or arginine methylation motif). It binds to the
          SH3 domain of RasGAP, a multi-functional protein
          controlling Ras activity, through its N-terminal
          NTF2-like domain. The acidic domain is sufficient for
          the interaction of G3BP2 with the IkappaBalpha
          cytoplasmic retention sequence. Furthermore, G3BP2
          might influence stability or translational efficiency
          of particular mRNAs by binding to RNA-containing
          structures within the cytoplasm through its RNA-binding
          domain.
          Length = 83

 Score = 28.0 bits (62), Expect = 0.19
 Identities = 10/30 (33%), Positives = 19/30 (63%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          L++ NLP+ I   E+ + F  +G + ++RI
Sbjct: 8  LFVGNLPHDIDESELKEFFMSFGNVVELRI 37


>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in
          SMART/HDAC1-associated repressor protein (SHARP) and
          similar proteins.  This subfamily corresponds to the
          RRM3 of SHARP, also termed Msx2-interacting protein
          (MINT), or SPEN homolog, an estrogen-inducible
          transcriptional repressor that interacts directly with
          the nuclear receptor corepressor SMRT, histone
          deacetylases (HDACs) and components of the NuRD
          complex. SHARP recruits HDAC activity and binds to the
          steroid receptor RNA coactivator SRA through four
          conserved N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), further suppressing
          SRA-potentiated steroid receptor transcription
          activity. Thus, SHARP has the capacity to modulate both
          liganded and nonliganded nuclear receptors. SHARP also
          has been identified as a component of transcriptional
          repression complexes in Notch/RBP-Jkappa signaling
          pathways. In addition to the N-terminal RRMs, SHARP
          possesses a C-terminal SPOC domain (Spen paralog and
          ortholog C-terminal domain), which is highly conserved
          among Spen proteins.  .
          Length = 74

 Score = 28.1 bits (63), Expect = 0.19
 Identities = 11/32 (34%), Positives = 17/32 (53%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          R L+I NL    T  ++ + F ++G I  I I
Sbjct: 3  RTLFIGNLEKTTTYSDLREAFERFGEIIDIDI 34


>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found
          in heterogeneous nuclear ribonucleoprotein (hnRNP) H
          protein family, epithelial splicing regulatory proteins
          (ESRPs), Drosophila RNA-binding protein Fusilli,
          RNA-binding protein 12 (RBM12) and similar proteins.
          The family includes RRM domains in the hnRNP H protein
          family, G-rich sequence factor 1 (GRSF-1), ESRPs (also
          termed RBM35), Drosophila Fusilli, RBM12 (also termed
          SWAN), RBM12B, RBM19 (also termed RBD-1) and similar
          proteins. The hnRNP H protein family includes hnRNP H
          (also termed mcs94-1), hnRNP H2 (also termed FTP-3 or
          hnRNP H'), hnRNP F and hnRNP H3 (also termed hnRNP
          2H9), which represent a group of nuclear RNA binding
          proteins that are involved in pre-mRNA processing.
          GRSF-1 is a cytoplasmic poly(A)+ mRNA binding protein
          which interacts with RNA in a G-rich element-dependent
          manner. It may function in RNA packaging, stabilization
          of RNA secondary structure, or other macromolecular
          interactions. ESRP1 (also termed RBM35A) and ESRP2
          (also termed RBM35B) are epithelial-specific RNA
          binding proteins that promote splicing of the
          epithelial variant of fibroblast growth factor receptor
          2 (FGFR2), ENAH (also termed hMena), CD44 and CTNND1
          (also termed p120-Catenin) transcripts. Fusilli shows
          high sequence homology to ESRPs. It can regulate
          endogenous FGFR2 splicing and functions as a splicing
          factor. The biological roles of both, RBM12 and RBM12B,
          remain unclear. RBM19 is a nucleolar protein conserved
          in eukaryotes. It is involved in ribosome biogenesis by
          processing rRNA. In addition, it is essential for
          preimplantation development. Members in this family
          contain 2~6 conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). .
          Length = 73

 Score = 27.9 bits (63), Expect = 0.20
 Identities = 11/39 (28%), Positives = 17/39 (43%), Gaps = 1/39 (2%)

Query: 19 VLYIRNLPYKITGDEMYDIFGKYG-AIRQIRIGNTPDTR 56
          V+ +R LP+  T +++ D F         I I    D R
Sbjct: 1  VVRLRGLPFSATEEDIRDFFSGLDIPPDGIHIVYDDDGR 39


>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia
          (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE.
          This subfamily corresponds to the RRM domain of two
          Deleted in AZoospermia (DAZ) autosomal homologs, DAZL
          (DAZ-like) and BOULE. BOULE is the founder member of
          the family and DAZL arose from BOULE in an ancestor of
          vertebrates. The DAZ gene subsequently originated from
          a duplication transposition of the DAZL gene.
          Invertebrates contain a single DAZ homolog, BOULE,
          while vertebrates, other than catarrhine primates,
          possess both BOULE and DAZL genes. The catarrhine
          primates possess BOULE, DAZL, and DAZ genes. The family
          members encode closely related RNA-binding proteins
          that are required for fertility in numerous organisms.
          These proteins contain an RNA recognition motif (RRM),
          also known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and a varying number of
          copies of a DAZ motif, believed to mediate
          protein-protein interactions. DAZL and BOULE contain a
          single copy of the DAZ motif, while DAZ proteins can
          contain 8-24 copies of this repeat. Although their
          specific biochemical functions remain to be
          investigated, DAZL proteins may interact with
          poly(A)-binding proteins (PABPs), and act as
          translational activators of specific mRNAs during
          gametogenesis.  .
          Length = 80

 Score = 28.0 bits (63), Expect = 0.20
 Identities = 9/33 (27%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 17 NRVLYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          NR+ ++  +P   T +E+ D F ++G+++ ++I
Sbjct: 3  NRI-FVGGIPPDTTEEELRDFFSRFGSVKDVKI 34


>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate
          Hu-antigen R (HuR).  This subgroup corresponds to the
          RRM2 of HuR, also termed ELAV-like protein 1 (ELAV-1),
          the ubiquitously expressed Hu family member. It has a
          variety of biological functions mostly related to the
          regulation of cellular response to DNA damage and other
          types of stress. HuR has an anti-apoptotic function
          during early cell stress response. It binds to mRNAs
          and enhances the expression of several anti-apoptotic
          proteins, such as p21waf1, p53, and prothymosin alpha.
          HuR also has pro-apoptotic function by promoting
          apoptosis when cell death is unavoidable. Furthermore,
          HuR may be important in muscle differentiation,
          adipogenesis, suppression of inflammatory response and
          modulation of gene expression in response to chronic
          ethanol exposure and amino acid starvation. Like other
          Hu proteins, HuR contains three RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). RRM1 and RRM2 may
          cooperate in binding to an AU-rich RNA element (ARE).
          RRM3 may help to maintain the stability of the
          RNA-protein complex, and might also bind to poly(A)
          tails or be involved in protein-protein interactions. .
          Length = 84

 Score = 28.1 bits (62), Expect = 0.21
 Identities = 11/30 (36%), Positives = 18/30 (60%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          LYI  LP  +T  ++ D+F ++G I   R+
Sbjct: 3  LYISGLPRTMTQKDVEDMFSRFGRIINSRV 32


>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA
          binding protein fox-1 homologs and similar proteins.
          This subfamily corresponds to the RRM of several
          tissue-specific alternative splicing isoforms of
          vertebrate RNA binding protein Fox-1 homologs, which
          show high sequence similarity to the Caenorhabditis
          elegans feminizing locus on X (Fox-1) gene encoding
          Fox-1 protein. RNA binding protein Fox-1 homolog 1
          (RBFOX1), also termed ataxin-2-binding protein 1
          (A2BP1), or Fox-1 homolog A, or
          hexaribonucleotide-binding protein 1 (HRNBP1), is
          predominantly expressed in neurons, skeletal muscle and
          heart. It regulates alternative splicing of
          tissue-specific exons by binding to UGCAUG elements.
          Moreover, RBFOX1 binds to the C-terminus of ataxin-2
          and forms an ataxin-2/A2BP1 complex involved in RNA
          processing. RNA binding protein fox-1 homolog 2
          (RBFOX2), also termed Fox-1 homolog B, or
          hexaribonucleotide-binding protein 2 (HRNBP2), or
          RNA-binding motif protein 9 (RBM9), or repressor of
          tamoxifen transcriptional activity, is expressed in
          ovary, whole embryo, and human embryonic cell lines in
          addition to neurons and muscle. RBFOX2 activates
          splicing of neuron-specific exons through binding to
          downstream UGCAUG elements. RBFOX2 also functions as a
          repressor of tamoxifen activation of the estrogen
          receptor. RNA binding protein Fox-1 homolog 3 (RBFOX3
          or NeuN or HRNBP3), also termed Fox-1 homolog C, is a
          nuclear RNA-binding protein that regulates alternative
          splicing of the RBFOX2 pre-mRNA, producing a message
          encoding a dominant negative form of the RBFOX2
          protein. Its message is detected exclusively in
          post-mitotic regions of embryonic brain. Like RBFOX1,
          both RBFOX2 and RBFOX3 bind to the hexanucleotide
          UGCAUG elements and modulate brain and muscle-specific
          splicing of exon EIIIB of fibronectin, exon N1 of
          c-src, and calcitonin/CGRP. Members in this family also
          harbor one RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains). .
          Length = 76

 Score = 27.8 bits (62), Expect = 0.21
 Identities = 8/32 (25%), Positives = 20/32 (62%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          + L++ N+P++    ++  +FG++G I  + I
Sbjct: 1  KRLHVSNIPFRFRDPDLRQMFGQFGPILDVEI 32


>gnl|CDD|241013 cd12569, RRM4_RBM19, RNA recognition motif 4 in RNA-binding
          protein 19 (RBM19) and similar proteins.  This subgroup
          corresponds to the RRM4 of RBM19, also termed
          RNA-binding domain-1 (RBD-1), which is a nucleolar
          protein conserved in eukaryotes. It is involved in
          ribosome biogenesis by processing rRNA. In addition, it
          is essential for preimplantation development. RBM19 has
          a unique domain organization containing 6 conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains). .
          Length = 72

 Score = 27.7 bits (62), Expect = 0.21
 Identities = 8/29 (27%), Positives = 19/29 (65%)

Query: 19 VLYIRNLPYKITGDEMYDIFGKYGAIRQI 47
          V+ ++NLP      E+ ++F K+G++ ++
Sbjct: 2  VILVKNLPAGTLTAELRELFSKFGSLGRV 30


>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and
          CTD-associated factor 4 (SCAF4), SR-related and
          CTD-associated factor 8 (SCAF8) and similar proteins.
          This subfamily corresponds to the RRM in a new class of
          SCAFs (SR-like CTD-associated factors), including
          SCAF4, SCAF8 and similar proteins. The biological role
          of SCAF4 remains unclear, but it shows high sequence
          similarity to SCAF8 (also termed CDC5L
          complex-associated protein 7, or RNA-binding motif
          protein 16, or CTD-binding SR-like protein RA8). SCAF8
          is a nuclear matrix protein that interacts specifically
          with a highly serine-phosphorylated form of the
          carboxy-terminal domain (CTD) of the largest subunit of
          RNA polymerase II (pol II). The pol II CTD plays a role
          in coupling transcription and pre-mRNA processing. In
          addition, SCAF8 co-localizes primarily with
          transcription sites that are enriched in nuclear matrix
          fraction, which is known to contain proteins involved
          in pre-mRNA processing. Thus, SCAF8 may play a direct
          role in coupling with both, transcription and pre-mRNA
          processing, processes. SCAF8 and SCAF4 both contain a
          conserved N-terminal CTD-interacting domain (CID), an
          atypical RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNPs (ribonucleoprotein
          domain), and serine/arginine-rich motifs.
          Length = 77

 Score = 27.7 bits (62), Expect = 0.21
 Identities = 10/30 (33%), Positives = 20/30 (66%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAIRQI 47
            L+I +L  K+T +++ ++F +YG I+ I
Sbjct: 3  TTLWIGHLSKKVTEEDLKNLFEEYGEIQSI 32


>gnl|CDD|241137 cd12693, RRM2_PTBP1_like, RNA recognition motif 2 in
          polypyrimidine tract-binding protein 1 (PTB or hnRNP I)
          and similar proteins.  This subfamily corresponds to
          the RRM2 of polypyrimidine tract-binding protein 1 (PTB
          or hnRNP I), polypyrimidine tract-binding protein 2
          (PTBP2 or nPTB), regulator of differentiation 1 (Rod1),
          and similar proteins found in Metazoa. PTB is an
          important negative regulator of alternative splicing in
          mammalian cells and also functions at several other
          aspects of mRNA metabolism, including mRNA
          localization, stabilization, polyadenylation, and
          translation. PTBP2 is highly homologous to PTB and is
          perhaps specific to the vertebrates. Unlike PTB, PTBP2
          is enriched in the brain and in some neural cell lines.
          It binds more stably to the downstream control sequence
          (DCS) RNA than PTB does but is a weaker repressor of
          splicing in vitro. PTBP2 also greatly enhances the
          binding of two other proteins, heterogeneous nuclear
          ribonucleoprotein (hnRNP) H and KH-type
          splicing-regulatory protein (KSRP), to the DCS RNA. The
          binding properties of PTBP2 and its reduced inhibitory
          activity on splicing imply roles in controlling the
          assembly of other splicing-regulatory proteins. PTBP2
          also contains four RRMs. ROD1 coding protein Rod1 is a
          mammalian PTB homolog of a regulator of differentiation
          in the fission yeast Schizosaccharomyces pombe, where
          the nrd1 gene encodes an RNA binding protein negatively
          regulates the onset of differentiation. ROD1 is
          predominantly expressed in hematopoietic cells or
          organs. It may play a role controlling differentiation
          in mammals. All members in this family contain four RNA
          recognition motifs (RRM), also known as RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain). .
          Length = 96

 Score = 28.2 bits (63), Expect = 0.22
 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 2/33 (6%)

Query: 17 NRVLY--IRNLPYKITGDEMYDIFGKYGAIRQI 47
          N VL   + N+ Y +T D ++ IF K+G + +I
Sbjct: 1  NTVLRVIVENMTYPVTLDVLHQIFSKFGTVLKI 33


>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the
          p54nrb/PSF/PSP1 family.  This subfamily corresponds to
          the RRM1 of the p54nrb/PSF/PSP1 family, including 54
          kDa nuclear RNA- and DNA-binding protein (p54nrb or
          NonO or NMT55), polypyrimidine tract-binding protein
          (PTB)-associated-splicing factor (PSF or POMp100),
          paraspeckle protein 1 (PSP1 or PSPC1), which are
          ubiquitously expressed and are conserved in
          vertebrates. p54nrb is a multi-functional protein
          involved in numerous nuclear processes including
          transcriptional regulation, splicing, DNA unwinding,
          nuclear retention of hyperedited double-stranded RNA,
          viral RNA processing, control of cell proliferation,
          and circadian rhythm maintenance. PSF is also a
          multi-functional protein that binds RNA,
          single-stranded DNA (ssDNA), double-stranded DNA
          (dsDNA) and many factors, and mediates diverse
          activities in the cell. PSP1 is a novel nucleolar
          factor that accumulates within a new nucleoplasmic
          compartment, termed paraspeckles, and diffusely
          distributes in the nucleoplasm. The cellular function
          of PSP1 remains unknown currently. This subfamily also
          includes some p54nrb/PSF/PSP1 homologs from
          invertebrate species, such as the Drosophila
          melanogaster gene no-ontransient A (nonA) encoding
          puff-specific protein Bj6 (also termed NONA) and
          Chironomus tentans hrp65 gene encoding protein Hrp65.
          D. melanogaster NONA is involved in eye development and
          behavior, and may play a role in circadian rhythm
          maintenance, similar to vertebrate p54nrb. C. tentans
          Hrp65 is a component of nuclear fibers associated with
          ribonucleoprotein particles in transit from the gene to
          the nuclear pore. All family members contain a DBHS
          domain (for Drosophila behavior, human splicing), which
          comprises two conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a charged
          protein-protein interaction module. PSF has an
          additional large N-terminal domain that differentiates
          it from other family members. .
          Length = 71

 Score = 27.6 bits (62), Expect = 0.23
 Identities = 11/30 (36%), Positives = 20/30 (66%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          L++ NLP  IT +E  ++F KYG + ++ +
Sbjct: 4  LFVGNLPNDITEEEFKELFSKYGEVSEVFL 33


>gnl|CDD|240898 cd12452, RRM_ARP_like, RNA recognition motif in yeast
          asparagine-rich protein (ARP) and similar proteins.
          This subfamily corresponds to the RRM of ARP, also
          termed NRP1, encoded by Saccharomyces cerevisiae
          YDL167C. Although its exact biological function remains
          unclear, ARP contains an RNA recognition motif (RRM),
          also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), two Ran-binding protein
          zinc fingers (zf-RanBP), and an asparagine-rich region.
          It may possess RNA-binding and zinc ion binding
          activities. Additional research had indicated that ARP
          may function as a factor involved in the stress
          response. .
          Length = 88

 Score = 27.8 bits (62), Expect = 0.27
 Identities = 12/25 (48%), Positives = 15/25 (60%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYG 42
          +VLYI NLP   T  E+   F +YG
Sbjct: 1  KVLYISNLPPDTTQLELESWFTQYG 25


>gnl|CDD|240921 cd12477, RRM1_U1A, RNA recognition motif 1 found in vertebrate U1
          small nuclear ribonucleoprotein A (U1A).  This subgroup
          corresponds to the RRM1 of U1A (also termed U1 snRNP A
          or U1-A), an RNA-binding protein associated with the U1
          snRNP, a small RNA-protein complex involved in pre-mRNA
          splicing. U1A binds with high affinity and specificity
          to stem-loop II (SLII) of U1 snRNA. It is predominantly
          a nuclear protein and it also shuttles between the
          nucleus and the cytoplasm independently of interactions
          with U1 snRNA. U1A may be involved in RNA 3'-end
          processing, specifically cleavage, splicing and
          polyadenylation, through interacting with a large
          number of non-snRNP proteins, including polypyrimidine
          tract binding protein (PTB), polypyrimidine-tract
          binding protein-associated factor (PSF), and
          non-POU-domain-containing, octamer-binding (NONO), DEAD
          (Asp-Glu-Ala-Asp) box polypeptide 5 (DDX5). It also
          binds to a flavivirus NS5 protein and plays an
          important role in virus replication. U1A contains two
          RNA recognition motifs (RRMs); the N-terminal RRM
          (RRM1) binds tightly and specifically to the U1 snRNA
          SLII and its own 3'-UTR, while in contrast, the
          C-terminal RRM (RRM2) does not appear to associate with
          any RNA and may be free to bind other proteins. U1A
          also contains a proline-rich region, and a nuclear
          localization signal (NLS) in the central domain that is
          responsible for its nuclear import. .
          Length = 89

 Score = 27.7 bits (61), Expect = 0.27
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 13/64 (20%)

Query: 17 NRVLYIRNLPYKITGDE----MYDIFGKYGAIRQIRIGNTPDTRYLTKSLVMKCMIFLVN 72
          N  +YI NL  KI  DE    ++ IF ++G I  I +         ++SL M+   F++ 
Sbjct: 3  NHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILV---------SRSLKMRGQAFVIF 53

Query: 73 MELS 76
           E+S
Sbjct: 54 KEVS 57


>gnl|CDD|241142 cd12698, RRM3_PTBPH3, RNA recognition motif 3 in plant
          polypyrimidine tract-binding protein homolog 3
          (PTBPH3).  This subgroup corresponds to the RRM3 of
          PTBPH3. Although its biological roles remain unclear,
          PTBPH3 shows significant sequence similarity to
          polypyrimidine tract binding protein (PTB) that is an
          important negative regulator of alternative splicing in
          mammalian cells and also functions at several other
          aspects of mRNA metabolism, including mRNA
          localization, stabilization, polyadenylation, and
          translation. Like PTB, PTBPH3 contains four RNA
          recognition motifs (RRM), also known as RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain). .
          Length = 76

 Score = 27.6 bits (61), Expect = 0.31
 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 2/37 (5%)

Query: 20 LYIRNL-PYKITGDEMYDIFGKYGAIRQIRI-GNTPD 54
          L + NL P KI  D+++++F  YG I +I++  N PD
Sbjct: 4  LLVSNLNPEKIDADKLFNLFSNYGNIVRIKLLHNKPD 40


>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic
          translation initiation factor 3 subunit G (eIF-3G) and
          similar proteins.  This subfamily corresponds to the
          RRM of eIF-3G and similar proteins. eIF-3G, also termed
          eIF-3 subunit 4, or eIF-3-delta, or eIF3-p42, or
          eIF3-p44, is the RNA-binding subunit of eIF3, a large
          multisubunit complex that plays a central role in the
          initiation of translation by binding to the 40 S
          ribosomal subunit and promoting the binding of
          methionyl-tRNAi and mRNA. eIF-3G binds 18 S rRNA and
          beta-globin mRNA, and therefore appears to be a
          nonspecific RNA-binding protein. eIF-3G is one of the
          cytosolic targets and interacts with mature
          apoptosis-inducing factor (AIF). eIF-3G contains one
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain). This
          family also includes yeast eIF3-p33, a homolog of
          vertebrate eIF-3G, plays an important role in the
          initiation phase of protein synthesis in yeast. It
          binds both, mRNA and rRNA, fragments due to an RRM near
          its C-terminus. .
          Length = 77

 Score = 27.5 bits (62), Expect = 0.31
 Identities = 7/35 (20%), Positives = 17/35 (48%)

Query: 22 IRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTR 56
          + NL      D++ ++F  +G I ++ +    +T 
Sbjct: 4  VTNLSEDADEDDLRELFRPFGPISRVYLAKDKETG 38


>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate
          RNA-binding protein 39 (RBM39) and similar proteins.
          This subfamily corresponds to the RRM1 of RNA-binding
          protein 39 (RBM39), RNA-binding protein 23 (RBM23) and
          similar proteins. RBM39 (also termed HCC1) is a nuclear
          autoantigen that contains an N-terminal arginine/serine
          rich (RS) motif and three RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). An octapeptide sequence
          called the RS-ERK motif is repeated six times in the RS
          region of RBM39. Although the cellular function of
          RBM23 remains unclear, it shows high sequence homology
          to RBM39 and contains two RRMs. It may possibly
          function as a pre-mRNA splicing factor. .
          Length = 73

 Score = 27.2 bits (61), Expect = 0.32
 Identities = 9/29 (31%), Positives = 17/29 (58%)

Query: 21 YIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          ++  L  K+   ++Y+ F K G +R +RI
Sbjct: 3  FVMQLSLKVRERDLYEFFSKAGKVRDVRI 31


>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear
          ribonucleoprotein 70 kDa (U1-70K) and similar proteins.
           This subfamily corresponds to the RRM of U1-70K, also
          termed snRNP70, a key component of the U1 snRNP
          complex, which is one of the key factors facilitating
          the splicing of pre-mRNA via interaction at the 5'
          splice site, and is involved in regulation of
          polyadenylation of some viral and cellular genes,
          enhancing or inhibiting efficient poly(A) site usage.
          U1-70K plays an essential role in targeting the U1
          snRNP to the 5' splice site through protein-protein
          interactions with regulatory RNA-binding splicing
          factors, such as the RS protein ASF/SF2. Moreover,
          U1-70K protein can specifically bind to stem-loop I of
          the U1 small nuclear RNA (U1 snRNA) contained in the U1
          snRNP complex. It also mediates the binding of U1C,
          another U1-specific protein, to the U1 snRNP complex.
          U1-70K contains a conserved RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), followed by an adjacent
          glycine-rich region at the N-terminal half, and two
          serine/arginine-rich (SR) domains at the C-terminal
          half. The RRM is responsible for the binding of
          stem-loop I of U1 snRNA molecule. Additionally, the
          most prominent immunodominant region that can be
          recognized by auto-antibodies from autoimmune patients
          may be located within the RRM. The SR domains are
          involved in protein-protein interaction with SR
          proteins that mediate 5' splice site recognition. For
          instance, the first SR domain is necessary and
          sufficient for ASF/SF2 Binding. The family also
          includes Drosophila U1-70K that is an essential
          splicing factor required for viability in flies, but
          its SR domain is dispensable. The yeast U1-70k doesn't
          contain easily recognizable SR domains and shows low
          sequence similarity in the RRM region with other U1-70k
          proteins and therefore not included in this family. The
          RRM domain is dispensable for yeast U1-70K function.
          Length = 91

 Score = 27.6 bits (62), Expect = 0.32
 Identities = 10/32 (31%), Positives = 19/32 (59%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          + L++  L Y  T  ++   F +YG I++IR+
Sbjct: 2  KTLFVARLNYDTTESKLRREFEEYGPIKRIRL 33


>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar
          protein interacting with the FHA domain of pKI-67
          (NIFK) and similar proteins.  This subgroup corresponds
          to the RRM of NIFK and Nop15p. NIFK, also termed MKI67
          FHA domain-interacting nucleolar phosphoprotein, or
          nucleolar phosphoprotein Nopp34, is a putative
          RNA-binding protein interacting with the forkhead
          associated (FHA) domain of pKi-67 antigen in a
          mitosis-specific and phosphorylation-dependent manner.
          It is nucleolar in interphase but associates with
          condensed mitotic chromosomes. This family also
          includes Saccharomyces cerevisiae YNL110C gene encoding
          ribosome biogenesis protein 15 (Nop15p), also termed
          nucleolar protein 15. Both, NIFK and Nop15p, contain an
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain). .
          Length = 74

 Score = 27.2 bits (61), Expect = 0.33
 Identities = 10/37 (27%), Positives = 21/37 (56%)

Query: 19 VLYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDT 55
          V+YI +LP+     E+   F ++G + ++R+  +  T
Sbjct: 1  VVYIGHLPHGFYEPELRKYFSQFGTVTRLRLSRSKKT 37


>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage
          stimulation factor subunit 2 (CSTF2), cleavage
          stimulation factor subunit 2 tau variant (CSTF2T) and
          similar proteins.  This subgroup corresponds to the RRM
          domain of CSTF2, its tau variant and eukaryotic
          homologs. CSTF2, also termed cleavage stimulation
          factor 64 kDa subunit (CstF64), is the vertebrate
          conterpart of yeast mRNA 3'-end-processing protein
          RNA15. It is expressed in all somatic tissues and is
          one of three cleavage stimulatory factor (CstF)
          subunits required for polyadenylation. CstF64 contains
          an N-terminal RNA recognition motif (RRM), also known
          as RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain), a CstF77-binding domain, a repeated MEARA
          helical region and a conserved C-terminal domain
          reported to bind the transcription factor PC-4. During
          polyadenylation, CstF interacts with the pre-mRNA
          through the RRM of CstF64 at U- or GU-rich sequences
          within 10 to 30 nucleotides downstream of the cleavage
          site. CSTF2T, also termed tauCstF64, is a paralog of
          the X-linked cleavage stimulation factor CstF64 protein
          that supports polyadenylation in most somatic cells. It
          is expressed during meiosis and subsequent haploid
          differentiation in a more limited set of tissues and
          cell types, largely in meiotic and postmeiotic male
          germ cells, and to a lesser extent in brain. The loss
          of CSTF2T will cause male infertility, as it is
          necessary for spermatogenesis and fertilization.
          Moreover, CSTF2T is required for expression of genes
          involved in morphological differentiation of
          spermatids, as well as for genes having products that
          function during interaction of motile spermatozoa with
          eggs. It promotes germ cell-specific patterns of
          polyadenylation by using its RRM to bind to different
          sequence elements downstream of polyadenylation sites
          than does CstF64. .
          Length = 75

 Score = 27.5 bits (61), Expect = 0.34
 Identities = 9/30 (30%), Positives = 20/30 (66%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          +++ N+PY+ T +++ DIF + G +   R+
Sbjct: 1  VFVGNIPYEATEEQLKDIFSEVGPVVSFRL 30


>gnl|CDD|241178 cd12734, RRM3_hnRNPH_hnRNPH2_hnRNPF, RNA recognition motif 3 in
          heterogeneous nuclear ribonucleoprotein hnRNP H , hnRNP
          H2, hnRNP F and similar proteins.  This subgroup
          corresponds to the RRM3 of hnRNP H (also termed
          mcs94-1), hnRNP H2 (also termed FTP-3 or hnRNP H') and
          hnRNP F, which represent a group of nuclear RNA binding
          proteins that play important roles in the regulation of
          alternative splicing decisions. hnRNP H and hnRNP F are
          two closely related proteins, both of which bind to the
          RNA sequence DGGGD. They are present in a complex with
          the tissue-specific splicing factor Fox2, and regulate
          the alternative splicing of the fibroblast growth
          factor receptor 2 (FGFR2) transcripts. The presence of
          Fox 2 can allows hnRNP H and hnRNP F to better compete
          with the SR protein ASF/SF2 for binding to FGFR2 exon
          IIIc. Thus, hnRNP H and hnRNP F can function as potent
          silencers of FGFR2 exon IIIc inclusion through an
          interaction with the exonic GGG motifs. Furthermore,
          hnRNP H and hnRNP H2 are almost identical; bothe have
          been found to bind nuclear-matrix proteins. hnRNP H
          activates exon inclusion by binding G-rich intronic
          elements downstream of the 5' splice site in the
          transcripts of c-src, human immunodeficiency virus type
          1 (HIV-1), Bcl-X, GRIN1, and myelin. It silences exons
          when bound to exonic elements in the transcripts of
          beta-tropomyosin, HIV-1, and alpha-tropomyosin. hnRNP
          H2 has been implicated in pre-mRNA 3' end formation.
          Members in this family contain three RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains). RRM1 and RRM2 are
          responsible for the binding to the RNA at DGGGD motifs,
          and they play an important role in efficiently
          silencing the exon. In addition, the family members
          have an extensive glycine-rich region near the
          C-terminus, which may allow them to homo- or
          heterodimerize. .
          Length = 76

 Score = 27.3 bits (60), Expect = 0.34
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 3/38 (7%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIR-QIRIGNTPDTR 56
          +++R LPY+ T +++Y+ F     +R  I IG  PD R
Sbjct: 3  VHMRGLPYRATENDIYNFFSPLNPVRVHIEIG--PDGR 38


>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene
          single-strand binding proteins (MSSP) family.  This
          subfamily corresponds to the RRM2 of c-myc gene
          single-strand binding proteins (MSSP) family, including
          single-stranded DNA-binding protein MSSP-1 (also termed
          RBMS1 or SCR2) and MSSP-2 (also termed RBMS2 or SCR3).
          All MSSP family members contain two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), both of which are
          responsible for the specific DNA binding activity.
          Both, MSSP-1 and -2, have been identified as protein
          factors binding to a putative DNA replication
          origin/transcriptional enhancer sequence present
          upstream from the human c-myc gene in both single- and
          double-stranded forms. Thus they have been implied in
          regulating DNA replication, transcription, apoptosis
          induction, and cell-cycle movement, via the interaction
          with C-MYC, the product of protooncogene c-myc.
          Moreover, they family includes a new member termed
          RNA-binding motif, single-stranded-interacting protein
          3 (RBMS3), which is not a transcriptional regulator.
          RBMS3 binds with high affinity to A/U-rich stretches of
          RNA, and to A/T-rich DNA sequences, and functions as a
          regulator of cytoplasmic activity. In addition, a
          putative meiosis-specific RNA-binding protein termed
          sporulation-specific protein 5 (SPO5, or meiotic
          RNA-binding protein 1, or meiotically up-regulated gene
          12 protein), encoded by Schizosaccharomyces pombe
          Spo5/Mug12 gene, is also included in this family. SPO5
          is a novel meiosis I regulator that may function in the
          vicinity of the Mei2 dot. .
          Length = 79

 Score = 27.3 bits (61), Expect = 0.37
 Identities = 10/36 (27%), Positives = 15/36 (41%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDT 55
          LYI NLP  +   ++  +   YG +   RI      
Sbjct: 3  LYISNLPLHMDEQDLETMLKPYGQVISTRILRDSKG 38


>gnl|CDD|240684 cd12238, RRM1_RBM40_like, RNA recognition motif 1 in RNA-binding
          protein 40 (RBM40) and similar proteins.  This
          subfamily corresponds to the RRM1 of RBM40, also known
          as RNA-binding region-containing protein 3 (RNPC3) or
          U11/U12 small nuclear ribonucleoprotein 65 kDa protein
          (U11/U12-65K protein), It serves as a bridging factor
          between the U11 and U12 snRNPs. It contains two repeats
          of RNA recognition motif (RRM), also known as RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain),
          connected by a linker that includes a proline-rich
          region. It binds to the U11-associated 59K protein via
          its RRM1 and employs the RRM2 to bind hairpin III of
          the U12 small nuclear RNA (snRNA). The proline-rich
          region might be involved in protein-protein
          interactions. .
          Length = 73

 Score = 26.8 bits (60), Expect = 0.43
 Identities = 11/50 (22%), Positives = 23/50 (46%), Gaps = 9/50 (18%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTRYLTKSLVMKCMIF 69
          L +R+LP +++ D+  D+   +GA            R +++   +K   F
Sbjct: 2  LLVRHLPPELSEDDKEDLLKHFGAS---------SVRVMSRRGKLKNTAF 42


>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding
          protein 19 (RBM19) and similar proteins.  This subgroup
          corresponds to the RRM1 of RBM19, also termed
          RNA-binding domain-1 (RBD-1), a nucleolar protein
          conserved in eukaryotes. It is involved in ribosome
          biogenesis by processing rRNA. In addition, it is
          essential for preimplantation development. RBM19 has a
          unique domain organization containing 6 conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains). .
          Length = 76

 Score = 26.9 bits (60), Expect = 0.44
 Identities = 11/35 (31%), Positives = 20/35 (57%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPD 54
          L ++NLP  I  D++  +F  +G I  +++  T D
Sbjct: 3  LIVKNLPKGIKEDKLRKLFEAFGTITDVQLKYTKD 37


>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor.  This
           model describes the ELAV/HuD subfamily of splicing
           factors found in metazoa. HuD stands for the human
           paraneoplastic encephalomyelitis antigen D of which
           there are 4 variants in human. ELAV stnds for the
           Drosophila Embryonic lethal abnormal visual protein.
           ELAV-like splicing factors are also known in human as
           HuB (ELAV-like protein 2), HuC (ELAV-like protein 3,
           Paraneoplastic cerebellar degeneration-associated
           antigen) and HuR (ELAV-like protein 1). These genes are
           most closely related to the sex-lethal subfamily of
           splicing factors found in Dipteran insects (TIGR01659).
           These proteins contain 3 RNA-recognition motifs (rrm:
           pfam00076).
          Length = 352

 Score = 28.0 bits (62), Expect = 0.45
 Identities = 12/30 (40%), Positives = 16/30 (53%)

Query: 20  LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
           LY+  LP  +T  E+  IF  +G I   RI
Sbjct: 92  LYVSGLPKTMTQHELESIFSPFGQIITSRI 121


>gnl|CDD|240867 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition motif in
          polypyrimidine tract-binding protein 1 (PTB or hnRNP
          I), heterogeneous nuclear ribonucleoprotein L
          (hnRNP-L), and similar proteins.  This subfamily
          corresponds to the RRM1 of the majority of family
          members that include polypyrimidine tract-binding
          protein 1 (PTB or hnRNP I), polypyrimidine
          tract-binding protein 2 (PTBP2 or nPTB), regulator of
          differentiation 1 (Rod1), heterogeneous nuclear
          ribonucleoprotein L (hnRNP-L), heterogeneous nuclear
          ribonucleoprotein L-like (hnRNP-LL), polypyrimidine
          tract-binding protein homolog 3 (PTBPH3),
          polypyrimidine tract-binding protein homolog 1 and 2
          (PTBPH1 and PTBPH2), and similar proteins. PTB is an
          important negative regulator of alternative splicing in
          mammalian cells and also functions at several other
          aspects of mRNA metabolism, including mRNA
          localization, stabilization, polyadenylation, and
          translation. PTBP2 is highly homologous to PTB and is
          perhaps specific to the vertebrates. Unlike PTB, PTBP2
          is enriched in the brain and in some neural cell lines.
          It binds more stably to the downstream control sequence
          (DCS) RNA than PTB does but is a weaker repressor of
          splicing in vitro. PTBP2 also greatly enhances the
          binding of two other proteins, heterogeneous nuclear
          ribonucleoprotein (hnRNP) H and KH-type
          splicing-regulatory protein (KSRP), to the DCS RNA. The
          binding properties of PTBP2 and its reduced inhibitory
          activity on splicing imply roles in controlling the
          assembly of other splicing-regulatory proteins. Rod1 is
          a mammalian polypyrimidine tract binding protein (PTB)
          homolog of a regulator of differentiation in the
          fission yeast Schizosaccharomyces pombe, where the nrd1
          gene encodes an RNA binding protein negatively
          regulates the onset of differentiation. ROD1 is
          predominantly expressed in hematopoietic cells or
          organs. It might play a role controlling
          differentiation in mammals. hnRNP-L is a higher
          eukaryotic specific subunit of human KMT3a (also known
          as HYPB or hSet2) complex required for histone H3
          Lys-36 trimethylation activity. It plays both, nuclear
          and cytoplasmic, roles in mRNA export of intronless
          genes, IRES-mediated translation, mRNA stability, and
          splicing. hnRNP-LL protein plays a critical and unique
          role in the signal-induced regulation of CD45 and acts
          as a global regulator of alternative splicing in
          activated T cells. The family also includes
          polypyrimidine tract binding protein homolog 3 (PTBPH3)
          found in plant. Although its biological roles remain
          unclear, PTBPH3 shows significant sequence similarity
          to other family members, all of which contain four RNA
          recognition motifs (RRM), also known as RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain).
          Although their biological roles remain unclear, both
          PTBPH1 and PTBPH2 show significant sequence similarity
          to PTB. However, in contrast to PTB, they have three
          RRMs. In addition, this family also includes
          RNA-binding motif protein 20 (RBM20) that is an
          alternative splicing regulator associated with dilated
          cardiomyopathy (DCM) and contains only one RRM. .
          Length = 74

 Score = 26.8 bits (60), Expect = 0.47
 Identities = 8/26 (30%), Positives = 16/26 (61%)

Query: 19 VLYIRNLPYKITGDEMYDIFGKYGAI 44
          VL++RNLP  +T  ++  +   +G +
Sbjct: 1  VLHLRNLPPDVTESDLIALVSPFGKV 26


>gnl|CDD|240794 cd12348, RRM1_SHARP, RNA recognition motif 1 in
          SMART/HDAC1-associated repressor protein (SHARP) and
          similar proteins.  This subfamily corresponds to the
          RRM1 of SHARP, also termed Msx2-interacting protein
          (MINT), or SPEN homolog, an estrogen-inducible
          transcriptional repressor that interacts directly with
          the nuclear receptor corepressor SMRT, histone
          deacetylases (HDACs) and components of the NuRD
          complex. SHARP recruits HDAC activity and binds to the
          steroid receptor RNA coactivator SRA through four
          conserved N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), further suppressing
          SRA-potentiated steroid receptor transcription
          activity. Thus, SHARP has the capacity to modulate both
          liganded and nonliganded nuclear receptors. SHARP also
          has been identified as a component of transcriptional
          repression complexes in Notch/RBP-Jkappa signaling
          pathways. In addition to the N-terminal RRMs, SHARP
          possesses a C-terminal SPOC domain (Spen paralog and
          ortholog C-terminal domain), which is highly conserved
          among Spen proteins.  .
          Length = 75

 Score = 26.6 bits (59), Expect = 0.57
 Identities = 8/30 (26%), Positives = 18/30 (60%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          L++ NLP  +  + + + F +YG +  ++I
Sbjct: 2  LWVGNLPENVREERISEHFKRYGRVESVKI 31


>gnl|CDD|240959 cd12515, RRM5_RBM12_like, RNA recognition motif 5 in RNA-binding
          protein RBM12, RBM12B and similar proteins.  This
          subfamily corresponds to the RRM5 of RBM12 and RBM12B.
          RBM12, also termed SH3/WW domain anchor protein in the
          nucleus (SWAN), is ubiquitously expressed. It contains
          five distinct RNA binding motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), two proline-rich regions, and several
          putative transmembrane domains. RBM12B show high
          sequence semilarity with RBM12. It contains five
          distinct RRMs as well. The biological roles of both
          RBM12 and RBM12B remain unclear. .
          Length = 75

 Score = 26.6 bits (59), Expect = 0.57
 Identities = 9/23 (39%), Positives = 14/23 (60%)

Query: 22 IRNLPYKITGDEMYDIFGKYGAI 44
          ++NLP+  T +E+ D F  Y  I
Sbjct: 5  VQNLPFTATIEEILDFFYGYRVI 27


>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family.  This model
           represents a subfamily of RNA splicing factors including
           the Pad-1 protein (N. crassa), CAPER (M. musculus) and
           CC1.3 (H.sapiens). These proteins are characterized by
           an N-terminal arginine-rich, low complexity domain
           followed by three (or in the case of 4 H. sapiens
           paralogs, two) RNA recognition domains (rrm: pfam00706).
           These splicing factors are closely related to the U2AF
           splicing factor family (TIGR01642). A homologous gene
           from Plasmodium falciparum was identified in the course
           of the analysis of that genome at TIGR and was included
           in the seed.
          Length = 457

 Score = 27.6 bits (61), Expect = 0.58
 Identities = 11/50 (22%), Positives = 22/50 (44%), Gaps = 7/50 (14%)

Query: 7   RANVRLPPEV-------NRVLYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
           R + R   E        +R +++  L  K    ++Y+ F K G +R ++ 
Sbjct: 72  RRSGRNTKEPLTEAERDDRTVFVLQLALKARERDLYEFFSKVGKVRDVQC 121



 Score = 27.2 bits (60), Expect = 0.96
 Identities = 13/36 (36%), Positives = 21/36 (58%)

Query: 20  LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDT 55
           LY+ NL + IT  E+  IF  +G I  +++   P+T
Sbjct: 189 LYVGNLHFNITEQELRQIFEPFGDIEDVQLHRDPET 224


>gnl|CDD|240739 cd12293, RRM_Rrp7p, RNA recognition motif in yeast ribosomal
          RNA-processing protein 7 (Rrp7p) and similar proteins. 
          This subfamily corresponds to the RRM of Rrp7p which is
          encoded by YCL031C gene from Saccharomyces cerevisiae.
          It is an essential yeast protein involved in pre-rRNA
          processing and ribosome assembly, and is speculated to
          be required for correct assembly of rpS27 into the
          pre-ribosomal particle. Rrp7p contains an N-terminal
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain), and
          a C-terminal RRP7 domain. .
          Length = 96

 Score = 27.0 bits (60), Expect = 0.62
 Identities = 10/38 (26%), Positives = 15/38 (39%), Gaps = 1/38 (2%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGK-YGAIRQIRIGNTPD 54
          R L++ NLP   T   +  +FG   G I  +       
Sbjct: 1  RTLFLVNLPVDTTERHLRKLFGSGGGIIESVVFVEELL 38


>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein
          Musashi homolog Musashi-1, Musashi-2 and similar
          proteins.  This subfamily corresponds to the RRM1 in
          Musashi-1 and Musashi-2. Musashi-1 (also termed Msi1)
          is a neural RNA-binding protein putatively expressed in
          central nervous system (CNS) stem cells and neural
          progenitor cells, and associated with asymmetric
          divisions in neural progenitor cells. It is
          evolutionarily conserved from invertebrates to
          vertebrates. Musashi-1 is a homolog of Drosophila
          Musashi and Xenopus laevis nervous system-specific RNP
          protein-1 (Nrp-1). It has been implicated in the
          maintenance of the stem-cell state, differentiation,
          and tumorigenesis. It translationally regulates the
          expression of a mammalian numb gene by binding to the
          3'-untranslated region of mRNA of Numb, encoding a
          membrane-associated inhibitor of Notch signaling, and
          further influences neural development. Moreover,
          Musashi-1 represses translation by interacting with the
          poly(A)-binding protein and competes for binding of the
          eukaryotic initiation factor-4G (eIF-4G). Musashi-2
          (also termed Msi2) has been identified as a regulator
          of the hematopoietic stem cell (HSC) compartment and of
          leukemic stem cells after transplantation of cells with
          loss and gain of function of the gene. It influences
          proliferation and differentiation of HSCs and myeloid
          progenitors, and further modulates normal hematopoiesis
          and promotes aggressive myeloid leukemia. Both,
          Musashi-1 and Musashi-2, contain two conserved
          N-terminal tandem RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), along with other domains
          of unknown function. .
          Length = 75

 Score = 26.6 bits (59), Expect = 0.66
 Identities = 9/37 (24%), Positives = 21/37 (56%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTR 56
          ++I  L ++ T + + + F K+G I++  +   P T+
Sbjct: 1  MFIGGLSWQTTAEGLREYFSKFGEIKECMVMRDPTTK 37


>gnl|CDD|240754 cd12308, RRM1_Spen, RNA recognition motif 1 in the Spen (split
          end) protein family.  This subfamily corresponds to the
          RRM1 domain in the Spen (split end) family which
          includes RNA binding motif protein 15 (RBM15), putative
          RNA binding motif protein 15B (RBM15B), and similar
          proteins found in Metazoa. RBM15, also termed
          one-twenty two protein 1 (OTT1), conserved in
          eukaryotes, is a novel mRNA export factor and component
          of the NXF1 pathway. It binds to NXF1 and serves as
          receptor for the RNA export element RTE. It also
          possesses mRNA export activity and can facilitate the
          access of DEAD-box protein DBP5 to mRNA at the nuclear
          pore complex (NPC). RNA-binding protein 15B (RBM15B),
          also known as one twenty-two 3 (OTT3), is a paralog of
          RBM15 and therefore has post-transcriptional regulatory
          activity. It is a nuclear protein sharing with RBM15
          the association with the splicing factor compartment
          and the nuclear envelope as well as the binding to mRNA
          export factors NXF1 and Aly/REF. Members in this family
          belong- to the Spen (split end) protein family, which
          share a domain architecture comprising of three
          N-terminal RNA recognition motifs (RRMs), also known as
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain), and a C-terminal SPOC (Spen paralog and
          ortholog C-terminal) domain. .
          Length = 79

 Score = 26.5 bits (59), Expect = 0.73
 Identities = 10/41 (24%), Positives = 23/41 (56%), Gaps = 5/41 (12%)

Query: 18 RVLYIRNLPYKITGDE----MYDIFGKYGAIRQIRIGNTPD 54
          + L + NLP K++ ++    +Y  F K+G +  +R+ +  +
Sbjct: 2  KTLCVSNLPSKLSDEDIEDVLYHEFKKFGDVS-VRVLHDGE 41


>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in
          heterogeneous nuclear ribonucleoprotein M (hnRNP M) and
          similar proteins.  This subfamily corresponds to the
          RRM2 of heterogeneous nuclear ribonucleoprotein M
          (hnRNP M), myelin expression factor 2 (MEF-2 or MyEF-2
          or MST156) and similar proteins. hnRNP M is pre-mRNA
          binding protein that may play an important role in the
          pre-mRNA processing. It also preferentially binds to
          poly(G) and poly(U) RNA homopolymers. hnRNP M is able
          to interact with early spliceosomes, further
          influencing splicing patterns of specific pre-mRNAs. It
          functions as the receptor of carcinoembryonic antigen
          (CEA) that contains the penta-peptide sequence PELPK
          signaling motif. In addition, hnRNP M and another
          splicing factor Nova-1 work together as dopamine D2
          receptor (D2R) pre-mRNA-binding proteins. They regulate
          alternative splicing of D2R pre-mRNA in an antagonistic
          manner. hnRNP M contains three RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an unusual
          hexapeptide-repeat region rich in methionine and
          arginine residues (MR repeat motif). MEF-2 is a
          sequence-specific single-stranded DNA (ssDNA) binding
          protein that binds specifically to ssDNA derived from
          the proximal (MB1) element of the myelin basic protein
          (MBP) promoter and represses transcription of the MBP
          gene. MEF-2 shows high sequence homology with hnRNP M.
          It also contains three RRMs, which may be responsible
          for its ssDNA binding activity. .
          Length = 74

 Score = 26.6 bits (59), Expect = 0.75
 Identities = 6/25 (24%), Positives = 15/25 (60%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAI 44
          +++ NL YK+   ++ ++F   G +
Sbjct: 1  IFVANLDYKVGWKKLKEVFKLAGKV 25


>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate
          Hu-antigen D (HuD).  This subgroup corresponds to the
          RRM2 of HuD, also termed ELAV-like protein 4 (ELAV-4),
          or paraneoplastic encephalomyelitis antigen HuD, one of
          the neuronal members of the Hu family. The neuronal Hu
          proteins play important roles in neuronal
          differentiation, plasticity and memory. HuD has been
          implicated in various aspects of neuronal function,
          such as the commitment and differentiation of neuronal
          precursors as well as synaptic remodeling in mature
          neurons. HuD also functions as an important regulator
          of mRNA expression in neurons by interacting with
          AU-rich RNA element (ARE) and stabilizing multiple
          transcripts. Moreover, HuD regulates the nuclear
          processing/stability of N-myc pre-mRNA in neuroblastoma
          cells and also regulates the neurite elongation and
          morphological differentiation. HuD specifically binds
          poly(A) RNA. Like other Hu proteins, HuD contains three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an ARE. RRM3
          may help to maintain the stability of the RNA-protein
          complex, and might also bind to poly(A) tails or be
          involved in protein-protein interactions. .
          Length = 81

 Score = 26.6 bits (58), Expect = 0.75
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          LY+  LP  +T  E+  +F +YG I   RI
Sbjct: 5  LYVSGLPKTMTQKELEQLFSQYGRIITSRI 34


>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins
          family.  This subfamily corresponds to the RRM3 of the
          Hu proteins family which represent a group of
          RNA-binding proteins involved in diverse biological
          processes. Since the Hu proteins share high homology
          with the Drosophila embryonic lethal abnormal vision
          (ELAV) protein, the Hu family is sometimes referred to
          as the ELAV family. Drosophila ELAV is exclusively
          expressed in neurons and is required for the correct
          differentiation and survival of neurons in flies. The
          neuronal members of the Hu family include Hu-antigen B
          (HuB or ELAV-2 or Hel-N1), Hu-antigen C (HuC or ELAV-3
          or PLE21), and Hu-antigen D (HuD or ELAV-4), which play
          important roles in neuronal differentiation, plasticity
          and memory. HuB is also expressed in gonads. Hu-antigen
          R (HuR or ELAV-1 or HuA) is the ubiquitously expressed
          Hu family member. It has a variety of biological
          functions mostly related to the regulation of cellular
          response to DNA damage and other types of stress. Hu
          proteins perform their cytoplasmic and nuclear
          molecular functions by coordinately regulating
          functionally related mRNAs. In the cytoplasm, Hu
          proteins recognize and bind to AU-rich RNA elements
          (AREs) in the 3' untranslated regions (UTRs) of certain
          target mRNAs, such as GAP-43, vascular epithelial
          growth factor (VEGF), the glucose transporter GLUT1,
          eotaxin and c-fos, and stabilize those ARE-containing
          mRNAs. They also bind and regulate the translation of
          some target mRNAs, such as neurofilament M, GLUT1, and
          p27. In the nucleus, Hu proteins function as regulators
          of polyadenylation and alternative splicing. Each Hu
          protein contains three RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). RRM1 and RRM2 may
          cooperate in binding to an ARE. RRM3 may help to
          maintain the stability of the RNA-protein complex, and
          might also bind to poly(A) tails or be involved in
          protein-protein interactions. .
          Length = 78

 Score = 26.5 bits (59), Expect = 0.75
 Identities = 6/30 (20%), Positives = 17/30 (56%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          +++ NLP       ++ +F  +GA+  +++
Sbjct: 4  IFVYNLPPDADESLLWQLFSPFGAVTNVKV 33


>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate
          Hu-antigen C (HuC).  This subgroup corresponds to the
          RRM2 of HuC, also termed ELAV-like protein 3 (ELAV-3),
          or paraneoplastic cerebellar degeneration-associated
          antigen, or paraneoplastic limbic encephalitis antigen
          21 (PLE21), one of the neuronal members of the Hu
          family. The neuronal Hu proteins play important roles
          in neuronal differentiation, plasticity and memory.
          Like other Hu proteins, HuC contains three RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an AU-rich
          RNA element (ARE). The AU-rich element binding of HuC
          can be inhibited by flavonoids. RRM3 may help to
          maintain the stability of the RNA-protein complex, and
          might also bind to poly(A) tails or be involved in
          protein-protein interactions. .
          Length = 81

 Score = 26.5 bits (58), Expect = 0.77
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          LY+  LP  ++  EM  +F +YG I   RI
Sbjct: 4  LYVSGLPKTMSQKEMEQLFSQYGRIITSRI 33


>gnl|CDD|241012 cd12568, RRM3_MRD1, RNA recognition motif 3 in yeast multiple
          RNA-binding domain-containing protein 1 (MRD1) and
          similar proteins.  This subgroup corresponds to the
          RRM3 of MRD1 which is encoded by a novel yeast gene
          MRD1 (multiple RNA-binding domain). It is
          well-conserved in yeast and its homologs exist in all
          eukaryotes. MRD1 is present in the nucleolus and the
          nucleoplasm. It interacts with the 35 S precursor rRNA
          (pre-rRNA) and U3 small nucleolar RNAs (snoRNAs). MRD1
          is essential for the initial processing at the A0-A2
          cleavage sites in the 35 S pre-rRNA. It contains 5
          conserved RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), which may play an important structural role
          in organizing specific rRNA processing events. .
          Length = 72

 Score = 26.2 bits (58), Expect = 0.84
 Identities = 8/31 (25%), Positives = 19/31 (61%)

Query: 19 VLYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
           + ++N PY  T +E+ D+F  +G + ++ +
Sbjct: 2  TILVKNFPYGTTAEELRDLFEPHGKLTRVLM 32


>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related
          protein 7 (LARP7) and similar proteins.  This subfamily
          corresponds to the RRM1 of LARP7, also termed La
          ribonucleoprotein domain family member 7, or
          P-TEFb-interaction protein for 7SK stability (PIP7S),
          an oligopyrimidine-binding protein that binds to the
          highly conserved 3'-terminal U-rich stretch (3'
          -UUU-OH) of 7SK RNA. LARP7 is a stable component of the
          7SK small nuclear ribonucleoprotein (7SK snRNP). It
          intimately associates with all the nuclear 7SK and is
          required for 7SK stability. LARP7 also acts as a
          negative transcriptional regulator of cellular and
          viral polymerase II genes, acting by means of the 7SK
          snRNP system. It plays an essential role in the
          inhibition of positive transcription elongation factor
          b (P-TEFb)-dependent transcription, which has been
          linked to the global control of cell growth and
          tumorigenesis. LARP7 contains a La motif (LAM) and an
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain), at
          the N-terminal region, which mediates binding to the
          U-rich 3' terminus of 7SK RNA. LARP7 also carries
          another putative RRM domain at its C-terminus. .
          Length = 80

 Score = 26.2 bits (58), Expect = 0.85
 Identities = 9/37 (24%), Positives = 17/37 (45%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTR 56
          +Y+  LP   T + +  +F KYG +  + +     T 
Sbjct: 2  VYVECLPKNATHEWLKAVFSKYGTVVYVSLPRYKHTG 38


>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate
          Hu-antigen B (HuB).  This subgroup corresponds to the
          RRM2 of HuB, also termed ELAV-like protein 2 (ELAV-2),
          or ELAV-like neuronal protein 1, or nervous
          system-specific RNA-binding protein Hel-N1 (Hel-N1),
          one of the neuronal members of the Hu family. The
          neuronal Hu proteins play important roles in neuronal
          differentiation, plasticity and memory. HuB is also
          expressed in gonads. It is up-regulated during neuronal
          differentiation of embryonic carcinoma P19 cells. Like
          other Hu proteins, HuB contains three RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains). RRM1 and RRM2 may
          cooperate in binding to an AU-rich RNA element (ARE).
          RRM3 may help to maintain the stability of the
          RNA-protein complex, and might also bind to poly(A)
          tails or be involved in protein-protein interactions. .
          Length = 90

 Score = 26.7 bits (58), Expect = 0.89
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          LY+  LP  +T  E+  +F +YG I   RI
Sbjct: 8  LYVSGLPKTMTQKELEQLFSQYGRIITSRI 37


>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein
          PTB-binding raver-1, raver-2 and similar proteins.
          This subfamily corresponds to the RRM2 of raver-1 and
          raver-2. Raver-1 is a ubiquitously expressed
          heterogeneous nuclear ribonucleoprotein (hnRNP) that
          serves as a co-repressor of the nucleoplasmic splicing
          repressor polypyrimidine tract-binding protein
          (PTB)-directed splicing of select mRNAs. It shuttles
          between the cytoplasm and the nucleus and can
          accumulate in the perinucleolar compartment, a dynamic
          nuclear substructure that harbors PTB. Raver-1 also
          modulates focal adhesion assembly by binding to the
          cytoskeletal proteins, including alpha-actinin,
          vinculin, and metavinculin (an alternatively spliced
          isoform of vinculin) at adhesion complexes,
          particularly in differentiated muscle tissue. Raver-2
          is a novel member of the heterogeneous nuclear
          ribonucleoprotein (hnRNP) family. It shows high
          sequence homology to raver-1. Raver-2 exerts a
          spatio-temporal expression pattern during embryogenesis
          and is mainly limited to differentiated neurons and
          glia cells. Although it displays nucleo-cytoplasmic
          shuttling in heterokaryons, raver2 localizes to the
          nucleus in glia cells and neurons. Raver-2 can interact
          with PTB and may participate in PTB-mediated
          RNA-processing. However, there is no evidence
          indicating that raver-2 can bind to cytoplasmic
          proteins. Both, raver-1 and raver-2, contain three
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), two putative nuclear localization signals
          (NLS) at the N- and C-termini, a central leucine-rich
          region, and a C-terminal region harboring two
          [SG][IL]LGxxP motifs. They binds to RNA through the
          RRMs. In addition, the two [SG][IL]LGxxP motifs serve
          as the PTB-binding motifs in raver1. However, raver-2
          interacts with PTB through the SLLGEPP motif only. .
          Length = 77

 Score = 26.1 bits (58), Expect = 0.90
 Identities = 7/27 (25%), Positives = 16/27 (59%)

Query: 19 VLYIRNLPYKITGDEMYDIFGKYGAIR 45
          +L + NLP + T ++  ++   +GA+ 
Sbjct: 1  LLCVGNLPLEFTDEQFRELVSPFGAVE 27


>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12
          small nuclear ribonucleoprotein 35 kDa protein
          (U11/U12-35K) and similar proteins.  This subfamily
          corresponds to the RRM of U11/U12-35K, also termed
          protein HM-1, or U1 snRNP-binding protein homolog, and
          is one of the components of the U11/U12 snRNP, which is
          a subunit of the minor (U12-dependent) spliceosome
          required for splicing U12-type nuclear pre-mRNA
          introns. U11/U12-35K is highly conserved among
          bilateria and plants, but lacks in some organisms, such
          as Saccharomyces cerevisiae and Caenorhabditis elegans.
          Moreover, U11/U12-35K shows significant sequence
          homology to U1 snRNP-specific 70 kDa protein (U1-70K or
          snRNP70). It contains a conserved RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), followed by an adjacent
          glycine-rich region, and Arg-Asp and Arg-Glu dipeptide
          repeats rich domain, making U11/U12-35K a possible
          functional analog of U1-70K. It may facilitate 5'
          splice site recognition in the minor spliceosome and
          play a role in exon bridging, interacting with
          components of the major spliceosome bound to the
          pyrimidine tract of an upstream U2-type intron. The
          family corresponds to the RRM of U11/U12-35K that may
          directly contact the U11 or U12 snRNA through the RRM
          domain.
          Length = 93

 Score = 26.5 bits (59), Expect = 0.91
 Identities = 9/33 (27%), Positives = 20/33 (60%)

Query: 17 NRVLYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
             L++  L  + T + + ++F +YG IR++R+
Sbjct: 3  YLTLFVGRLSLQTTEETLREVFSRYGDIRRLRL 35


>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate
          heterogeneous nuclear ribonucleoprotein Q (hnRNP Q).
          This subgroup corresponds to the RRM3 of hnRNP Q, also
          termed glycine- and tyrosine-rich RNA-binding protein
          (GRY-RBP), or NS1-associated protein 1 (NASP1), or
          synaptotagmin-binding, cytoplasmic RNA-interacting
          protein (SYNCRIP). It is a ubiquitously expressed
          nuclear RNA-binding protein identified as a component
          of the spliceosome complex, as well as a component of
          the apobec-1 editosome. As an alternatively spliced
          version of NSAP, it acts as an interaction partner of a
          multifunctional protein required for viral replication,
          and is implicated in the regulation of specific mRNA
          transport. hnRNP Q has also been identified as SYNCRIP
          that is a dual functional protein participating in both
          viral RNA replication and translation. As a
          synaptotagmin-binding protein, hnRNP Q plays a putative
          role in organelle-based mRNA transport along the
          cytoskeleton. Moreover, hnRNP Q has been found in
          protein complexes involved in translationally coupled
          mRNA turnover and mRNA splicing. It functions as a
          wild-type survival motor neuron (SMN)-binding protein
          that may participate in pre-mRNA splicing and modulate
          mRNA transport along microtubuli. hnRNP Q contains an
          acidic auxiliary N-terminal region, followed by two
          well defined and one degenerated RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a C-terminal RGG
          motif; hnRNP Q binds RNA through its RRM domains. .
          Length = 72

 Score = 26.1 bits (57), Expect = 0.92
 Identities = 9/31 (29%), Positives = 21/31 (67%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAIRQIR 48
          +VL++RNL   +T + +   FG++G + +++
Sbjct: 2  KVLFVRNLANTVTEEILEKAFGQFGKLERVK 32


>gnl|CDD|241134 cd12690, RRM3_PTBPH1_PTBPH2, RNA recognition motif 3 in plant
          polypyrimidine tract-binding protein homolog 1 and 2
          (PTBPH1 and PTBPH2).  This subfamily corresponds to the
          RRM3 of PTBPH1 and PTBPH2. Although their biological
          roles remain unclear, PTBPH1 and PTBPH2 show
          significant sequence similarity to polypyrimidine tract
          binding protein (PTB) that is an important negative
          regulator of alternative splicing in mammalian cells
          and also functions at several other aspects of mRNA
          metabolism, including mRNA localization, stabilization,
          polyadenylation, and translation. Both, PTBPH1 and
          PTBPH2, contain three RNA recognition motifs (RRM),
          also known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain). .
          Length = 97

 Score = 26.4 bits (58), Expect = 0.95
 Identities = 9/28 (32%), Positives = 18/28 (64%)

Query: 22 IRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          I N+ Y +T D ++ +F  +G +++I I
Sbjct: 8  IENMQYAVTVDVLHTVFSAFGFVQKIAI 35


>gnl|CDD|240963 cd12519, RRM1_SREK1, RNA recognition motif 1 in splicing
          regulatory glutamine/lysine-rich protein 1 (SREK1) and
          similar proteins.  This subgroup corresponds to the
          RRM1 of SREK1, also termed
          serine/arginine-rich-splicing regulatory protein 86-kDa
          (SRrp86), or splicing factor arginine/serine-rich 12
          (SFRS12), or splicing regulatory protein 508 amino acid
          (SRrp508). SREK1 belongs to a family of proteins
          containing regions rich in serine-arginine dipeptides
          (SR proteins family), and is involved in bridge-complex
          formation and splicing by mediating protein-protein
          interactions across either introns or exons. It is a
          unique SR family member and may play a crucial role in
          determining tissue specific patterns of alternative
          splicing. SREK1 can alter splice site selection by both
          positively and negatively modulating the activity of
          other SR proteins. For instance, SREK1 can activate
          SRp20 and repress SC35 in a dose-dependent manner both
          in vitro and in vivo. In addition, SREK1 generally
          contains two RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), and two serine-arginine (SR)-rich domains (SR
          domains) separated by an unusual glutamic acid-lysine
          (EK) rich region. The RRM and SR domains are highly
          conserved among other members of the SR superfamily.
          However, the EK domain is unique to SREK1; plays a
          modulatory role controlling SR domain function by
          involvement in the inhibition of both constitutive and
          alternative splicing and in the selection of
          splice-site. .
          Length = 80

 Score = 26.1 bits (57), Expect = 1.0
 Identities = 11/31 (35%), Positives = 19/31 (61%)

Query: 19 VLYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          V+ + NL   +T D+M  +FG  G I ++R+
Sbjct: 1  VIQVTNLSAAVTSDQMRTLFGFLGDIEELRL 31


>gnl|CDD|241107 cd12663, RRM1_RAVER1, RNA recognition motif 1 in vertebrate
          ribonucleoprotein PTB-binding 1 (raver-1).  This
          subgroup corresponds to the RRM1 of raver-1, a
          ubiquitously expressed heterogeneous nuclear
          ribonucleoprotein (hnRNP) that serves as a co-repressor
          of the nucleoplasmic splicing repressor polypyrimidine
          tract-binding protein (PTB)-directed splicing of select
          mRNAs. It shuttles between the cytoplasm and the
          nucleus and can accumulate in the perinucleolar
          compartment, a dynamic nuclear substructure that
          harbors PTB. Raver-1 also modulates focal adhesion
          assembly by binding to the cytoskeletal proteins,
          including alpha-actinin, vinculin, and metavinculin (an
          alternatively spliced isoform of vinculin) at adhesion
          complexes, particularly in differentiated muscle
          tissue. Raver-1 contains three N-terminal RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          two putative nuclear localization signals (NLS) at the
          N- and C-termini, a central leucine-rich region, and a
          C-terminal region harboring two PTB-binding
          [SG][IL]LGxxP motifs. Raver1 binds to PTB through the
          PTB-binding motifs at its C-terminal half, and binds to
          other partners, such as RNA having the sequence
          UCAUGCAGUCUG, through its N-terminal RRMs.
          Interestingly, the 12-nucleotide RNA having the
          sequence UCAUGCAGUCUG with micromolar affinity is found
          in vinculin mRNA. Additional research indicates that
          the RRM1 of raver-1 directs its interaction with the
          tail domain of activated vinculin. Then the
          raver1/vinculin tail (Vt) complex binds to vinculin
          mRNA, which is permissive for vinculin binding to
          F-actin. .
          Length = 71

 Score = 26.0 bits (57), Expect = 1.0
 Identities = 9/24 (37%), Positives = 15/24 (62%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKY 41
          R + I+ LP  I+  E++D+ G Y
Sbjct: 1  RKILIKGLPADISNQEVHDLLGDY 24


>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP
          Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6
          and similar proteins.  This subgroup corresponds to the
          RRM2 of CELF-3, CELF-4, CELF-5, and CELF-6, all of
          which belong to the CUGBP1 and ETR-3-like factors
          (CELF) or BRUNOL (Bruno-like) family of RNA-binding
          proteins that display dual nuclear and cytoplasmic
          localizations and have been implicated in the
          regulation of pre-mRNA splicing and in the control of
          mRNA translation and deadenylation. CELF-3, expressed
          in brain and testis only, is also known as bruno-like
          protein 1 (BRUNOL-1), or CAG repeat protein 4, or
          CUG-BP- and ETR-3-like factor 3, or embryonic lethal
          abnormal vision (ELAV)-type RNA-binding protein 1
          (ETR-1), or expanded repeat domain protein CAG/CTG 4,
          or trinucleotide repeat-containing gene 4 protein
          (TNRC4). It plays an important role in the pathogenesis
          of tauopathies. CELF-3 contains three highly conserved
          RNA recognition motifs (RRMs), also known as RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains):
          two consecutive RRMs (RRM1 and RRM2) situated in the
          N-terminal region followed by a linker region and the
          third RRM (RRM3) close to the C-terminus of the
          protein. The effect of CELF-3 on tau splicing is
          mediated mainly by the RNA-binding activity of RRM2.
          The divergent linker region might mediate the
          interaction of CELF-3 with other proteins regulating
          its activity or involved in target recognition. CELF-4,
          being highly expressed throughout the brain and in
          glandular tissues, moderately expressed in heart,
          skeletal muscle, and liver, is also known as bruno-like
          protein 4 (BRUNOL-4), or CUG-BP- and ETR-3-like factor
          4. Like CELF-3, CELF-4 also contain three highly
          conserved RRMs. The splicing activation or repression
          activity of CELF-4 on some specific substrates is
          mediated by its RRM1/RRM2. On the other hand, both RRM1
          and RRM2 of CELF-4 can activate cardiac troponin T
          (cTNT) exon 5 inclusion. CELF-5, expressed in brain, is
          also known as bruno-like protein 5 (BRUNOL-5), or
          CUG-BP- and ETR-3-like factor 5. Although its
          biological role remains unclear, CELF-5 shares same
          domain architecture with CELF-3. CELF-6, being strongly
          expressed in kidney, brain, and testis, is also known
          as bruno-like protein 6 (BRUNOL-6), or CUG-BP- and
          ETR-3-like factor 6. It activates exon inclusion of a
          cardiac troponin T minigene in transient transfection
          assays in a muscle-specific splicing enhancer
          (MSE)-dependent manner and can activate inclusion via
          multiple copies of a single element, MSE2. CELF-6 also
          promotes skipping of exon 11 of insulin receptor, a
          known target of CELF activity that is expressed in
          kidney. In addition to three highly conserved RRMs,
          CELF-6 also possesses numerous potential
          phosphorylation sites, a potential nuclear localization
          signal (NLS) at the C terminus, and an alanine-rich
          region within the divergent linker region. .
          Length = 81

 Score = 26.2 bits (58), Expect = 1.1
 Identities = 11/38 (28%), Positives = 20/38 (52%)

Query: 17 NRVLYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPD 54
          +R L++  L  + T D++  +F  +G I +  I   PD
Sbjct: 1  DRKLFVGMLSKQQTEDDVRRLFEPFGTIEECTILRGPD 38


>gnl|CDD|240721 cd12275, RRM1_MEI2_EAR1_like, RNA recognition motif 1 in
          Mei2-like proteins and terminal EAR1-like proteins.
          This subfamily corresponds to the RRM1 of Mei2-like
          proteins from plant and fungi, terminal EAR1-like
          proteins from plant, and other eukaryotic homologs.
          Mei2-like proteins represent an ancient eukaryotic
          RNA-binding protein family whose corresponding
          Mei2-like genes appear to have arisen early in
          eukaryote evolution, been lost from some lineages such
          as Saccharomyces cerevisiae and metazoans, and
          diversified in the plant lineage. The plant Mei2-like
          genes may function in cell fate specification during
          development, rather than as stimulators of meiosis. In
          the fission yeast Schizosaccharomyces pombe, the Mei2
          protein is an essential component of the switch from
          mitotic to meiotic growth. S. pombe Mei2 stimulates
          meiosis in the nucleus upon binding a specific
          non-coding RNA. The terminal EAR1-like protein 1 and 2
          (TEL1 and TEL2) are mainly found in land plants. They
          may play a role in the regulation of leaf initiation.
          All members in this family are putative RNA-binding
          proteins carrying three RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). In addition to the RRMs,
          the terminal EAR1-like proteins also contain TEL
          characteristic motifs that allow sequence and putative
          functional discrimination between them and Mei2-like
          proteins. .
          Length = 71

 Score = 26.0 bits (57), Expect = 1.1
 Identities = 9/30 (30%), Positives = 17/30 (56%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAIRQI 47
          R L++ N+P  +T   +  +F  YG +R +
Sbjct: 2  RSLFVINVPRDVTESTLRRLFEVYGDVRGV 31


>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein
          with serine-rich domain 1 (RNPS1) and similar proteins.
           This subfamily corresponds to the RRM of RNPS1 and its
          eukaryotic homologs. RNPS1, also termed RNA-binding
          protein prevalent during the S phase, or SR-related
          protein LDC2, was originally characterized as a general
          pre-mRNA splicing activator, which activates both
          constitutive and alternative splicing of pre-mRNA in
          vitro.It has been identified as a protein component of
          the splicing-dependent mRNP complex, or exon-exon
          junction complex (EJC), and is directly involved in
          mRNA surveillance. Furthermore, RNPS1 is a splicing
          regulator whose activator function is controlled in
          part by CK2 (casein kinase II) protein kinase
          phosphorylation. It can also function as a
          squamous-cell carcinoma antigen recognized by T cells-3
          (SART3)-binding protein, and is involved in the
          regulation of mRNA splicing. RNPS1 contains an
          N-terminal serine-rich (S) domain, a central RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), and the
          C-terminal arginine/serine/proline-rich (RS/P) domain.
          .
          Length = 73

 Score = 26.0 bits (58), Expect = 1.1
 Identities = 7/28 (25%), Positives = 15/28 (53%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQI 47
          L++  L   +  D + +IF  YG ++ +
Sbjct: 1  LHVGKLTRNVNKDHLKEIFSNYGTVKDV 28


>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein
          RBM8A, RBM8B nd similar proteins.  This subfamily
          corresponds to the RRM of RBM8, also termed binder of
          OVCA1-1 (BOV-1), or RNA-binding protein Y14, which is
          one of the components of the exon-exon junction complex
          (EJC). It has two isoforms, RBM8A and RBM8B, both of
          which are identical except that RBM8B is 16 amino acids
          shorter at its N-terminus. RBM8, together with other
          EJC components (such as Magoh, Aly/REF, RNPS1, Srm160,
          and Upf3), plays critical roles in postsplicing
          processing, including nuclear export and cytoplasmic
          localization of the mRNA, and the nonsense-mediated
          mRNA decay (NMD) surveillance process. RBM8 binds to
          mRNA 20-24 nucleotides upstream of a spliced exon-exon
          junction. It is also involved in spliced mRNA nuclear
          export, and the process of nonsense-mediated decay of
          mRNAs with premature stop codons. RBM8 forms a specific
          heterodimer complex with the EJC protein Magoh which
          then associates with Aly/REF, RNPS1, DEK, and SRm160 on
          the spliced mRNA, and inhibits ATP turnover by
          eIF4AIII, thereby trapping the EJC core onto RNA. RBM8
          contains an N-terminal putative bipartite nuclear
          localization signal, one RNA recognition motif (RRM),
          also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), in the central region, and
          a C-terminal serine-arginine rich region (SR domain)
          and glycine-arginine rich region (RG domain). .
          Length = 88

 Score = 26.0 bits (58), Expect = 1.1
 Identities = 4/29 (13%), Positives = 18/29 (62%)

Query: 19 VLYIRNLPYKITGDEMYDIFGKYGAIRQI 47
          ++++  +  +   ++++D F ++G I+ +
Sbjct: 8  IIFVTGVHEEAQEEDVHDKFAEFGEIKNL 36


>gnl|CDD|205005 pfam12668, DUF3791, Protein of unknown function (DUF3791).  This
          family of proteins is functionally uncharacterized.
          This family of proteins is found in bacteria. Proteins
          in this family are typically between 71 and 125 amino
          acids in length.
          Length = 62

 Score = 25.6 bits (57), Expect = 1.1
 Identities = 9/21 (42%), Positives = 12/21 (57%)

Query: 27 YKITGDEMYDIFGKYGAIRQI 47
            I+G E Y++  KYG I  I
Sbjct: 15 LGISGKEAYNLLKKYGVIDYI 35


>gnl|CDD|240765 cd12319, RRM4_MRD1, RNA recognition motif 4 in yeast multiple
          RNA-binding domain-containing protein 1 (MRD1) and
          similar proteins.  This subfamily corresponds to the
          RRM4 of MRD1which is encoded by a novel yeast gene MRD1
          (multiple RNA-binding domain). It is well-conserved in
          yeast and its homologs exist in all eukaryotes. MRD1 is
          present in the nucleolus and the nucleoplasm. It
          interacts with the 35 S precursor rRNA (pre-rRNA) and
          U3 small nucleolar RNAs (snoRNAs). MRD1 is essential
          for the initial processing at the A0-A2 cleavage sites
          in the 35 S pre-rRNA. It contains 5 conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          which may play an important structural role in
          organizing specific rRNA processing events. .
          Length = 84

 Score = 26.0 bits (57), Expect = 1.2
 Identities = 11/45 (24%), Positives = 20/45 (44%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTRYLTKSLVM 64
          L+++NL +  T   + D F         R+   PD +   ++L M
Sbjct: 3  LFVKNLNFSTTNQHLTDAFKHLDGFVFARVKTKPDPKRPGQTLSM 47


>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in
          CELF/Bruno-like family of RNA binding proteins and
          plant flowering time control protein FCA.  This
          subfamily corresponds to the RRM1 and RRM2 domains of
          the CUGBP1 and ETR-3-like factors (CELF) as well as
          plant flowering time control protein FCA. CELF, also
          termed BRUNOL (Bruno-like) proteins, is a family of
          structurally related RNA-binding proteins involved in
          regulation of pre-mRNA splicing in the nucleus, and
          control of mRNA translation and deadenylation in the
          cytoplasm. The family contains six members: CELF-1
          (also known as BRUNOL-2, CUG-BP1, NAPOR, EDEN-BP),
          CELF-2 (also known as BRUNOL-3, ETR-3, CUG-BP2,
          NAPOR-2), CELF-3 (also known as BRUNOL-1, TNRC4, ETR-1,
          CAGH4, ER DA4), CELF-4 (BRUNOL-4), CELF-5 (BRUNOL-5)
          and CELF-6 (BRUNOL-6). They all contain three highly
          conserved RNA recognition motifs (RRMs), also known as
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains): two consecutive RRMs (RRM1 and RRM2) situated
          in the N-terminal region followed by a linker region
          and the third RRM (RRM3) close to the C-terminus of the
          protein. The low sequence conservation of the linker
          region is highly suggestive of a large variety in the
          co-factors that associate with the various CELF family
          members. Based on both, sequence similarity and
          function, the CELF family can be divided into two
          subfamilies, the first containing CELFs 1 and 2, and
          the second containing CELFs 3, 4, 5, and 6. The
          different CELF proteins may act through different sites
          on at least some substrates. Furthermore, CELF proteins
          may interact with each other in varying combinations to
          influence alternative splicing in different contexts.
          This subfamily also includes plant flowering time
          control protein FCA that functions in the
          posttranscriptional regulation of transcripts involved
          in the flowering process. FCA contains two RRMs, and a
          WW protein interaction domain.  .
          Length = 77

 Score = 26.0 bits (58), Expect = 1.3
 Identities = 9/30 (30%), Positives = 18/30 (60%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          L++  LP   T +++  +F +YG I ++ I
Sbjct: 2  LFVGQLPKTATEEDVRALFEEYGNIEEVTI 31


>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like
          family of RNA binding proteins CELF1, CELF2, CELF3,
          CELF4, CELF5, CELF6 and similar proteins.  This
          subgroup corresponds to the RRM3 of the CUGBP1 and
          ETR-3-like factors (CELF) or BRUNOL (Bruno-like)
          proteins, a family of structurally related RNA-binding
          proteins involved in the regulation of pre-mRNA
          splicing in the nucleus and in the control of mRNA
          translation and deadenylation in the cytoplasm. The
          family contains six members: CELF-1 (also termed
          BRUNOL-2, or CUG-BP1, or NAPOR, or EDEN-BP), CELF-2
          (also termed BRUNOL-3, or ETR-3, or CUG-BP2, or
          NAPOR-2), CELF-3 (also termed BRUNOL-1, or TNRC4, or
          ETR-1, or CAGH4, or ER DA4), CELF-4 (also termed
          BRUNOL-4), CELF-5 (also termed BRUNOL-5), CELF-6 (also
          termed BRUNOL-6). They all contain three highly
          conserved RNA recognition motifs (RRMs), also known as
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains): two consecutive RRMs (RRM1 and RRM2) situated
          in the N-terminal region followed by a linker region
          and the third RRM (RRM3) close to the C-terminus of the
          protein. The low sequence conservation of the linker
          region is highly suggestive of a large variety in the
          co-factors that associate with the various CELF family
          members. Based on both sequence similarity and
          function, the CELF family can be divided into two
          subfamilies, the first containing CELFs 1 and 2, and
          the second containing CELFs 3, 4, 5, and 6. The
          different CELF proteins may act through different sites
          on at least some substrates. Furthermore, CELF proteins
          may interact with each other in varying combinations to
          influence alternative splicing in different contexts. .
          Length = 73

 Score = 25.7 bits (57), Expect = 1.4
 Identities = 8/30 (26%), Positives = 18/30 (60%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          L+I +LP + T  ++Y +F  +G +   ++
Sbjct: 1  LFIYHLPNEFTDQDLYQLFAPFGNVISAKV 30


>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in
          RRM-containing coactivator activator/modulator (CoAA)
          and similar proteins.  This subfamily corresponds to
          the RRM in CoAA (also known as RBM14 or PSP2) and
          RNA-binding protein 4 (RBM4). CoAA is a heterogeneous
          nuclear ribonucleoprotein (hnRNP)-like protein
          identified as a nuclear receptor coactivator. It
          mediates transcriptional coactivation and RNA splicing
          effects in a promoter-preferential manner, and is
          enhanced by thyroid hormone receptor-binding protein
          (TRBP). CoAA contains two N-terminal RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and a
          TRBP-interacting domain. RBM4 is a ubiquitously
          expressed splicing factor with two isoforms, RBM4A
          (also known as Lark homolog) and RBM4B (also known as
          RBM30), which are very similar in structure and
          sequence. RBM4 may also function as a translational
          regulator of stress-associated mRNAs as well as play a
          role in micro-RNA-mediated gene regulation. RBM4
          contains two N-terminal RRMs, a CCHC-type zinc finger,
          and three alanine-rich regions within their C-terminal
          regions. This family also includes Drosophila
          RNA-binding protein lark (Dlark), a homolog of human
          RBM4. It plays an important role in embryonic
          development and in the circadian regulation of adult
          eclosion. Dlark shares high sequence similarity with
          RBM4 at the N-terminal region. However, Dlark has three
          proline-rich segments instead of three alanine-rich
          segments within the C-terminal region. .
          Length = 66

 Score = 25.7 bits (57), Expect = 1.4
 Identities = 10/25 (40%), Positives = 16/25 (64%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAI 44
          L++ NLP   T +E+  +F KYG +
Sbjct: 2  LFVGNLPDATTSEELRALFEKYGTV 26


>gnl|CDD|240873 cd12427, RRM4_hnRNPL_like, RNA recognition motif 4 in
          heterogeneous nuclear ribonucleoprotein L (hnRNP-L) and
          similar proteins.  This subfamily corresponds to the
          RRM4 of heterogeneous nuclear ribonucleoprotein L
          (hnRNP-L), heterogeneous nuclear ribonucleoprotein
          L-like (hnRNP-LL), and similar proteins. hnRNP-L is a
          higher eukaryotic specific subunit of human KMT3a (also
          known as HYPB or hSet2) complex required for histone H3
          Lys-36 trimethylation activity. It plays both, nuclear
          and cytoplasmic, roles in mRNA export of intronless
          genes, IRES-mediated translation, mRNA stability, and
          splicing. hnRNP-LL plays a critical and unique role in
          the signal-induced regulation of CD45 and acts as a
          global regulator of alternative splicing in activated T
          cells. It is closely related in domain structure and
          sequence to hnRNP-L, which contains three
          RNA-recognition motifs (RRMs), also known as RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain). .
          Length = 84

 Score = 25.7 bits (57), Expect = 1.4
 Identities = 9/33 (27%), Positives = 19/33 (57%)

Query: 17 NRVLYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          ++VL+  N P   T +++ ++F + GA    +I
Sbjct: 2  SKVLHFFNAPPTFTEEDLRELFAEKGAPPPSKI 34


>gnl|CDD|241141 cd12697, RRM3_ROD1, RNA recognition motif 3 in vertebrate
          regulator of differentiation 1 (Rod1).  This subgroup
          corresponds to the RRM3 of ROD1 coding protein Rod1, a
          mammalian polypyrimidine tract binding protein (PTB)
          homolog of a regulator of differentiation in the
          fission yeast Schizosaccharomyces pombe, where the nrd1
          gene encodes an RNA binding protein negatively
          regulates the onset of differentiation. ROD1 is
          predominantly expressed in hematopoietic cells or
          organs. It might play a role controlling
          differentiation in mammals. Rod1 contains four repeats
          of RNA recognition motifs (RRM), also known as RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain) and
          does have RNA binding activities. .
          Length = 76

 Score = 25.7 bits (56), Expect = 1.6
 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 1/32 (3%)

Query: 19 VLYIRNL-PYKITGDEMYDIFGKYGAIRQIRI 49
          VL + NL P  IT   ++ +FG YG + +++I
Sbjct: 2  VLLVSNLNPDAITPHGLFILFGVYGDVHRVKI 33


>gnl|CDD|241133 cd12689, RRM1_hnRNPL_like, RNA recognition motif 1 in
          heterogeneous nuclear ribonucleoprotein L (hnRNP-L) and
          similar proteins.  This subfamily corresponds to the
          RRM1 of heterogeneous nuclear ribonucleoprotein L
          (hnRNP-L), heterogeneous nuclear ribonucleoprotein
          L-like (hnRNP-LL), and similar proteins. hnRNP-L is a
          higher eukaryotic specific subunit of human KMT3a (also
          known as HYPB or hSet2) complex required for histone H3
          Lys-36 trimethylation activity. It plays both, nuclear
          and cytoplasmic, roles in mRNA export of intronless
          genes, IRES-mediated translation, mRNA stability, and
          splicing. hnRNP-LL plays a critical and unique role in
          the signal-induced regulation of CD45 and acts as a
          global regulator of alternative splicing in activated T
          cells. It is closely related in domain structure and
          sequence to hnRNP-L, which contains three
          RNA-recognition motifs (RRMs), also known as RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain). .
          Length = 80

 Score = 25.8 bits (57), Expect = 1.6
 Identities = 7/30 (23%), Positives = 17/30 (56%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAIRQI 47
           V+++R LP  +T  ++ +   ++G I  +
Sbjct: 3  PVVHVRGLPDGVTEADLVEALSEFGPISYV 32


>gnl|CDD|241195 cd12751, RRM5_RBM12, RNA recognition motif 5 in RNA-binding
          protein 12 (RBM12) and similar proteins.  This subgroup
          corresponds to the RRM5 of RBM12, also termed SH3/WW
          domain anchor protein in the nucleus (SWAN), which is
          ubiquitously expressed. It contains five distinct RNA
          binding motifs (RBMs), also termed RBDs (RNA binding
          domains) or RNPs (ribonucleoprotein domains), two
          proline-rich regions, and several putative
          transmembrane domains. The biological role of RBM12
          remains unclear. .
          Length = 76

 Score = 25.3 bits (55), Expect = 1.8
 Identities = 10/26 (38%), Positives = 17/26 (65%)

Query: 19 VLYIRNLPYKITGDEMYDIFGKYGAI 44
          V+ ++N+P+ +T DE+ D F  Y  I
Sbjct: 3  VIKVQNMPFTVTVDEILDFFYGYQVI 28


>gnl|CDD|241000 cd12556, RRM2_RBM15B, RNA recognition motif 2 in putative RNA
          binding motif protein 15B (RBM15B) from vertebrate.
          This subgroup corresponds to the RRM2 of RBM15B, also
          termed one twenty-two 3 (OTT3), a paralog of RNA
          binding motif protein 15 (RBM15), also known as
          One-twenty two protein 1 (OTT1). Like RBM15, RBM15B has
          post-transcriptional regulatory activity. It is a
          nuclear protein sharing with RBM15 the association with
          the splicing factor compartment and the nuclear
          envelope as well as the binding to mRNA export factors
          NXF1 and Aly/REF. RBM15B belongs to the Spen (split
          end) protein family, which shares a domain architecture
          comprising of three N-terminal RNA recognition motifs
          (RRMs), also known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and a C-terminal SPOC (Spen
          paralog and ortholog C-terminal) domain. .
          Length = 85

 Score = 25.7 bits (56), Expect = 1.9
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          R L+I NL + ++  E+   F KYG I ++ I
Sbjct: 9  RNLFIGNLDHNVSEVELRRAFDKYGIIEEVVI 40


>gnl|CDD|237139 PRK12564, PRK12564, carbamoyl phosphate synthase small subunit;
           Reviewed.
          Length = 360

 Score = 26.2 bits (59), Expect = 1.9
 Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 4/31 (12%)

Query: 54  DTRYLTKSL----VMKCMIFLVNMELSDKLE 80
           DTR LT+ L     MK +I   + +  + LE
Sbjct: 114 DTRALTRKLREKGAMKGVIATEDFDAEELLE 144


>gnl|CDD|240705 cd12259, RRM_SRSF11_SREK1, RNA recognition motif in
          serine/arginine-rich splicing factor 11 (SRSF11),
          splicing regulatory glutamine/lysine-rich protein 1
          (SREK1) and similar proteins.  This subfamily
          corresponds to the RRM domain of SRSF11 (SRp54 or p54),
          SREK1 ( SFRS12 or SRrp86) and similar proteins, a group
          of proteins containing regions rich in serine-arginine
          dipeptides (SR protein family). These are involved in
          bridge-complex formation and splicing by mediating
          protein-protein interactions across either introns or
          exons. SR proteins have been identified as crucial
          regulators of alternative splicing. Different SR
          proteins display different substrate specificity, have
          distinct functions in alternative splicing of different
          pre-mRNAs, and can even negatively regulate splicing.
          All SR family members are characterized by the presence
          of one or two N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and the C-terminal regions
          rich in serine and arginine dipeptides (SR domains).
          The RRM domain is responsible for RNA binding and
          specificity in both alternative and constitutive
          splicing. In contrast, SR domains are thought to be
          protein-protein interaction domains that are often
          interchangeable. .
          Length = 76

 Score = 25.3 bits (56), Expect = 2.1
 Identities = 9/31 (29%), Positives = 19/31 (61%)

Query: 19 VLYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          V+ + N+  + T ++M  +FG  G I ++R+
Sbjct: 1  VVQVTNVSPQATEEQMRTLFGFLGKIEELRL 31


>gnl|CDD|240734 cd12288, RRM_La_like_plant, RNA recognition motif in plant
          proteins related to the La autoantigen.  This subfamily
          corresponds to the RRM of plant La-like proteins
          related to the La autoantigen. A variety of La-related
          proteins (LARPs or La ribonucleoproteins), with
          differing domain architecture, appear to function as
          RNA-binding proteins in eukaryotic cellular processes.
          Members in this family contain an LAM domain followed
          by an RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain). .
          Length = 93

 Score = 25.6 bits (56), Expect = 2.1
 Identities = 10/32 (31%), Positives = 19/32 (59%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          R +   NLP   + + + +IFG  G+++ +RI
Sbjct: 1  RTVVAENLPEDHSIENLEEIFGTVGSVKNVRI 32


>gnl|CDD|240966 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA-binding
          protein MRN1 and similar proteins.  This subgroup
          corresponds to the RRM4 of MRN1, also termed multicopy
          suppressor of RSC-NHP6 synthetic lethality protein 1,
          or post-transcriptional regulator of 69 kDa, which is a
          RNA-binding protein found in yeast. Although its
          specific biological role remains unclear, MRN1 might be
          involved in translational regulation. Members in this
          family contain four copies of conserved RNA recognition
          motif (RRM), also known as RBD (RNA binding domain) or
          RNP (ribonucleoprotein domain). .
          Length = 79

 Score = 25.5 bits (56), Expect = 2.1
 Identities = 9/30 (30%), Positives = 18/30 (60%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAIRQI 47
          R +YI N+   +T +++ + F +YG I  +
Sbjct: 4  RNVYIGNIDDSLTEEKLRNDFSQYGEIESV 33


>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in
          heterogeneous nuclear ribonucleoprotein M (hnRNP M) and
          similar proteins.  This subfamily corresponds to the
          RRM3 of heterogeneous nuclear ribonucleoprotein M
          (hnRNP M), myelin expression factor 2 (MEF-2 or MyEF-2
          or MST156) and similar proteins. hnRNP M is pre-mRNA
          binding protein that may play an important role in the
          pre-mRNA processing. It also preferentially binds to
          poly(G) and poly(U) RNA homopolymers. hnRNP M is able
          to interact with early spliceosomes, further
          influencing splicing patterns of specific pre-mRNAs.
          hnRNP M functions as the receptor of carcinoembryonic
          antigen (CEA) that contains the penta-peptide sequence
          PELPK signaling motif. In addition, hnRNP M and another
          splicing factor Nova-1 work together as dopamine D2
          receptor (D2R) pre-mRNA-binding proteins. They regulate
          alternative splicing of D2R pre-mRNA in an antagonistic
          manner. hnRNP M contains three RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an unusual
          hexapeptide-repeat region rich in methionine and
          arginine residues (MR repeat motif). MEF-2 is a
          sequence-specific single-stranded DNA (ssDNA) binding
          protein that binds specifically to ssDNA derived from
          the proximal (MB1) element of the myelin basic protein
          (MBP) promoter and represses transcription of the MBP
          gene. MEF-2 shows high sequence homology with hnRNP M.
          It also contains three RRMs, which may be responsible
          for its ssDNA binding activity. .
          Length = 72

 Score = 25.3 bits (56), Expect = 2.1
 Identities = 10/37 (27%), Positives = 22/37 (59%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTR 56
          +++RNLP+ +T  ++ D+F + G + +  +    D R
Sbjct: 1  IFVRNLPFSVTWQDLKDLFRECGNVLRADVKTDNDGR 37


>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE.  This
          subgroup corresponds to the RRM of BOULE, the founder
          member of the human DAZ gene family. Invertebrates
          contain a single BOULE, while vertebrates, other than
          catarrhine primates, possess both BOULE and DAZL genes.
          The catarrhine primates possess BOULE, DAZL, and DAZ
          genes. BOULE encodes an RNA-binding protein containing
          an RNA recognition motif (RRM), also known as RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain), and
          a single copy of the DAZ motif. Although its specific
          biochemical functions remains to be investigated, BOULE
          protein may interact with poly(A)-binding proteins
          (PABPs), and act as translational activators of
          specific mRNAs during gametogenesis. .
          Length = 81

 Score = 25.2 bits (55), Expect = 2.1
 Identities = 8/35 (22%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 17 NRVLYIRNLPYKITGDEMYDIFGKYGAIRQIRIGN 51
          NR+ ++  + +K   +++   F +YG +++++I N
Sbjct: 3  NRI-FVGGIDFKTNENDLRKFFSQYGTVKEVKIVN 36


>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate
          RNA-binding protein 4 (RBM4).  This subgroup
          corresponds to the RRM1 of RBM4, a ubiquitously
          expressed splicing factor that has two isoforms, RBM4A
          (also known as Lark homolog) and RBM4B (also known as
          RBM30), which are very similar in structure and
          sequence. RBM4 may function as a translational
          regulator of stress-associated mRNAs and also plays a
          role in micro-RNA-mediated gene regulation. RBM4
          contains two N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), a CCHC-type zinc finger,
          and three alanine-rich regions within their C-terminal
          regions. The C-terminal region may be crucial for
          nuclear localization and protein-protein interaction.
          The RRMs, in combination with the C-terminal region,
          are responsible for the splicing function of RBM4. .
          Length = 67

 Score = 25.2 bits (55), Expect = 2.3
 Identities = 10/30 (33%), Positives = 18/30 (60%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          L++ NLP + T  E+  +F +YG + +  I
Sbjct: 3  LFVGNLPPEATEQEIRSLFEQYGKVLECDI 32


>gnl|CDD|215227 PLN02406, PLN02406, ethanolamine-phosphate cytidylyltransferase.
          Length = 418

 Score = 25.8 bits (56), Expect = 2.3
 Identities = 13/41 (31%), Positives = 19/41 (46%), Gaps = 2/41 (4%)

Query: 1   MAMSQRRANVRLPPEVNRVLYIRNLPYKITGDEMYDIFGKY 41
             M +R   V     V+ V  I + PY IT + M  +F +Y
Sbjct: 102 TPMHERMIMVSGVKWVDEV--IPDAPYAITEEFMNKLFNEY 140


>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal
          pre-messenger RNA splicing protein 24 (Prp24) and
          similar proteins.  This subfamily corresponds to the
          RRM2 of Prp24, also termed U4/U6
          snRNA-associated-splicing factor PRP24 (U4/U6 snRNP),
          an RNA-binding protein with four well conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          It facilitates U6 RNA base-pairing with U4 RNA during
          spliceosome assembly. Prp24 specifically binds free U6
          RNA primarily with RRMs 1 and 2 and facilitates pairing
          of U6 RNA bases with U4 RNA bases. Additionally, it may
          also be involved in dissociation of the U4/U6 complex
          during spliceosome activation. .
          Length = 78

 Score = 25.2 bits (56), Expect = 2.4
 Identities = 10/29 (34%), Positives = 16/29 (55%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIR 48
          L++ N P      ++ D+F +YG I  IR
Sbjct: 3  LWVTNFPPSFDQSDIRDLFEQYGEILSIR 31


>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit
          4 (THOC4) and similar proteins.  This subgroup
          corresponds to the RRM of THOC4, also termed
          transcriptional coactivator Aly/REF, or ally of AML-1
          and LEF-1, or bZIP-enhancing factor BEF, an mRNA
          transporter protein with a well conserved RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain). It is
          involved in RNA transportation from the nucleus. THOC4
          was initially identified as a transcription coactivator
          of LEF-1 and AML-1 for the TCRalpha enhancer function.
          In addition, THOC4 specifically binds to rhesus (RH)
          promoter in erythroid. It might be a novel
          transcription cofactor for erythroid-specific genes. .
          Length = 75

 Score = 24.9 bits (55), Expect = 2.6
 Identities = 7/26 (26%), Positives = 19/26 (73%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIR 45
          L + NL + ++ D++ ++F ++GA++
Sbjct: 3  LLVSNLDFGVSDDDIKELFAEFGALK 28


>gnl|CDD|241226 cd12782, RRM2_PTBP1, RNA recognition motif 2 in vertebrate
          polypyrimidine tract-binding protein 1 (PTB).  This
          subgroup corresponds to the RRM2 of PTB, also known as
          58 kDa RNA-binding protein PPTB-1 or heterogeneous
          nuclear ribonucleoprotein I (hnRNP I), an important
          negative regulator of alternative splicing in mammalian
          cells. PTB also functions at several other aspects of
          mRNA metabolism, including mRNA localization,
          stabilization, polyadenylation, and translation. PTB
          contains four RNA recognition motifs (RRM), also known
          as RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain). RRM1 and RRM2 are independent from each other
          and separated by flexible linkers. By contrast, there
          is an unusual and conserved interdomain interaction
          between RRM3 and RRM4. It is widely held that only RRMs
          3 and 4 are involved in RNA binding and RRM2 mediates
          PTB homodimer formation. However, new evidence shows
          that the RRMs 1 and 2 also contribute substantially to
          RNA binding. Moreover, PTB may not always dimerize to
          repress splicing. It is a monomer in solution. .
          Length = 100

 Score = 25.4 bits (55), Expect = 2.6
 Identities = 10/28 (35%), Positives = 18/28 (64%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQI 47
          + + NL Y +T D ++ IF K+G + +I
Sbjct: 7  IIVENLFYPVTLDVLHQIFSKFGTVLKI 34


>gnl|CDD|235498 PRK05541, PRK05541, adenylylsulfate kinase; Provisional.
          Length = 176

 Score = 25.8 bits (57), Expect = 2.7
 Identities = 10/21 (47%), Positives = 14/21 (66%)

Query: 29 ITGDEMYDIFGKYGAIRQIRI 49
          + GDE+ +I G YG  +Q RI
Sbjct: 41 LDGDELREILGHYGYDKQSRI 61


>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family.
          This subfamily corresponds to the RRM of the ist3
          family that includes fungal U2 small nuclear
          ribonucleoprotein (snRNP) component increased sodium
          tolerance protein 3 (ist3), X-linked 2 RNA-binding
          motif proteins (RBMX2) found in Metazoa and plants, and
          similar proteins. Gene IST3 encoding ist3, also termed
          U2 snRNP protein SNU17 (Snu17p), is a novel yeast
          Saccharomyces cerevisiae protein required for the first
          catalytic step of splicing and for progression of
          spliceosome assembly. It binds specifically to the U2
          snRNP and is an intrinsic component of prespliceosomes
          and spliceosomes. Yeast ist3 contains an atypical RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain). In the yeast
          pre-mRNA retention and splicing complex, the atypical
          RRM of ist3 functions as a scaffold that organizes the
          other two constituents, Bud13p (bud site selection 13)
          and Pml1p (pre-mRNA leakage 1). Fission yeast
          Schizosaccharomyces pombe gene cwf29 encoding ist3,
          also termed cell cycle control protein cwf29, is an
          RNA-binding protein complexed with cdc5 protein 29. It
          also contains one RRM. The biological function of RBMX2
          remains unclear. It shows high sequence similarity to
          yeast ist3 protein and harbors one RRM as well. .
          Length = 89

 Score = 24.9 bits (55), Expect = 2.7
 Identities = 10/25 (40%), Positives = 17/25 (68%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAI 44
          +YI  LPY++T  ++  +F +YG I
Sbjct: 12 IYIGGLPYELTEGDILCVFSQYGEI 36


>gnl|CDD|241139 cd12695, RRM3_PTBP1, RNA recognition motif 3 in vertebrate
          polypyrimidine tract-binding protein 1 (PTB).  This
          subgroup corresponds to the RRM3 of PTB, also known as
          58 kDa RNA-binding protein PPTB-1 or heterogeneous
          nuclear ribonucleoprotein I (hnRNP I), an important
          negative regulator of alternative splicing in mammalian
          cells. PTB also functions at several other aspects of
          mRNA metabolism, including mRNA localization,
          stabilization, polyadenylation, and translation. PTB
          contains four RNA recognition motifs (RRM), also known
          as RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain). RRM1 and RRM2 are independent from each other
          and separated by flexible linkers. By contrast, there
          is an unusual and conserved interdomain interaction
          between RRM3 and RRM4. It is widely held that only RRMs
          3 and 4 are involved in RNA binding and RRM2 mediates
          PTB homodimer formation. However, new evidence show
          that the RRMs 1 and 2 also contribute substantially to
          RNA binding. Moreover, PTB may not always dimerize to
          repress splicing. It is a monomer in solution. .
          Length = 93

 Score = 25.4 bits (55), Expect = 2.8
 Identities = 11/32 (34%), Positives = 22/32 (68%), Gaps = 1/32 (3%)

Query: 19 VLYIRNL-PYKITGDEMYDIFGKYGAIRQIRI 49
          VL + NL P ++T   ++ +FG YG +++++I
Sbjct: 1  VLLVSNLNPERVTPQCLFILFGVYGDVQRVKI 32


>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible
          RNA binding protein (CIRBP), RNA binding motif protein
          3 (RBM3) and similar proteins.  This subfamily
          corresponds to the RRM domain of two structurally
          related heterogenous nuclear ribonucleoproteins, CIRBP
          (also termed CIRP or A18 hnRNP) and RBM3 (also termed
          RNPL), both of which belong to a highly conserved cold
          shock proteins family. The cold shock proteins can be
          induced after exposure to a moderate cold-shock and
          other cellular stresses such as UV radiation and
          hypoxia. CIRBP and RBM3 may function in
          posttranscriptional regulation of gene expression by
          binding to different transcripts, thus allowing the
          cell to response rapidly to environmental signals.
          However, the kinetics and degree of cold induction are
          different between CIRBP and RBM3. Tissue distribution
          of their expression is different. CIRBP and RBM3 may be
          differentially regulated under physiological and stress
          conditions and may play distinct roles in cold
          responses of cells. CIRBP, also termed glycine-rich
          RNA-binding protein CIRP, is localized in the nucleus
          and mediates the cold-induced suppression of cell cycle
          progression. CIRBP also binds DNA and possibly serves
          as a chaperone that assists in the folding/unfolding,
          assembly/disassembly and transport of various proteins.
          RBM3 may enhance global protein synthesis and the
          formation of active polysomes while reducing the levels
          of ribonucleoprotein complexes containing microRNAs.
          RBM3 may also serve to prevent the loss of muscle mass
          by its ability to decrease cell death. Furthermore,
          RBM3 may be essential for cell proliferation and
          mitosis. Both, CIRBP and RBM3, contain an N-terminal
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain), that
          is involved in RNA binding, and C-terminal glycine-rich
          domain (RGG motif) that probably enhances RNA-binding
          via protein-protein and/or protein-RNA interactions.
          Like CIRBP, RBM3 can also bind to both RNA and DNA via
          its RRM domain. .
          Length = 80

 Score = 24.8 bits (54), Expect = 2.8
 Identities = 8/28 (28%), Positives = 14/28 (50%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQI 47
          L+I  L +      +  +F KYG I ++
Sbjct: 3  LFIGGLSFDTNEQSLEQVFSKYGQISEV 30


>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33
          (Cyp33) and similar proteins.  This subfamily
          corresponds to the RRM of Cyp33, also termed
          peptidyl-prolyl cis-trans isomerase E (PPIase E), or
          cyclophilin E, or rotamase E. Cyp33 is a nuclear
          RNA-binding cyclophilin with an N-terminal RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), and a
          C-terminal PPIase domain. Cyp33 possesses RNA-binding
          activity and preferentially binds to polyribonucleotide
          polyA and polyU, but hardly to polyG and polyC. It
          binds specifically to mRNA, which can stimulate its
          PPIase activity. Moreover, Cyp33 interacts with the
          third plant homeodomain (PHD3) zinc finger cassette of
          the mixed lineage leukemia (MLL) proto-oncoprotein and
          a poly-A RNA sequence through its RRM domain. It
          further mediates downregulation of the expression of
          MLL target genes HOXC8, HOXA9, CDKN1B, and C-MYC, in a
          proline isomerase-dependent manner. Cyp33 also
          possesses a PPIase activity that catalyzes cis-trans
          isomerization of the peptide bond preceding a proline,
          which has been implicated in the stimulation of folding
          and conformational changes in folded and unfolded
          proteins. The PPIase activity can be inhibited by the
          immunosuppressive drug cyclosporin A. .
          Length = 73

 Score = 24.9 bits (55), Expect = 3.0
 Identities = 8/30 (26%), Positives = 16/30 (53%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          LY+  L  ++    ++  F  +G I+ I+I
Sbjct: 1  LYVGGLAEEVDEKVLHAAFIPFGDIKDIQI 30


>gnl|CDD|240855 cd12409, RRM1_RRT5, RNA recognition motif 1 in yeast regulator of
          rDNA transcription protein 5 (RRT5) and similar
          proteins.  This subfamily corresponds to the RRM1 of
          the lineage specific family containing a group of
          uncharacterized yeast regulators of rDNA transcription
          protein 5 (RRT5), which may play roles in the
          modulation of rDNA transcription. RRT5 contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains). .
          Length = 84

 Score = 25.0 bits (55), Expect = 3.0
 Identities = 5/25 (20%), Positives = 13/25 (52%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAI 44
          +YI NL Y  + +++ +    +  +
Sbjct: 2  VYISNLSYSSSEEDLEEFLKDFEPV 26


>gnl|CDD|241227 cd12783, RRM2_PTBP2, RNA recognition motif 2 in vertebrate
          polypyrimidine tract-binding protein 2 (PTBP2).  This
          subgroup corresponds to the RRM2 of PTBP2, also known
          as neural polypyrimidine tract-binding protein or
          neurally-enriched homolog of PTB (nPTB), highly
          homologous to polypyrimidine tract binding protein
          (PTB) and perhaps specific to the vertebrates. Unlike
          PTB, PTBP2 is enriched in the brain and in some neural
          cell lines. It binds more stably to the downstream
          control sequence (DCS) RNA than PTB does but is a
          weaker repressor of splicing in vitro. PTBP2 also
          greatly enhances the binding of two other proteins,
          heterogeneous nuclear ribonucleoprotein (hnRNP) H and
          KH-type splicing-regulatory protein (KSRP), to the DCS
          RNA. The binding properties of PTBP2 and its reduced
          inhibitory activity on splicing imply roles in
          controlling the assembly of other splicing-regulatory
          proteins. PTBP2 contains four RNA recognition motifs
          (RRMs), also known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain). .
          Length = 101

 Score = 25.4 bits (55), Expect = 3.0
 Identities = 10/28 (35%), Positives = 18/28 (64%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQI 47
          + I N+ Y +T D ++ IF K+G + +I
Sbjct: 6  IIIDNMYYPVTLDVLHQIFSKFGTVLKI 33


>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple
          RNA-binding domain-containing protein 1 (MRD1) and
          similar proteins.  This subgroup corresponds to the
          RRM1 of MRD1 which is encoded by a novel yeast gene
          MRD1 (multiple RNA-binding domain). It is
          well-conserved in yeast and its homologs exist in all
          eukaryotes. MRD1 is present in the nucleolus and the
          nucleoplasm. It interacts with the 35 S precursor rRNA
          (pre-rRNA) and U3 small nucleolar RNAs (snoRNAs). MRD1
          is essential for the initial processing at the A0-A2
          cleavage sites in the 35 S pre-rRNA. It contains 5
          conserved RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), which may play an important structural role
          in organizing specific rRNA processing events. .
          Length = 76

 Score = 24.9 bits (55), Expect = 3.0
 Identities = 9/37 (24%), Positives = 20/37 (54%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTR 56
          + ++NLP  +T D + + F   G +  +++  T D +
Sbjct: 3  IIVKNLPKYVTEDRLREHFESKGEVTDVKVMRTRDGK 39


>gnl|CDD|240971 cd12527, RRM2_EAR1_like, RNA recognition motif 2 in terminal
          EAR1-like proteins.  This subgroup corresponds to the
          RRM2 of terminal EAR1-like proteins, including terminal
          EAR1-like protein 1 and 2 (TEL1 and TEL2) found in land
          plants. They may play a role in the regulation of leaf
          initiation. The terminal EAR1-like proteins are
          putative RNA-binding proteins carrying three RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and TEL characteristic motifs that allow sequence and
          putative functional discrimination between the terminal
          EAR1-like proteins and Mei2-like proteins. .
          Length = 71

 Score = 24.8 bits (54), Expect = 3.1
 Identities = 12/37 (32%), Positives = 20/37 (54%), Gaps = 2/37 (5%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTR 56
          L I NL   ++ + +  IF  YG ++++R   TP  R
Sbjct: 4  LVIFNLDPTVSSETLRSIFQVYGDVKELR--ETPCKR 38


>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous
          nuclear ribonucleoprotein A3 (hnRNP A3) and similar
          proteins.  This subgroup corresponds to the RRM1 of
          hnRNP A3 which is a novel RNA trafficking response
          element-binding protein that interacts with the hnRNP
          A2 response element (A2RE) independently of hnRNP A2
          and participates in the trafficking of A2RE-containing
          RNA. hnRNP A3 can shuttle between the nucleus and the
          cytoplasm. It contains two RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), followed by a long
          glycine-rich region at the C-terminus. .
          Length = 81

 Score = 25.1 bits (54), Expect = 3.2
 Identities = 11/39 (28%), Positives = 20/39 (51%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDTR 56
          R L+I  L ++ T D + + F K+G +    +   P T+
Sbjct: 3  RKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTK 41


>gnl|CDD|240726 cd12280, RRM_FET, RNA recognition motif in the FET family of
          RNA-binding proteins.  This subfamily corresponds to
          the RRM of FET (previously TET) (FUS/TLS, EWS, TAF15)
          family of RNA-binding proteins. This ubiquitously
          expressed family of similarly structured proteins
          predominantly localizing to the nuclear, includes FUS
          (also known as TLS or Pigpen or hnRNP P2), EWS (also
          known as EWSR1), TAF15 (also known as hTAFII68 or TAF2N
          or RPB56), and Drosophila Cabeza (also known as SARFH).
          The corresponding coding genes of these proteins are
          involved in deleterious genomic rearrangements with
          transcription factor genes in a variety of human
          sarcomas and acute leukemias. All FET proteins interact
          with each other and are therefore likely to be part of
          the very same protein complexes, which suggests a
          general bridging role for FET proteins coupling RNA
          transcription, processing, transport, and DNA repair.
          The FET proteins contain multiple copies of a
          degenerate hexapeptide repeat motif at the N-terminus.
          The C-terminal region consists of a conserved nuclear
          import and retention signal (C-NLS), a putative
          zinc-finger domain, and a conserved RNA recognition
          motif (RRM), also known as RBD (RNA binding domain) or
          RNP (ribonucleoprotein domain), which is flanked by 3
          arginine-glycine-glycine (RGG) boxes. FUS and EWS might
          have similar sequence specificity; both bind
          preferentially to GGUG-containing RNAs. FUS has also
          been shown to bind strongly to human telomeric RNA and
          to small low-copy-number RNAs tethered to the promoter
          of cyclin D1. To date, nothing is known about the RNA
          binding specificity of TAF15. .
          Length = 81

 Score = 24.6 bits (54), Expect = 3.3
 Identities = 10/25 (40%), Positives = 15/25 (60%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAI 44
          +YI  LP  +T D + ++FG  G I
Sbjct: 1  IYISGLPDDVTEDSLAELFGGIGII 25


>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate
          paraspeckle protein 1 (PSP1).  This subgroup
          corresponds to the RRM1 of PSPC1, also termed
          paraspeckle component 1 (PSPC1), a novel nucleolar
          factor that accumulates within a new nucleoplasmic
          compartment, termed paraspeckles, and diffusely
          distributes in the nucleoplasm. It is ubiquitously
          expressed and highly conserved in vertebrates. Its
          cellular function remains unknown currently, however,
          PSPC1 forms a novel heterodimer with the nuclear
          protein p54nrb, also known as non-POU domain-containing
          octamer-binding protein (NonO), which localizes to
          paraspeckles in an RNA-dependent manner. PSPC1 contains
          two conserved RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), at the N-terminus. .
          Length = 71

 Score = 24.5 bits (53), Expect = 3.5
 Identities = 11/30 (36%), Positives = 18/30 (60%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          L++ NLP  IT ++   +F KYG   ++ I
Sbjct: 4  LFVGNLPTDITEEDFKKLFEKYGEPSEVFI 33


>gnl|CDD|240884 cd12438, RRM_CNOT4, RNA recognition motif in Eukaryotic CCR4-NOT
          transcription complex subunit 4 (NOT4) and similar
          proteins.  This subfamily corresponds to the RRM of
          NOT4, also termed CCR4-associated factor 4, or E3
          ubiquitin-protein ligase CNOT4, or potential
          transcriptional repressor NOT4Hp, a component of the
          CCR4-NOT complex, a global negative regulator of RNA
          polymerase II transcription. NOT4 functions as an
          ubiquitin-protein ligase (E3). It contains an
          N-terminal C4C4 type RING finger motif, followed by a
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain). The
          RING fingers may interact with a subset of
          ubiquitin-conjugating enzymes (E2s), including UbcH5B,
          and mediate protein-protein interactions. T.
          Length = 98

 Score = 24.8 bits (55), Expect = 3.9
 Identities = 11/32 (34%), Positives = 20/32 (62%), Gaps = 3/32 (9%)

Query: 21 YIRNLPYKITGDEM---YDIFGKYGAIRQIRI 49
          Y+  LP ++  +E+    + FG+YG I++I I
Sbjct: 9  YVVGLPPRLADEEVLKKPEYFGQYGKIKKIVI 40


>gnl|CDD|241190 cd12746, RRM2_RBM12B, RNA recognition motif 2 in RNA-binding
          protein 12B (RBM12B) and similar proteins.  This
          subgroup corresponds to the RRM2 of RBM12B which
          contains five distinct RNA binding motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). Its biological role
          remains unclear. .
          Length = 78

 Score = 24.7 bits (54), Expect = 3.9
 Identities = 8/20 (40%), Positives = 13/20 (65%)

Query: 20 LYIRNLPYKITGDEMYDIFG 39
          L++R LP+ +T D + D F 
Sbjct: 2  LFLRGLPFSVTEDNVRDFFS 21


>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding
          protein 43 (TDP-43) and similar proteins.  This
          subfamily corresponds to the RRM2 of TDP-43 (also
          termed TARDBP), a ubiquitously expressed pathogenic
          protein whose normal function and abnormal aggregation
          are directly linked to the genetic disease cystic
          fibrosis, and two neurodegenerative disorders:
          frontotemporal lobar degeneration (FTLD) and
          amyotrophic lateral sclerosis (ALS). TDP-43 binds both
          DNA and RNA, and has been implicated in transcriptional
          repression, pre-mRNA splicing and translational
          regulation. TDP-43 is a dimeric protein with two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and a C-terminal glycine-rich domain. The RRMs are
          responsible for DNA and RNA binding; they bind to TAR
          DNA and RNA sequences with UG-repeats. The glycine-rich
          domain can interact with the hnRNP family proteins to
          form the hnRNP-rich complex involved in splicing
          inhibition. It is also essential for the cystic
          fibrosis transmembrane conductance regulator (CFTR)
          exon 9-skipping activity. .
          Length = 71

 Score = 24.5 bits (54), Expect = 4.1
 Identities = 5/30 (16%), Positives = 16/30 (53%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          +++  L   +T +++   F ++G +  + I
Sbjct: 3  VFVGRLTEDMTEEDLRQYFSQFGEVTDVYI 32


>gnl|CDD|240740 cd12294, RRM_Rrp7A, RNA recognition motif in ribosomal
          RNA-processing protein 7 homolog A (Rrp7A) and similar
          proteins.  This subfamily corresponds to the RRM of
          Rrp7A, also termed gastric cancer antigen Zg14, a
          homolog of yeast ribosomal RNA-processing protein 7
          (Rrp7p), and mainly found in Metazoa. Rrp7p is an
          essential yeast protein involved in pre-rRNA processing
          and ribosome assembly, and is speculated to be required
          for correct assembly of rpS27 into the pre-ribosomal
          particle. In contrast, the cellular function of Rrp7A
          remains unclear currently. Rrp7A harbors an N-terminal
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain), and
          a C-terminal Rrp7 domain. .
          Length = 102

 Score = 24.6 bits (54), Expect = 4.8
 Identities = 8/36 (22%), Positives = 18/36 (50%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTP 53
          R L++ N+P   T + +  +F + G +  + +   P
Sbjct: 1  RTLFVLNVPPYCTEESLKRLFSRCGKVESVELQEKP 36


>gnl|CDD|220976 pfam11091, T4_tail_cap, Tail-tube assembly protein.  This tail tube
           protein is also referred to as Gp48. It is required for
           the assembly and length regulation of the tail tube of
           bacteriophage T4.
          Length = 348

 Score = 25.2 bits (55), Expect = 4.9
 Identities = 14/51 (27%), Positives = 17/51 (33%), Gaps = 11/51 (21%)

Query: 10  VRLPPEVNRVLYIRNLPYKITGDEMY---DIFGKYGAIRQIRIGNTPDTRY 57
           V+ PP    V  I N              D FG    I  +R   TPD  +
Sbjct: 277 VKNPP----VWMIENF---GNTSSFDGPSDAFGPAQ-ITSVRFDKTPDGIF 319


>gnl|CDD|240941 cd12497, RRM3_RBM47, RNA recognition motif 3 in vertebrate
          RNA-binding protein 47 (RBM47).  This subgroup
          corresponds to the RRM3 of RBM47, a putative
          RNA-binding protein that shows high sequence homology
          with heterogeneous nuclear ribonucleoprotein R (hnRNP
          R) and heterogeneous nuclear ribonucleoprotein Q (hnRNP
          Q). Its biological function remains unclear. Like hnRNP
          R and hnRNP Q, RBM47 contains two well defined and one
          degenerated RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains). .
          Length = 74

 Score = 24.2 bits (52), Expect = 5.0
 Identities = 8/24 (33%), Positives = 16/24 (66%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKY 41
          ++LY+RNL  + + D +   FG++
Sbjct: 2  KILYVRNLMIETSEDTIKKTFGQF 25


>gnl|CDD|240848 cd12402, RRM_eIF4B, RNA recognition motif in eukaryotic
          translation initiation factor 4B (eIF-4B) and similar
          proteins.  This subfamily corresponds to the RRM of
          eIF-4B, a multi-domain RNA-binding protein that has
          been primarily implicated in promoting the binding of
          40S ribosomal subunits to mRNA during translation
          initiation. It contains two RNA-binding domains; the
          N-terminal well-conserved RNA recognition motif (RRM),
          also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), binds the 18S rRNA of the
          40S ribosomal subunit and the C-terminal basic domain
          (BD), including two arginine-rich motifs (ARMs), binds
          mRNA during initiation, and is primarily responsible
          for the stimulation of the helicase activity of eIF-4A.
          eIF-4B also contains a DRYG domain (a region rich in
          Asp, Arg, Tyr, and Gly amino acids) in the middle,
          which is responsible for both, self-association of
          eIF-4B and  binding to the p170 subunit of eIF3.
          Additional research indicates that eIF-4B can interact
          with the poly(A) binding protein (PABP) in mammalian
          cells, which can stimulate both, the eIF-4B-mediated
          activation of the helicase activity of eIF-4A and
          binding of poly(A) by PABP. eIF-4B has also been shown
          to interact specifically with the internal ribosome
          entry sites (IRES) of several picornaviruses which
          facilitate cap-independent translation initiation. .
          Length = 77

 Score = 24.3 bits (53), Expect = 5.1
 Identities = 7/18 (38%), Positives = 13/18 (72%)

Query: 21 YIRNLPYKITGDEMYDIF 38
          Y+ NLPY +T +++ + F
Sbjct: 5  YLGNLPYDVTEEDIKEFF 22


>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear
          polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p)
          and similar proteins.  This subfamily corresponds to
          the RRM1 of Hrp1p and similar proteins. Hrp1p or Nab4p,
          also termed cleavage factor IB (CFIB), is a
          sequence-specific trans-acting factor that is essential
          for mRNA 3'-end formation in yeast Saccharomyces
          cerevisiae. It can be UV cross-linked to RNA and
          specifically recognizes the (UA)6 RNA element required
          for both, the cleavage and poly(A) addition, steps.
          Moreover, Hrp1p can shuttle between the nucleus and the
          cytoplasm, and play an additional role in the export of
          mRNAs to the cytoplasm. Hrp1p also interacts with
          Rna15p and Rna14p, two components of CF1A. In addition,
          Hrp1p functions as a factor directly involved in
          modulating the activity of the nonsense-mediated mRNA
          decay (NMD) pathway. It binds specifically to a
          downstream sequence element (DSE)-containing RNA and
          interacts with Upf1p, a component of the surveillance
          complex, further triggering the NMD pathway. Hrp1p
          contains two central RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an
          arginine-glycine-rich region harboring repeats of the
          sequence RGGF/Y. .
          Length = 76

 Score = 24.1 bits (52), Expect = 5.2
 Identities = 8/36 (22%), Positives = 18/36 (50%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDT 55
          ++I  L ++ T D + + FG++G +    +     T
Sbjct: 1  MFIGGLNWETTDDSLREYFGQFGEVTDCTVMRDSAT 36


>gnl|CDD|241078 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in CUGBP Elav-like
          family member CELF-1, CELF-2 and similar proteins.
          This subgroup corresponds to the RRM2 of CELF-1 (also
          termed BRUNOL-2, or CUG-BP1, or EDEN-BP), CELF-2 (also
          termed BRUNOL-3, or ETR-3, or CUG-BP2, or NAPOR), both
          of which belong to the CUGBP1 and ETR-3-like factors
          (CELF) or BRUNOL (Bruno-like) family of RNA-binding
          proteins that have been implicated in the regulation of
          pre-mRNA splicing and in the control of mRNA
          translation and deadenylation. CELF-1 is strongly
          expressed in all adult and fetal tissues tested. Human
          CELF-1 is a nuclear and cytoplasmic RNA-binding protein
          that regulates multiple aspects of nuclear and
          cytoplasmic mRNA processing, with implications for
          onset of type 1 myotonic dystrophy (DM1), a
          neuromuscular disease associated with an unstable CUG
          triplet expansion in the 3'-UTR (3'-untranslated
          region) of the DMPK (myotonic dystrophy protein kinase)
          gene; it preferentially targets UGU-rich mRNA elements.
          It has been shown to bind to a Bruno response element,
          a cis-element involved in translational control of
          oskar mRNA in Drosophila, and share sequence similarity
          to Bruno, the Drosophila protein that mediates this
          process. The Xenopus homolog embryo deadenylation
          element-binding protein (EDEN-BP) mediates
          sequence-specific deadenylation of Eg5 mRNA. It binds
          specifically to the EDEN motif in the 3'-untranslated
          regions of maternal mRNAs and targets these mRNAs for
          deadenylation and translational repression. CELF-1
          contains three highly conserved RNA recognition motifs
          (RRMs), also known as RBDs (RNA binding domains) or
          RNPs (ribonucleoprotein domains): two consecutive RRMs
          (RRM1 and RRM2) situated in the N-terminal region
          followed by a linker region and the third RRM (RRM3)
          close to the C-terminus of the protein. The two
          N-terminal RRMs of EDEN-BP are necessary for the
          interaction with EDEN as well as a part of the linker
          region (between RRM2 and RRM3). Oligomerization of
          EDEN-BP is required for specific mRNA deadenylation and
          binding. CELF-2 is expressed in all tissues at some
          level, but highest in brain, heart, and thymus. It has
          been implicated in the regulation of nuclear and
          cytoplasmic RNA processing events, including
          alternative splicing, RNA editing, stability and
          translation. CELF-2 shares high sequence identity with
          CELF-1, but shows different binding specificity; it
          preferentially binds to sequences with UG repeats and
          UGUU motifs. It has been shown to bind to a Bruno
          response element, a cis-element involved in
          translational control of oskar mRNA in Drosophila, and
          share sequence similarity to Bruno, the Drosophila
          protein that mediates this process. It also binds to
          the 3'-UTR of cyclooxygenase-2 messages, affecting both
          translation and mRNA stability, and binds to apoB mRNA,
          regulating its C to U editing. CELF-2 also contains
          three highly conserved RRMs. It binds to RNA via the
          first two RRMs, which are also important for
          localization in the cytoplasm. The splicing activation
          or repression activity of CELF-2 on some specific
          substrates is mediated by RRM1/RRM2. Both, RRM1 and
          RRM2 of CELF-2, can activate cardiac troponin T (cTNT)
          exon 5 inclusion. In addition, CELF-2 possesses a
          typical arginine and lysine-rich nuclear localization
          signal (NLS) in the C-terminus, within RRM3. .
          Length = 81

 Score = 24.2 bits (52), Expect = 5.4
 Identities = 11/38 (28%), Positives = 20/38 (52%)

Query: 17 NRVLYIRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPD 54
          +R L+I  +  K   +++  +F  +G I + RI   PD
Sbjct: 1  DRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPD 38


>gnl|CDD|240737 cd12291, RRM1_La, RNA recognition motif 1 in La autoantigen (La
          or LARP3) and similar proteins.  This subfamily
          corresponds to the RRM1 of La autoantigen, also termed
          Lupus La protein, or La ribonucleoprotein, or Sjoegren
          syndrome type B antigen (SS-B), a highly abundant
          nuclear phosphoprotein and well conserved in
          eukaryotes. It specifically binds the 3'-terminal
          UUU-OH motif of nascent RNA polymerase III transcripts
          and protects them from exonucleolytic degradation by 3'
          exonucleases. In addition, La can directly facilitate
          the translation and/or metabolism of many UUU-3'
          OH-lacking cellular and viral mRNAs, through binding
          internal RNA sequences within the untranslated regions
          of target mRNAs. La contains an N-terminal La motif
          (LAM), followed by two RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). It also possesses a short
          basic motif (SBM) and a nuclear localization signal
          (NLS) at the C-terminus. .
          Length = 72

 Score = 24.1 bits (53), Expect = 6.0
 Identities = 9/29 (31%), Positives = 17/29 (58%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIR 48
          +Y++  P   T D++ + F K+G +  IR
Sbjct: 2  VYVKGFPKDATLDDIQEFFEKFGKVNNIR 30


>gnl|CDD|241194 cd12750, RRM5_RBM12B, RNA recognition motif 5 in RNA-binding
          protein 12B (RBM12B) and similar proteins.  This
          subgroup corresponds to the RRM5 of RBM12B which
          contains five distinct RNA binding motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). Its biological role
          remains unclear. .
          Length = 77

 Score = 24.1 bits (52), Expect = 6.2
 Identities = 10/23 (43%), Positives = 14/23 (60%)

Query: 22 IRNLPYKITGDEMYDIFGKYGAI 44
          + NLP+K T +E+ D F  Y  I
Sbjct: 5  LENLPFKATINEILDFFHGYRVI 27


>gnl|CDD|240748 cd12302, RRM_scSet1p_like, RNA recognition motif in budding yeast
          Saccharomyces cerevisiae SET domain-containing protein
          1 (scSet1p) and similar proteins.  This subfamily
          corresponds to the RRM of scSet1p, also termed H3
          lysine-4 specific histone-lysine N-methyltransferase,
          or COMPASS component SET1, or lysine
          N-methyltransferase 2, which is encoded by SET1 from
          the yeast S. cerevisiae. It is a nuclear protein that
          may play a role in both silencing and activating
          transcription. scSet1p is closely related to the SET
          domain proteins of multicellular organisms, which are
          implicated in diverse aspects of cell morphology,
          growth control, and chromatin-mediated transcriptional
          silencing. scSet1p contains an N-terminal RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), followed by
          a conserved SET domain that may play a role in DNA
          repair and telomere function. .
          Length = 110

 Score = 24.2 bits (53), Expect = 6.5
 Identities = 9/34 (26%), Positives = 16/34 (47%)

Query: 22 IRNLPYKITGDEMYDIFGKYGAIRQIRIGNTPDT 55
          +       + D + + F  +G I +IR  N P+T
Sbjct: 7  VWGFQPSTSEDIIKNYFSSFGEIAEIRNFNDPNT 40


>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein
          homolog TRA2-alpha, TRA2-beta and similar proteins.
          This subfamily corresponds to the RRM of two mammalian
          homologs of Drosophila transformer-2 (Tra2),
          TRA2-alpha, TRA2-beta (also termed SFRS10), and similar
          proteins found in eukaryotes. TRA2-alpha is a 40-kDa
          serine/arginine-rich (SR) protein that specifically
          binds to gonadotropin-releasing hormone (GnRH) exonic
          splicing enhancer on exon 4 (ESE4) and is necessary for
          enhanced GnRH pre-mRNA splicing. It strongly stimulates
          GnRH intron A excision in a dose-dependent manner. In
          addition, TRA2-alpha can interact with either 9G8 or
          SRp30c, which may also be crucial for ESE-dependent
          GnRH pre-mRNA splicing. TRA2-beta is a
          serine/arginine-rich (SR) protein that controls the
          pre-mRNA alternative splicing of the
          calcitonin/calcitonin gene-related peptide (CGRP), the
          survival motor neuron 1 (SMN1) protein and the tau
          protein. Both, TRA2-alpha and TRA2-beta, contains a
          well conserved RNA recognition motif (RRM), also termed
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain), flanked by the N- and C-terminal
          arginine/serine (RS)-rich regions. .
          Length = 78

 Score = 23.7 bits (52), Expect = 7.7
 Identities = 7/31 (22%), Positives = 17/31 (54%)

Query: 19 VLYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
           L +  L    T  ++ ++F +YG I ++++
Sbjct: 1  CLGVFGLSLYTTERDLREVFSRYGPIEKVQV 31


>gnl|CDD|240888 cd12442, RRM_RBM48, RNA recognition motif in RNA-binding protein
          48 (RBM48) and similar proteins.  This subfamily
          corresponds to the RRM of RBM48, a putative RNA-binding
          protein of unknown function. It contains one RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain). .
          Length = 100

 Score = 23.8 bits (52), Expect = 8.1
 Identities = 9/32 (28%), Positives = 17/32 (53%)

Query: 18 RVLYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          R L ++ +P      E+ ++F  YG I + R+
Sbjct: 11 RYLLVQGVPALGVEKELLELFALYGTIEEYRL 42


>gnl|CDD|240735 cd12289, RRM_LARP6, RNA recognition motif in La-related protein 6
          (LARP6) and similar proteins.  This subfamily
          corresponds to the RRM of LARP6, also termed Acheron
          (Achn), a novel member of the lupus antigen (La)
          family. It is expressed predominantly in neurons and
          muscle in vertebrates. LARP6 functions as a key
          regulatory protein that may play a role in mediating a
          variety of developmental and homeostatic processes in
          animals, including myogenesis, neurogenesis and
          possibly metastasis. LARP6 binds to
          Ca2+/calmodulin-dependent serine protein kinase (CASK),
          and forms a complex with inhibitor of differentiation
          transcription factors. It is structurally related to
          the La autoantigen and contains a La motif (LAM),
          nuclear localization and export (NLS and NES) signals,
          and an RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain).
          .
          Length = 93

 Score = 23.8 bits (52), Expect = 8.3
 Identities = 6/14 (42%), Positives = 8/14 (57%)

Query: 36 DIFGKYGAIRQIRI 49
          ++F   G I  IRI
Sbjct: 20 ELFSTCGVIALIRI 33


>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and
          cytoplasmic polyadenylated RNA-binding protein PUB1 and
          similar proteins.  This subgroup corresponds to the
          RRM1 of yeast protein PUB1, also termed ARS
          consensus-binding protein ACBP-60, or poly
          uridylate-binding protein, or poly(U)-binding protein.
          PUB1 has been identified as both, a heterogeneous
          nuclear RNA-binding protein (hnRNP) and a cytoplasmic
          mRNA-binding protein (mRNP), which may be stably bound
          to a translationally inactive subpopulation of mRNAs
          within the cytoplasm. It is distributed in both, the
          nucleus and the cytoplasm, and binds to poly(A)+ RNA
          (mRNA or pre-mRNA). Although it is one of the major
          cellular proteins cross-linked by UV light to
          polyadenylated RNAs in vivo, PUB1 is nonessential for
          cell growth in yeast. PUB1 also binds to T-rich single
          stranded DNA (ssDNA); however, there is no strong
          evidence implicating PUB1 in the mechanism of DNA
          replication. PUB1 contains three RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a GAR motif (glycine
          and arginine rich stretch) that is located between RRM2
          and RRM3. .
          Length = 74

 Score = 23.7 bits (51), Expect = 8.8
 Identities = 10/30 (33%), Positives = 18/30 (60%)

Query: 20 LYIRNLPYKITGDEMYDIFGKYGAIRQIRI 49
          LY+ NL  ++T D +  IF   G ++ ++I
Sbjct: 1  LYVGNLDPRVTEDILKQIFQVGGPVQNVKI 30


>gnl|CDD|144543 pfam00988, CPSase_sm_chain, Carbamoyl-phosphate synthase small
           chain, CPSase domain.  The carbamoyl-phosphate synthase
           domain is in the amino terminus of protein.
           Carbamoyl-phosphate synthase catalyzes the ATP-dependent
           synthesis of carbamyl-phosphate from glutamine or
           ammonia and bicarbonate. This important enzyme initiates
           both the urea cycle and the biosynthesis of arginine
           and/or pyrimidines. The carbamoyl-phosphate synthase
           (CPS) enzyme in prokaryotes is a heterodimer of a small
           and large chain. The small chain promotes the hydrolysis
           of glutamine to ammonia, which is used by the large
           chain to synthesise carbamoyl phosphate. See pfam00289.
           The small chain has a GATase domain in the carboxyl
           terminus. See pfam00117.
          Length = 131

 Score = 23.9 bits (53), Expect = 9.2
 Identities = 9/19 (47%), Positives = 11/19 (57%), Gaps = 4/19 (21%)

Query: 54  DTRYLTKSL----VMKCMI 68
           DTR LT+ L     MK +I
Sbjct: 112 DTRALTRKLREKGAMKGVI 130


>gnl|CDD|240879 cd12433, RRM_Yme2p_like, RNA recognition motif in yeast
          mitochondrial escape protein 2 (Yme2p) and similar
          proteins.  This subfamily corresponds to the RRM of
          Yme2p, also termed protein RNA12, an inner
          mitochondrial membrane protein that plays a critical
          role in mitochondrial DNA transactions. It may serve as
          a mediator of nucleoid structure and number in
          mitochondria of the yeast Saccharomyces cerevisiae.
          Yme2p contains an exonuclease domain, an RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), and a
          C-terminal domain. .
          Length = 86

 Score = 23.8 bits (52), Expect = 9.7
 Identities = 9/37 (24%), Positives = 19/37 (51%), Gaps = 3/37 (8%)

Query: 11 RLPPEVNRVLYIRNLPYKITGDEMYDIFGKYGAIRQI 47
          R P   +  + +     +++ +E+Y +F  YG I+ I
Sbjct: 1  RFP---STTIRVEFEGPELSQEELYSLFRPYGKIKDI 34


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.325    0.141    0.406 

Gapped
Lambda     K      H
   0.267   0.0911    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 4,129,240
Number of extensions: 331101
Number of successful extensions: 664
Number of sequences better than 10.0: 1
Number of HSP's gapped: 661
Number of HSP's successfully gapped: 203
Length of query: 80
Length of database: 10,937,602
Length adjustment: 49
Effective length of query: 31
Effective length of database: 8,764,256
Effective search space: 271691936
Effective search space used: 271691936
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (23.9 bits)