RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy10284
         (103 letters)



>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP
           Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6
           and similar proteins.  This subgroup corresponds to the
           RRM2 of CELF-3, CELF-4, CELF-5, and CELF-6, all of which
           belong to the CUGBP1 and ETR-3-like factors (CELF) or
           BRUNOL (Bruno-like) family of RNA-binding proteins that
           display dual nuclear and cytoplasmic localizations and
           have been implicated in the regulation of pre-mRNA
           splicing and in the control of mRNA translation and
           deadenylation. CELF-3, expressed in brain and testis
           only, is also known as bruno-like protein 1 (BRUNOL-1),
           or CAG repeat protein 4, or CUG-BP- and ETR-3-like
           factor 3, or embryonic lethal abnormal vision
           (ELAV)-type RNA-binding protein 1 (ETR-1), or expanded
           repeat domain protein CAG/CTG 4, or trinucleotide
           repeat-containing gene 4 protein (TNRC4). It plays an
           important role in the pathogenesis of tauopathies.
           CELF-3 contains three highly conserved RNA recognition
           motifs (RRMs), also known as RBDs (RNA binding domains)
           or RNPs (ribonucleoprotein domains): two consecutive
           RRMs (RRM1 and RRM2) situated in the N-terminal region
           followed by a linker region and the third RRM (RRM3)
           close to the C-terminus of the protein. The effect of
           CELF-3 on tau splicing is mediated mainly by the
           RNA-binding activity of RRM2. The divergent linker
           region might mediate the interaction of CELF-3 with
           other proteins regulating its activity or involved in
           target recognition. CELF-4, being highly expressed
           throughout the brain and in glandular tissues,
           moderately expressed in heart, skeletal muscle, and
           liver, is also known as bruno-like protein 4 (BRUNOL-4),
           or CUG-BP- and ETR-3-like factor 4. Like CELF-3, CELF-4
           also contain three highly conserved RRMs. The splicing
           activation or repression activity of CELF-4 on some
           specific substrates is mediated by its RRM1/RRM2. On the
           other hand, both RRM1 and RRM2 of CELF-4 can activate
           cardiac troponin T (cTNT) exon 5 inclusion. CELF-5,
           expressed in brain, is also known as bruno-like protein
           5 (BRUNOL-5), or CUG-BP- and ETR-3-like factor 5.
           Although its biological role remains unclear, CELF-5
           shares same domain architecture with CELF-3. CELF-6,
           being strongly expressed in kidney, brain, and testis,
           is also known as bruno-like protein 6 (BRUNOL-6), or
           CUG-BP- and ETR-3-like factor 6. It activates exon
           inclusion of a cardiac troponin T minigene in transient
           transfection assays in a muscle-specific splicing
           enhancer (MSE)-dependent manner and can activate
           inclusion via multiple copies of a single element, MSE2.
           CELF-6 also promotes skipping of exon 11 of insulin
           receptor, a known target of CELF activity that is
           expressed in kidney. In addition to three highly
           conserved RRMs, CELF-6 also possesses numerous potential
           phosphorylation sites, a potential nuclear localization
           signal (NLS) at the C terminus, and an alanine-rich
           region within the divergent linker region. .
          Length = 81

 Score = 95.6 bits (238), Expect = 2e-27
 Identities = 34/42 (80%), Positives = 39/42 (92%)

Query: 62  DKKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
           D+KLFVGMLSKQQ EDDVR++F PFGTIEECT+L+GPDG SK
Sbjct: 1   DRKLFVGMLSKQQTEDDVRRLFEPFGTIEECTILRGPDGNSK 42


>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila
           melanogaster Bruno protein and similar proteins.  This
           subgroup corresponds to the RRM2 of Bruno, a Drosophila
           RNA recognition motif (RRM)-containing protein that
           plays a central role in regulation of Oskar (Osk)
           expression. It mediates repression by binding to
           regulatory Bruno response elements (BREs) in the Osk
           mRNA 3' UTR. The full-length Bruno protein contains
           three RRMs, two located in the N-terminal half of the
           protein and the third near the C-terminus, separated by
           a linker region. .
          Length = 81

 Score = 74.5 bits (183), Expect = 3e-19
 Identities = 28/42 (66%), Positives = 37/42 (88%)

Query: 62  DKKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
           ++KLFVGMLSK+ NE+DVR +FAPFG+IEECTVL+  +G S+
Sbjct: 1   ERKLFVGMLSKKCNENDVRIMFAPFGSIEECTVLRDQNGQSR 42


>gnl|CDD|241078 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in CUGBP Elav-like
           family member CELF-1, CELF-2 and similar proteins.  This
           subgroup corresponds to the RRM2 of CELF-1 (also termed
           BRUNOL-2, or CUG-BP1, or EDEN-BP), CELF-2 (also termed
           BRUNOL-3, or ETR-3, or CUG-BP2, or NAPOR), both of which
           belong to the CUGBP1 and ETR-3-like factors (CELF) or
           BRUNOL (Bruno-like) family of RNA-binding proteins that
           have been implicated in the regulation of pre-mRNA
           splicing and in the control of mRNA translation and
           deadenylation. CELF-1 is strongly expressed in all adult
           and fetal tissues tested. Human CELF-1 is a nuclear and
           cytoplasmic RNA-binding protein that regulates multiple
           aspects of nuclear and cytoplasmic mRNA processing, with
           implications for onset of type 1 myotonic dystrophy
           (DM1), a neuromuscular disease associated with an
           unstable CUG triplet expansion in the 3'-UTR
           (3'-untranslated region) of the DMPK (myotonic dystrophy
           protein kinase) gene; it preferentially targets UGU-rich
           mRNA elements. It has been shown to bind to a Bruno
           response element, a cis-element involved in
           translational control of oskar mRNA in Drosophila, and
           share sequence similarity to Bruno, the Drosophila
           protein that mediates this process. The Xenopus homolog
           embryo deadenylation element-binding protein (EDEN-BP)
           mediates sequence-specific deadenylation of Eg5 mRNA. It
           binds specifically to the EDEN motif in the
           3'-untranslated regions of maternal mRNAs and targets
           these mRNAs for deadenylation and translational
           repression. CELF-1 contains three highly conserved RNA
           recognition motifs (RRMs), also known as RBDs (RNA
           binding domains) or RNPs (ribonucleoprotein domains):
           two consecutive RRMs (RRM1 and RRM2) situated in the
           N-terminal region followed by a linker region and the
           third RRM (RRM3) close to the C-terminus of the protein.
           The two N-terminal RRMs of EDEN-BP are necessary for the
           interaction with EDEN as well as a part of the linker
           region (between RRM2 and RRM3). Oligomerization of
           EDEN-BP is required for specific mRNA deadenylation and
           binding. CELF-2 is expressed in all tissues at some
           level, but highest in brain, heart, and thymus. It has
           been implicated in the regulation of nuclear and
           cytoplasmic RNA processing events, including alternative
           splicing, RNA editing, stability and translation. CELF-2
           shares high sequence identity with CELF-1, but shows
           different binding specificity; it preferentially binds
           to sequences with UG repeats and UGUU motifs. It has
           been shown to bind to a Bruno response element, a
           cis-element involved in translational control of oskar
           mRNA in Drosophila, and share sequence similarity to
           Bruno, the Drosophila protein that mediates this
           process. It also binds to the 3'-UTR of cyclooxygenase-2
           messages, affecting both translation and mRNA stability,
           and binds to apoB mRNA, regulating its C to U editing.
           CELF-2 also contains three highly conserved RRMs. It
           binds to RNA via the first two RRMs, which are also
           important for localization in the cytoplasm. The
           splicing activation or repression activity of CELF-2 on
           some specific substrates is mediated by RRM1/RRM2. Both,
           RRM1 and RRM2 of CELF-2, can activate cardiac troponin T
           (cTNT) exon 5 inclusion. In addition, CELF-2 possesses a
           typical arginine and lysine-rich nuclear localization
           signal (NLS) in the C-terminus, within RRM3. .
          Length = 81

 Score = 68.5 bits (167), Expect = 8e-17
 Identities = 26/42 (61%), Positives = 37/42 (88%)

Query: 62  DKKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
           D+KLF+GM+SK+ NE+D+R +F+PFG IEEC +L+GPDG S+
Sbjct: 1   DRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSR 42


>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in
           CELF/Bruno-like family of RNA binding proteins and plant
           flowering time control protein FCA.  This subfamily
           corresponds to the RRM1 and RRM2 domains of the CUGBP1
           and ETR-3-like factors (CELF) as well as plant flowering
           time control protein FCA. CELF, also termed BRUNOL
           (Bruno-like) proteins, is a family of structurally
           related RNA-binding proteins involved in regulation of
           pre-mRNA splicing in the nucleus, and control of mRNA
           translation and deadenylation in the cytoplasm. The
           family contains six members: CELF-1 (also known as
           BRUNOL-2, CUG-BP1, NAPOR, EDEN-BP), CELF-2 (also known
           as BRUNOL-3, ETR-3, CUG-BP2, NAPOR-2), CELF-3 (also
           known as BRUNOL-1, TNRC4, ETR-1, CAGH4, ER DA4), CELF-4
           (BRUNOL-4), CELF-5 (BRUNOL-5) and CELF-6 (BRUNOL-6).
           They all contain three highly conserved RNA recognition
           motifs (RRMs), also known as RBDs (RNA binding domains)
           or RNPs (ribonucleoprotein domains): two consecutive
           RRMs (RRM1 and RRM2) situated in the N-terminal region
           followed by a linker region and the third RRM (RRM3)
           close to the C-terminus of the protein. The low sequence
           conservation of the linker region is highly suggestive
           of a large variety in the co-factors that associate with
           the various CELF family members. Based on both, sequence
           similarity and function, the CELF family can be divided
           into two subfamilies, the first containing CELFs 1 and
           2, and the second containing CELFs 3, 4, 5, and 6. The
           different CELF proteins may act through different sites
           on at least some substrates. Furthermore, CELF proteins
           may interact with each other in varying combinations to
           influence alternative splicing in different contexts.
           This subfamily also includes plant flowering time
           control protein FCA that functions in the
           posttranscriptional regulation of transcripts involved
           in the flowering process. FCA contains two RRMs, and a
           WW protein interaction domain.  .
          Length = 77

 Score = 68.0 bits (167), Expect = 9e-17
 Identities = 21/41 (51%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 64  KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPD-GTSK 103
           KLFVG L K   E+DVR +F  +G IEE T+++  D G SK
Sbjct: 1   KLFVGQLPKTATEEDVRALFEEYGNIEEVTIIRDKDTGQSK 41


>gnl|CDD|214636 smart00360, RRM, RNA recognition motif. 
          Length = 73

 Score = 46.0 bits (110), Expect = 4e-08
 Identities = 14/41 (34%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 64  KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPD-GTSK 103
            LFVG L     E+++R++F+ FG +E   +++  + G SK
Sbjct: 1   TLFVGNLPPDTTEEELRELFSKFGKVESVRLVRDKETGKSK 41


>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous
          nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA
          recognition motif 1 (hRBMY), testis-specific
          heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T)
          and similar proteins.  This subfamily corresponds to
          the RRM domain of hnRNP G, also termed glycoprotein p43
          or RBMX, an RNA-binding motif protein located on the X
          chromosome. It is expressed ubiquitously and has been
          implicated in the splicing control of several
          pre-mRNAs. Moreover, hnRNP G may function as a
          regulator of transcription for SREBP-1c and GnRH1.
          Research has shown that hnRNP G may also act as a
          tumor-suppressor since it upregulates the Txnip gene
          and promotes the fidelity of DNA end-joining activity.
          In addition, hnRNP G appears to play a critical role in
          proper neural development of zebrafish and frog
          embryos. The family also includes several paralogs of
          hnRNP G, such as hRBMY and hnRNP G-T (also termed
          RNA-binding motif protein, X-linked-like-2). Both,
          hRBMY and hnRNP G-T, are exclusively expressed in
          testis and critical for male fertility. Like hnRNP G,
          hRBMY and hnRNP G-T interact with factors implicated in
          the regulation of pre-mRNA splicing, such as
          hTra2-beta1 and T-STAR. Although members in this family
          share a high conserved N-terminal RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), they appear to recognize
          different RNA targets. For instance, hRBMY interacts
          specifically with a stem-loop structure in which the
          loop is formed by the sequence CA/UCAA. In contrast,
          hnRNP G associates with single stranded RNA sequences
          containing a CCA/C motif. In addition to the RRM, hnRNP
          G contains a nascent transcripts targeting domain (NTD)
          in the middle region and a novel auxiliary RNA-binding
          domain (RBD) in its C-terminal region. The C-terminal
          RBD exhibits distinct RNA binding specificity, and
          would play a critical role in the regulation of
          alternative splicing by hnRNP G. .
          Length = 80

 Score = 45.7 bits (109), Expect = 7e-08
 Identities = 14/35 (40%), Positives = 22/35 (62%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGP 98
          KLFV  LS +  E ++  +F+ FG +EE  ++K P
Sbjct: 3  KLFVSGLSTRTTEKELEALFSKFGRVEEVLLMKDP 37


>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in
          RRM-containing coactivator activator/modulator (CoAA)
          and similar proteins.  This subfamily corresponds to
          the RRM in CoAA (also known as RBM14 or PSP2) and
          RNA-binding protein 4 (RBM4). CoAA is a heterogeneous
          nuclear ribonucleoprotein (hnRNP)-like protein
          identified as a nuclear receptor coactivator. It
          mediates transcriptional coactivation and RNA splicing
          effects in a promoter-preferential manner, and is
          enhanced by thyroid hormone receptor-binding protein
          (TRBP). CoAA contains two N-terminal RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and a
          TRBP-interacting domain. RBM4 is a ubiquitously
          expressed splicing factor with two isoforms, RBM4A
          (also known as Lark homolog) and RBM4B (also known as
          RBM30), which are very similar in structure and
          sequence. RBM4 may also function as a translational
          regulator of stress-associated mRNAs as well as play a
          role in micro-RNA-mediated gene regulation. RBM4
          contains two N-terminal RRMs, a CCHC-type zinc finger,
          and three alanine-rich regions within their C-terminal
          regions. This family also includes Drosophila
          RNA-binding protein lark (Dlark), a homolog of human
          RBM4. It plays an important role in embryonic
          development and in the circadian regulation of adult
          eclosion. Dlark shares high sequence similarity with
          RBM4 at the N-terminal region. However, Dlark has three
          proline-rich segments instead of three alanine-rich
          segments within the C-terminal region. .
          Length = 66

 Score = 44.9 bits (107), Expect = 7e-08
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK 96
          KLFVG L      +++R +F  +GT+ EC V+K
Sbjct: 1  KLFVGNLPDATTSEELRALFEKYGTVTECDVVK 33


>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily.  RRM,
           also known as RBD (RNA binding domain) or RNP
           (ribonucleoprotein domain), is a highly abundant domain
           in eukaryotes found in proteins involved in
           post-transcriptional gene expression processes including
           mRNA and rRNA processing, RNA export, and RNA stability.
           This domain is 90 amino acids in length and consists of
           a four-stranded beta-sheet packed against two
           alpha-helices. RRM usually interacts with ssRNA, but is
           also known to interact with ssDNA as well as proteins.
           RRM binds a variable number of nucleotides, ranging from
           two to eight. The active site includes three aromatic
           side-chains located within the conserved RNP1 and RNP2
           motifs of the domain. The RRM domain is found in a
           variety heterogeneous nuclear ribonucleoproteins
           (hnRNPs), proteins implicated in regulation of
           alternative splicing, and protein components of small
           nuclear ribonucleoproteins (snRNPs).
          Length = 72

 Score = 43.4 bits (103), Expect = 3e-07
 Identities = 17/39 (43%), Positives = 25/39 (64%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
           LFVG L     E+D+R++F+ FG IE   +++  DG SK
Sbjct: 1   LFVGNLPPDTTEEDLRELFSKFGEIESVRIVRDKDGKSK 39


>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding
          protein 45 (RBM45) and similar proteins.  This
          subfamily corresponds to the RRM1 of RBM45, also termed
          developmentally-regulated RNA-binding protein 1 (DRB1),
          a new member of RNA recognition motif (RRM)-type neural
          RNA-binding proteins, which expresses under
          spatiotemporal control. It is encoded by gene drb1 that
          is expressed in neurons, not in glial cells. RBM45
          predominantly localizes in cytoplasm of cultured cells
          and specifically binds to poly(C) RNA. It could play an
          important role during neurogenesis. RBM45 carries four
          RRMs, also known as RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). .
          Length = 81

 Score = 43.1 bits (102), Expect = 5e-07
 Identities = 17/37 (45%), Positives = 26/37 (70%), Gaps = 1/37 (2%)

Query: 60 PPDKKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK 96
          PP+ +LF+ +  K   EDD+R+ FAPFG I++  V+K
Sbjct: 1  PPNSRLFI-VCGKSVTEDDLREAFAPFGEIQDIWVVK 36


>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif. (a.k.a. RRM, RBD, or RNP
           domain).  The RRM motif is probably diagnostic of an RNA
           binding protein. RRMs are found in a variety of RNA
           binding proteins, including various hnRNP proteins,
           proteins implicated in regulation of alternative
           splicing, and protein components of snRNPs. The motif
           also appears in a few single stranded DNA binding
           proteins. The RRM structure consists of four strands and
           two helices arranged in an alpha/beta sandwich, with a
           third helix present during RNA binding in some cases The
           C-terminal beta strand (4th strand) and final helix are
           hard to align and have been omitted in the SEED
           alignment The LA proteins have an N terminal rrm which
           is included in the seed. There is a second region
           towards the C terminus that has some features
           characteristic of a rrm but does not appear to have the
           important structural core of a rrm. The LA proteins are
           one of the main autoantigens in Systemic lupus
           erythematosus (SLE), an autoimmune disease.
          Length = 70

 Score = 41.4 bits (98), Expect = 2e-06
 Identities = 15/39 (38%), Positives = 23/39 (58%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
           LFVG L     E+D++ +F+ FG IE   +++   G SK
Sbjct: 1   LFVGNLPPDTTEEDLKDLFSKFGPIESIRIVRDETGRSK 39


>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP
          Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6
          and similar proteins.  This subfamily corresponds to
          the RRM1 of CELF-3, CELF-4, CELF-5, CELF-6, all of
          which belong to the CUGBP1 and ETR-3-like factors
          (CELF) or BRUNOL (Bruno-like) family of RNA-binding
          proteins that display dual nuclear and cytoplasmic
          localizations and have been implicated in the
          regulation of pre-mRNA splicing and in the control of
          mRNA translation and deadenylation. CELF-3, expressed
          in brain and testis only, is also known as bruno-like
          protein 1 (BRUNOL-1), or CAG repeat protein 4, or
          CUG-BP- and ETR-3-like factor 3, or embryonic lethal
          abnormal vision (ELAV)-type RNA-binding protein 1
          (ETR-1), or expanded repeat domain protein CAG/CTG 4,
          or trinucleotide repeat-containing gene 4 protein
          (TNRC4). It plays an important role in the pathogenesis
          of tauopathies. CELF-3 contains three highly conserved
          RNA recognition motifs (RRMs), also known as RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains):
          two consecutive RRMs (RRM1 and RRM2) situated in the
          N-terminal region followed by a linker region and the
          third RRM (RRM3) close to the C-terminus of the
          protein.The effect of CELF-3 on tau splicing is
          mediated mainly by the RNA-binding activity of RRM2.
          The divergent linker region might mediate the
          interaction of CELF-3 with other proteins regulating
          its activity or involved in target recognition. CELF-4,
          highly expressed throughout the brain and in glandular
          tissues, moderately expressed in heart, skeletal
          muscle, and liver, is also known as bruno-like protein
          4 (BRUNOL-4), or CUG-BP- and ETR-3-like factor 4. Like
          CELF-3, CELF-4 also contain three highly conserved
          RRMs. The splicing activation or repression activity of
          CELF-4 on some specific substrates is mediated by its
          RRM1/RRM2. On the other hand, both RRM1 and RRM2 of
          CELF-4 can activate cardiac troponin T (cTNT) exon 5
          inclusion. CELF-5, expressed in brain, is also known as
          bruno-like protein 5 (BRUNOL-5), or CUG-BP- and
          ETR-3-like factor 5. Although its biological role
          remains unclear, CELF-5 shares same domain architecture
          with CELF-3. CELF-6, strongly expressed in kidney,
          brain, and testis, is also known as bruno-like protein
          6 (BRUNOL-6), or CUG-BP- and ETR-3-like factor 6. It
          activates exon inclusion of a cardiac troponin T
          minigene in transient transfection assays in an
          muscle-specific splicing enhancer (MSE)-dependent
          manner and can activate inclusion via multiple copies
          of a single element, MSE2. CELF-6 also promotes
          skipping of exon 11 of insulin receptor, a known target
          of CELF activity that is expressed in kidney. In
          additiona to three highly conserved RRMs, CELF-6 also
          possesses numerous potential phosphorylation sites, a
          potential nuclear localization signal (NLS) at the C
          terminus, and an alanine-rich region within the
          divergent linker region. .
          Length = 87

 Score = 41.6 bits (98), Expect = 3e-06
 Identities = 17/33 (51%), Positives = 21/33 (63%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK 96
          KLFVG + +   E D+R +F  FG I E TVLK
Sbjct: 7  KLFVGQIPRNLEEKDLRPLFEQFGKIYELTVLK 39


>gnl|CDD|240803 cd12357, RRM_PPARGC1A_like, RNA recognition motif in the peroxisome
           proliferator-activated receptor gamma coactivator 1A
           (PGC-1alpha) family of regulated coactivators.  This
           subfamily corresponds to the RRM of PGC-1alpha,
           PGC-1beta, and PGC-1-related coactivator (PRC), which
           serve as mediators between environmental or endogenous
           signals and the transcriptional machinery governing
           mitochondrial biogenesis. They play an important
           integrative role in the control of respiratory gene
           expression through interacting with a number of
           transcription factors, such as NRF-1, NRF-2, ERR, CREB
           and YY1. All family members are multi-domain proteins
           containing the N-terminal activation domain, an LXXLL
           coactivator signature, a tetrapeptide motif (DHDY)
           responsible for HCF binding, and an RNA recognition
           motif (RRM), also termed RBD (RNA binding domain) or RNP
           (ribonucleoprotein domain). In contrast to PGC-1alpha
           and PRC, PGC-1beta possesses two glutamic/aspartic
           acid-rich acidic domains, but lacks most of the
           arginine/serine (SR)-rich domain that is responsible for
           the regulation of RNA processing. .
          Length = 89

 Score = 41.5 bits (98), Expect = 3e-06
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTS 102
           ++VG +       ++R+ F PFG IEE T+    DG +
Sbjct: 5   IYVGKIPIDTTRSELRQRFQPFGEIEEITLHFRDDGDN 42


>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding
           protein 28 (RBM28) and similar proteins.  This subfamily
           corresponds to the RRM2 of RBM28 and Nop4p. RBM28 is a
           specific nucleolar component of the spliceosomal small
           nuclear ribonucleoproteins (snRNPs), possibly
           coordinating their transition through the nucleolus. It
           specifically associates with U1, U2, U4, U5, and U6
           small nuclear RNAs (snRNAs), and may play a role in the
           maturation of both small nuclear and ribosomal RNAs.
           RBM28 has four RNA recognition motifs (RRMs), also
           termed RBDs (RNA binding domains) or RNPs
           (ribonucleoprotein domains), and an extremely acidic
           region between RRM2 and RRM3. The family also includes
           nucleolar protein 4 (Nop4p or Nop77p) encoded by YPL043W
           from Saccharomyces cerevisiae. It is an essential
           nucleolar protein involved in processing and maturation
           of 27S pre-rRNA and biogenesis of 60S ribosomal
           subunits. Nop4p also contains four RRMs.  .
          Length = 76

 Score = 40.3 bits (95), Expect = 6e-06
 Identities = 16/40 (40%), Positives = 25/40 (62%)

Query: 64  KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
           +L V  L  +  E D++K+F+PFG + E T+ + PDG  K
Sbjct: 1   RLIVRNLPFKCTEADLKKLFSPFGFVWEVTIPRKPDGKKK 40


>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter
           pylori HP0827 protein and similar proteins.  This
           subfamily corresponds to the RRM of H. pylori HP0827, a
           putative ssDNA-binding protein 12rnp2 precursor,
           containing one RNA recognition motif (RRM), also termed
           RBD (RNA binding domain) or RNP (ribonucleoprotein
           domain). The ssDNA binding may be important in
           activation of HP0827. .
          Length = 78

 Score = 40.3 bits (95), Expect = 7e-06
 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 64  KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPD-GTSK 103
            L+VG L     E+D++ +F  FG +    V+   + G S+
Sbjct: 1   NLYVGNLPYNVTEEDLKDLFGQFGEVTSARVITDRETGRSR 41


>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end)
           protein family.  This subfamily corresponds to the RRM2
           domain in the Spen (split end) protein family which
           includes RNA binding motif protein 15 (RBM15), putative
           RNA binding motif protein 15B (RBM15B), and similar
           proteins found in Metazoa. RBM15, also termed one-twenty
           two protein 1 (OTT1), conserved in eukaryotes, is a
           novel mRNA export factor and component of the NXF1
           pathway. It binds to NXF1 and serves as receptor for the
           RNA export element RTE. It also possess mRNA export
           activity and can facilitate the access of DEAD-box
           protein DBP5 to mRNA at the nuclear pore complex (NPC).
           RNA-binding protein 15B (RBM15B), also termed one
           twenty-two 3 (OTT3), is a paralog of RBM15 and therefore
           has post-transcriptional regulatory activity. It is a
           nuclear protein sharing with RBM15 the association with
           the splicing factor compartment and the nuclear envelope
           as well as the binding to mRNA export factors NXF1 and
           Aly/REF. Members in this family belong to the Spen
           (split end) protein family, which share a domain
           architecture comprising of three N-terminal RNA
           recognition motifs (RRMs), also known as RBD (RNA
           binding domain) or RNP (ribonucleoprotein domain), and a
           C-terminal SPOC (Spen paralog and ortholog C-terminal)
           domain. .
          Length = 79

 Score = 40.1 bits (94), Expect = 1e-05
 Identities = 12/37 (32%), Positives = 21/37 (56%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGT 101
           LFVG L     E+++R+ F  +G +E+  + + P G 
Sbjct: 5   LFVGNLEITITEEELRRAFERYGVVEDVDIKRPPRGQ 41


>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic
           RNA-binding protein RBM24, RBM38 and similar proteins.
           This subfamily corresponds to the RRM of RBM24 and RBM38
           from vertebrate, SUPpressor family member SUP-12 from
           Caenorhabditis elegans and similar proteins. Both, RBM24
           and RBM38, are preferentially expressed in cardiac and
           skeletal muscle tissues. They regulate myogenic
           differentiation by controlling the cell cycle in a
           p21-dependent or -independent manner. RBM24, also termed
           RNA-binding region-containing protein 6, interacts with
           the 3'-untranslated region (UTR) of myogenin mRNA and
           regulates its stability in C2C12 cells. RBM38, also
           termed CLL-associated antigen KW-5, or HSRNASEB, or
           RNA-binding region-containing protein 1(RNPC1), or
           ssDNA-binding protein SEB4, is a direct target of the
           p53 family. It is required for maintaining the stability
           of the basal and stress-induced p21 mRNA by binding to
           their 3'-UTRs. It also binds the AU-/U-rich elements in
           p63 3'-UTR and regulates p63 mRNA stability and
           activity. SUP-12 is a novel tissue-specific splicing
           factor that controls muscle-specific splicing of the
           ADF/cofilin pre-mRNA in C. elegans. All family members
           contain a conserved RNA recognition motif (RRM), also
           termed RBD (RNA binding domain) or RNP
           (ribonucleoprotein domain). .
          Length = 76

 Score = 39.5 bits (93), Expect = 1e-05
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 1/42 (2%)

Query: 63  KKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKG-PDGTSK 103
            K+FVG L     +D +RK F+ FG IEE  V+     G S+
Sbjct: 1   TKIFVGGLPYHTTDDSLRKYFSQFGEIEEAVVITDRQTGKSR 42


>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate
           RNA-binding protein RBM23, RBM39 and similar proteins.
           This subfamily corresponds to the RRM2 of RBM39 (also
           termed HCC1), a nuclear autoantigen that contains an
           N-terminal arginine/serine rich (RS) motif and three RNA
           recognition motifs (RRMs), also termed RBDs (RNA binding
           domains) or RNPs (ribonucleoprotein domains). An
           octapeptide sequence called the RS-ERK motif is repeated
           six times in the RS region of RBM39. Although the
           cellular function of RBM23 remains unclear, it shows
           high sequence homology to RBM39 and contains two RRMs.
           It may possibly function as a pre-mRNA splicing factor.
           .
          Length = 73

 Score = 39.5 bits (93), Expect = 1e-05
 Identities = 19/40 (47%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPD-GTSK 103
           L+VG L     EDD+R IF PFG IE   + + P+ G SK
Sbjct: 1   LYVGNLHFNITEDDLRGIFEPFGEIEFVQLQRDPETGRSK 40


>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12
          small nuclear ribonucleoprotein 35 kDa protein
          (U11/U12-35K) and similar proteins.  This subfamily
          corresponds to the RRM of U11/U12-35K, also termed
          protein HM-1, or U1 snRNP-binding protein homolog, and
          is one of the components of the U11/U12 snRNP, which is
          a subunit of the minor (U12-dependent) spliceosome
          required for splicing U12-type nuclear pre-mRNA
          introns. U11/U12-35K is highly conserved among
          bilateria and plants, but lacks in some organisms, such
          as Saccharomyces cerevisiae and Caenorhabditis elegans.
          Moreover, U11/U12-35K shows significant sequence
          homology to U1 snRNP-specific 70 kDa protein (U1-70K or
          snRNP70). It contains a conserved RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), followed by an adjacent
          glycine-rich region, and Arg-Asp and Arg-Glu dipeptide
          repeats rich domain, making U11/U12-35K a possible
          functional analog of U1-70K. It may facilitate 5'
          splice site recognition in the minor spliceosome and
          play a role in exon bridging, interacting with
          components of the major spliceosome bound to the
          pyrimidine tract of an upstream U2-type intron. The
          family corresponds to the RRM of U11/U12-35K that may
          directly contact the U11 or U12 snRNA through the RRM
          domain.
          Length = 93

 Score = 39.9 bits (94), Expect = 1e-05
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 61 PDKKLFVGMLSKQQNEDDVRKIFAPFGTIEEC 92
          P   LFVG LS Q  E+ +R++F+ +G I   
Sbjct: 2  PYLTLFVGRLSLQTTEETLREVFSRYGDIRRL 33



 Score = 25.7 bits (57), Expect = 2.9
 Identities = 9/18 (50%), Positives = 10/18 (55%)

Query: 15 PDKKLFVGMLSKQQNEDD 32
          P   LFVG LS Q  E+ 
Sbjct: 2  PYLTLFVGRLSLQTTEET 19


>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in
           granule-associated RNA binding proteins p40-TIA-1 and
           TIAR.  This subfamily corresponds to the RRM2 of
           nucleolysin TIA-1 isoform p40 (p40-TIA-1 or TIA-1) and
           nucleolysin TIA-1-related protein (TIAR), both of which
           are granule-associated RNA binding proteins involved in
           inducing apoptosis in cytotoxic lymphocyte (CTL) target
           cells. TIA-1 and TIAR share high sequence similarity.
           They are expressed in a wide variety of cell types.
           TIA-1 can be phosphorylated by a serine/threonine kinase
           that is activated during Fas-mediated apoptosis. TIAR is
           mainly localized in the nucleus of hematopoietic and
           nonhematopoietic cells. It is translocated from the
           nucleus to the cytoplasm in response to exogenous
           triggers of apoptosis. Both, TIA-1 and TIAR, bind
           specifically to poly(A) but not to poly(C) homopolymers.
           They are composed of three N-terminal highly homologous
           RNA recognition motifs (RRMs), also termed RBDs (RNA
           binding domains) or RNPs (ribonucleoprotein domains),
           and a glutamine-rich C-terminal auxiliary domain
           containing a lysosome-targeting motif. TIA-1 and TIAR
           interact with RNAs containing short stretches of
           uridylates and their RRM2 can mediate the specific
           binding to uridylate-rich RNAs. The C-terminal auxiliary
           domain may be responsible for interacting with other
           proteins. In addition, TIA-1 and TIAR share a potential
           serine protease-cleavage site (Phe-Val-Arg) localized at
           the junction between their RNA binding domains and their
           C-terminal auxiliary domains.
          Length = 75

 Score = 39.3 bits (92), Expect = 2e-05
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPD-GTSK 103
           +FVG LS + + + +R  FAPFG I +  V+K    G SK
Sbjct: 2   IFVGDLSPEIDTETLRAAFAPFGEISDARVVKDMQTGKSK 41


>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in
          heterogeneous nuclear ribonucleoprotein hnRNP A and
          hnRNP D subfamilies and similar proteins.  This
          subfamily corresponds to the RRM1 in the hnRNP A
          subfamily which includes hnRNP A0, hnRNP A1, hnRNP
          A2/B1, hnRNP A3 and similar proteins. hnRNP A0 is a low
          abundance hnRNP protein that has been implicated in
          mRNA stability in mammalian cells. hnRNP A1 is an
          abundant eukaryotic nuclear RNA-binding protein that
          may modulate splice site selection in pre-mRNA
          splicing. hnRNP A2/B1 is an RNA trafficking response
          element-binding protein that interacts with the hnRNP
          A2 response element (A2RE). hnRNP A3 is also a RNA
          trafficking response element-binding protein that
          participates in the trafficking of A2RE-containing RNA.
          The hnRNP A subfamily is characterized by two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          followed by a long glycine-rich region at the
          C-terminus. The hnRNP D subfamily includes hnRNP D0,
          hnRNP A/B, hnRNP DL and similar proteins. hnRNP D0 is a
          UUAG-specific nuclear RNA binding protein that may be
          involved in pre-mRNA splicing and telomere elongation.
          hnRNP A/B is an RNA unwinding protein with a high
          affinity for G- followed by U-rich regions. hnRNP A/B
          has also been identified as an APOBEC1-binding protein
          that interacts with apolipoprotein B (apoB) mRNA
          transcripts around the editing site and thus, plays an
          important role in apoB mRNA editing. hnRNP DL (or hnRNP
          D-like) is a dual functional protein that possesses
          DNA- and RNA-binding properties. It has been implicated
          in mRNA biogenesis at the transcriptional and
          post-transcriptional levels. All members in this
          subfamily contain two putative RRMs and a glycine- and
          tyrosine-rich C-terminus. The family also contains
          DAZAP1 (Deleted in azoospermia-associated protein 1),
          RNA-binding protein Musashi homolog Musashi-1,
          Musashi-2 and similar proteins. They all harbor two
          RRMs. .
          Length = 72

 Score = 39.1 bits (92), Expect = 2e-05
 Identities = 12/34 (35%), Positives = 22/34 (64%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGP 98
          LF+G LS    E+ +R+ F+ +G + +C ++K P
Sbjct: 1  LFIGGLSWDTTEESLREYFSKYGEVVDCVIMKDP 34


>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in
          heterogeneous nuclear ribonucleoprotein A subfamily.
          This subfamily corresponds to the RRM1 in hnRNP A0,
          hnRNP A1, hnRNP A2/B1, hnRNP A3 and similar proteins.
          hnRNP A0 is a low abundance hnRNP protein that has been
          implicated in mRNA stability in mammalian cells. It has
          been identified as the substrate for MAPKAP-K2 and may
          be involved in the lipopolysaccharide (LPS)-induced
          post-transcriptional regulation of tumor necrosis
          factor-alpha (TNF-alpha), cyclooxygenase 2 (COX-2) and
          macrophage inflammatory protein 2 (MIP-2). hnRNP A1 is
          an abundant eukaryotic nuclear RNA-binding protein that
          may modulate splice site selection in pre-mRNA
          splicing. hnRNP A2/B1 is an RNA trafficking response
          element-binding protein that interacts with the hnRNP
          A2 response element (A2RE). Many mRNAs, such as myelin
          basic protein (MBP), myelin-associated oligodendrocytic
          basic protein (MOBP), carboxyanhydrase II (CAII),
          microtubule-associated protein tau, and amyloid
          precursor protein (APP) are trafficked by hnRNP A2/B1.
          hnRNP A3 is also a RNA trafficking response
          element-binding protein that participates in the
          trafficking of A2RE-containing RNA. The hnRNP A
          subfamily is characterized by two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), followed by a long
          glycine-rich region at the C-terminus. .
          Length = 78

 Score = 38.9 bits (91), Expect = 3e-05
 Identities = 14/35 (40%), Positives = 23/35 (65%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGP 98
          KLF+G LS +  +D ++  F+ +G I +C V+K P
Sbjct: 1  KLFIGGLSYETTDDSLKNYFSQWGEITDCVVMKDP 35


>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate
          RRM-containing coactivator activator/modulator (CoAA). 
          This subgroup corresponds to the RRM1 of CoAA, also
          termed RNA-binding protein 14 (RBM14), or paraspeckle
          protein 2 (PSP2), or synaptotagmin-interacting protein
          (SYT-interacting protein), a heterogeneous nuclear
          ribonucleoprotein (hnRNP)-like protein identified as a
          nuclear receptor coactivator. It mediates
          transcriptional coactivation and RNA splicing effects
          in a promoter-preferential manner and is enhanced by
          thyroid hormone receptor-binding protein (TRBP). CoAA
          contains two N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a TRBP-interacting
          domain. It stimulates transcription through its
          interactions with coactivators, such as TRBP and
          CREB-binding protein CBP/p300, via the TRBP-interacting
          domain and interaction with an RNA-containing complex,
          such as DNA-dependent protein kinase-poly(ADP-ribose)
          polymerase complexes, via the RRMs. .
          Length = 69

 Score = 38.6 bits (90), Expect = 3e-05
 Identities = 9/33 (27%), Positives = 22/33 (66%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK 96
          K+FVG + +  +++++R +F  +G +  C V++
Sbjct: 2  KIFVGNVDEDTSQEELRALFEAYGAVLSCAVMR 34


>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate
          RRM-containing coactivator activator/modulator (CoAA). 
          This subgroup corresponds to the RRM2 of CoAA, also
          termed RNA-binding protein 14 (RBM14), or paraspeckle
          protein 2 (PSP2), or synaptotagmin-interacting protein
          (SYT-interacting protein), a heterogeneous nuclear
          ribonucleoprotein (hnRNP)-like protein identified as a
          nuclear receptor coactivator. It mediates
          transcriptional coactivation and RNA splicing effects
          in a promoter-preferential manner and is enhanced by
          thyroid hormone receptor-binding protein (TRBP). CoAA
          contains two N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a TRBP-interacting
          domain. It stimulates transcription through its
          interactions with coactivators, such as TRBP and
          CREB-binding protein CBP/p300, via the TRBP-interacting
          domain and interaction with an RNA-containing complex,
          such as DNA-dependent protein kinase-poly(ADP-ribose)
          polymerase complexes, via the RRMs. .
          Length = 68

 Score = 38.3 bits (89), Expect = 3e-05
 Identities = 13/34 (38%), Positives = 20/34 (58%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKG 97
          K+FVG +S     D++R +F  FG + EC  +K 
Sbjct: 2  KIFVGNVSATCTSDELRGLFEEFGRVVECDKVKD 35


>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family.  This model
           represents a subfamily of RNA splicing factors including
           the Pad-1 protein (N. crassa), CAPER (M. musculus) and
           CC1.3 (H.sapiens). These proteins are characterized by
           an N-terminal arginine-rich, low complexity domain
           followed by three (or in the case of 4 H. sapiens
           paralogs, two) RNA recognition domains (rrm: pfam00706).
           These splicing factors are closely related to the U2AF
           splicing factor family (TIGR01642). A homologous gene
           from Plasmodium falciparum was identified in the course
           of the analysis of that genome at TIGR and was included
           in the seed.
          Length = 457

 Score = 40.6 bits (95), Expect = 3e-05
 Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 60  PPDKKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPD-GTSK 103
           P   KL+VG L     E ++R+IF PFG IE+  + + P+ G SK
Sbjct: 184 PNFLKLYVGNLHFNITEQELRQIFEPFGDIEDVQLHRDPETGRSK 228


>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate
          RNA-binding protein 4 (RBM4).  This subgroup
          corresponds to the RRM1 of RBM4, a ubiquitously
          expressed splicing factor that has two isoforms, RBM4A
          (also known as Lark homolog) and RBM4B (also known as
          RBM30), which are very similar in structure and
          sequence. RBM4 may function as a translational
          regulator of stress-associated mRNAs and also plays a
          role in micro-RNA-mediated gene regulation. RBM4
          contains two N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), a CCHC-type zinc finger,
          and three alanine-rich regions within their C-terminal
          regions. The C-terminal region may be crucial for
          nuclear localization and protein-protein interaction.
          The RRMs, in combination with the C-terminal region,
          are responsible for the splicing function of RBM4. .
          Length = 67

 Score = 38.3 bits (89), Expect = 3e-05
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK 96
          KLFVG L  +  E ++R +F  +G + EC ++K
Sbjct: 2  KLFVGNLPPEATEQEIRSLFEQYGKVLECDIIK 34


>gnl|CDD|241075 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 1 in CUGBP
          Elav-like family member CELF-1, CELF-2, Drosophila
          melanogaster Bruno protein and similar proteins.  This
          subgroup corresponds to the RRM1 of CELF-1, CELF-2 and
          Bruno protein. CELF-1 (also termed BRUNOL-2, or
          CUG-BP1, or EDEN-BP) and CELF-2 (also termed BRUNOL-3,
          or ETR-3, or CUG-BP2, or NAPOR) belong to the CUGBP1
          and ETR-3-like factors (CELF) or BRUNOL (Bruno-like)
          family of RNA-binding proteins that have been
          implicated in regulation of pre-mRNA splicing, and
          control of mRNA translation and deadenylation. CELF-1
          is strongly expressed in all adult and fetal tissues
          tested. The human CELF-1 is a nuclear and cytoplasmic
          RNA-binding protein that regulates multiple aspects of
          nuclear and cytoplasmic mRNA processing, with
          implications for onset of type 1 myotonic dystrophy
          (DM1), a neuromuscular disease associated with an
          unstable CUG triplet expansion in the 3'-UTR
          (3'-untranslated region) of the DMPK (myotonic
          dystrophy protein kinase) gene; it preferentially
          targets UGU-rich mRNA elements. It has been shown to
          bind to a Bruno response element, a cis-element
          involved in translational control of oskar mRNA in
          Drosophila, and share sequence similarity to Bruno, the
          Drosophila protein that mediates this process. The
          Xenopus homolog embryo deadenylation element-binding
          protein (EDEN-BP) mediates sequence-specific
          deadenylation of Eg5 mRNA. It binds specifically to the
          EDEN motif in the 3'-untranslated regions of maternal
          mRNAs and targets these mRNAs for deadenylation and
          translational repression. CELF-1 contain three highly
          conserved RNA recognition motifs (RRMs), also known as
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains): two consecutive RRMs (RRM1 and RRM2) situated
          in the N-terminal region followed by a linker region
          and the third RRM (RRM3) close to the C-terminus of the
          protein. The two N-terminal RRMs of EDEN-BP are
          necessary for the interaction with EDEN as well as a
          part of the linker region (between RRM2 and RRM3).
          Oligomerization of EDEN-BP is required for specific
          mRNA deadenylation and binding. CELF-2 is expressed in
          all tissues at some level, but highest in brain, heart,
          and thymus. It has been implicated in the regulation of
          nuclear and cytoplasmic RNA processing events,
          including alternative splicing, RNA editing, stability
          and translation. CELF-2 shares high sequence identity
          with CELF-1, but shows different binding specificity;
          it binds preferentially to sequences with UG repeats
          and UGUU motifs. It has been shown to bind to a Bruno
          response element, a cis-element involved in
          translational control of oskar mRNA in Drosophila, and
          share sequence similarity to Bruno, the Drosophila
          protein that mediates this process. It also binds to
          the 3'-UTR of cyclooxygenase-2 messages, affecting both
          translation and mRNA stability, and binds to apoB mRNA,
          regulating its C to U editing. CELF-2 also contains
          three highly conserved RRMs. It binds to RNA via the
          first two RRMs, which are also important for
          localization in the cytoplasm. The splicing activation
          or repression activity of CELF-2 on some specific
          substrates is mediated by RRM1/RRM2. Both, RRM1 and
          RRM2 of CELF-2, can activate cardiac troponin T (cTNT)
          exon 5 inclusion. In addition, CELF-2 possesses a
          typical arginine and lysine-rich nuclear localization
          signal (NLS) in the C-terminus, within RRM3. This
          subgroup also includes Drosophila melanogaster Bruno
          protein, which plays a central role in regulation of
          Oskar (Osk) expression in flies. It mediates repression
          by binding to regulatory Bruno response elements (BREs)
          in the Osk mRNA 3' UTR. The full-length Bruno protein
          contains three RRMs, two located in the N-terminal half
          of the protein and the third near the C-terminus,
          separated by a linker region. .
          Length = 84

 Score = 38.6 bits (90), Expect = 4e-05
 Identities = 11/33 (33%), Positives = 22/33 (66%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK 96
          K+FVG + +  +E D+R++F  +G + +  VL+
Sbjct: 3  KMFVGQIPRSWSEKDLRELFEQYGAVYQINVLR 35


>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I
           polyadenylate-binding proteins.  This subfamily
           corresponds to the RRM4 of type I poly(A)-binding
           proteins (PABPs), highly conserved proteins that bind to
           the poly(A) tail present at the 3' ends of most
           eukaryotic mRNAs. They have been implicated in theThe CD
           corresponds to the RRM. regulation of poly(A) tail
           length during the polyadenylation reaction, translation
           initiation, mRNA stabilization by influencing the rate
           of deadenylation and inhibition of mRNA decapping. The
           family represents type I polyadenylate-binding proteins
           (PABPs), including polyadenylate-binding protein 1
           (PABP-1 or PABPC1), polyadenylate-binding protein 3
           (PABP-3 or PABPC3), polyadenylate-binding protein 4
           (PABP-4 or APP-1 or iPABP), polyadenylate-binding
           protein 5 (PABP-5 or PABPC5), polyadenylate-binding
           protein 1-like (PABP-1-like or PABPC1L),
           polyadenylate-binding protein 1-like 2 (PABPC1L2 or
           RBM32), polyadenylate-binding protein 4-like
           (PABP-4-like or PABPC4L), yeast polyadenylate-binding
           protein, cytoplasmic and nuclear (PABP or ACBP-67), and
           similar proteins. PABP-1 is an ubiquitously expressed
           multifunctional protein that may play a role in 3' end
           formation of mRNA, translation initiation, mRNA
           stabilization, protection of poly(A) from nuclease
           activity, mRNA deadenylation, inhibition of mRNA
           decapping, and mRNP maturation. Although PABP-1 is
           thought to be a cytoplasmic protein, it is also found in
           the nucleus. PABP-1 may be involved in nucleocytoplasmic
           trafficking and utilization of mRNP particles. PABP-1
           contains four copies of RNA recognition motifs (RRMs),
           also termed RBDs (RNA binding domains) or RNPs
           (ribonucleoprotein domains), a less well conserved
           linker region, and a proline-rich C-terminal conserved
           domain (CTD). PABP-3 is a testis-specific
           poly(A)-binding protein specifically expressed in round
           spermatids. It is mainly found in mammalian and may play
           an important role in the testis-specific regulation of
           mRNA homeostasis. PABP-3 shows significant sequence
           similarity to PABP-1. However, it binds to poly(A) with
           a lower affinity than PABP-1. Moreover, PABP-1 possesses
           an A-rich sequence in its 5'-UTR and allows binding of
           PABP and blockage of translation of its own mRNA. In
           contrast, PABP-3 lacks the A-rich sequence in its
           5'-UTR. PABP-4 is an inducible poly(A)-binding protein
           (iPABP) that is primarily localized to the cytoplasm. It
           shows significant sequence similarity to PABP-1 as well.
           The RNA binding properties of PABP-1 and PABP-4 appear
           to be identical. PABP-5 is encoded by PABPC5 gene within
           the X-specific subinterval, and expressed in fetal brain
           and in a range of adult tissues in mammalian, such as
           ovary and testis. It may play an important role in germ
           cell development. Moreover, unlike other PABPs, PABP-5
           contains only four RRMs, but lacks both the linker
           region and the CTD. PABP-1-like and PABP-1-like 2 are
           the orthologs of PABP-1. PABP-4-like is the ortholog of
           PABP-5. Their cellular functions remain unclear. The
           family also includes the yeast PABP, a conserved poly(A)
           binding protein containing poly(A) tails that can be
           attached to the 3'-ends of mRNAs. The yeast PABP and its
           homologs may play important roles in the initiation of
           translation and in mRNA decay. Like vertebrate PABP-1,
           the yeast PABP contains four RRMs, a linker region, and
           a proline-rich CTD as well. The first two RRMs are
           mainly responsible for specific binding to poly(A). The
           proline-rich region may be involved in protein-protein
           interactions. .
          Length = 79

 Score = 38.4 bits (90), Expect = 4e-05
 Identities = 14/40 (35%), Positives = 22/40 (55%)

Query: 64  KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
            L+V  L    +++ +R+ F+PFGTI    V+    G SK
Sbjct: 3   NLYVKNLDDSIDDERLREEFSPFGTITSAKVMTDEKGRSK 42


>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible
          RNA binding protein (CIRBP), RNA binding motif protein
          3 (RBM3) and similar proteins.  This subfamily
          corresponds to the RRM domain of two structurally
          related heterogenous nuclear ribonucleoproteins, CIRBP
          (also termed CIRP or A18 hnRNP) and RBM3 (also termed
          RNPL), both of which belong to a highly conserved cold
          shock proteins family. The cold shock proteins can be
          induced after exposure to a moderate cold-shock and
          other cellular stresses such as UV radiation and
          hypoxia. CIRBP and RBM3 may function in
          posttranscriptional regulation of gene expression by
          binding to different transcripts, thus allowing the
          cell to response rapidly to environmental signals.
          However, the kinetics and degree of cold induction are
          different between CIRBP and RBM3. Tissue distribution
          of their expression is different. CIRBP and RBM3 may be
          differentially regulated under physiological and stress
          conditions and may play distinct roles in cold
          responses of cells. CIRBP, also termed glycine-rich
          RNA-binding protein CIRP, is localized in the nucleus
          and mediates the cold-induced suppression of cell cycle
          progression. CIRBP also binds DNA and possibly serves
          as a chaperone that assists in the folding/unfolding,
          assembly/disassembly and transport of various proteins.
          RBM3 may enhance global protein synthesis and the
          formation of active polysomes while reducing the levels
          of ribonucleoprotein complexes containing microRNAs.
          RBM3 may also serve to prevent the loss of muscle mass
          by its ability to decrease cell death. Furthermore,
          RBM3 may be essential for cell proliferation and
          mitosis. Both, CIRBP and RBM3, contain an N-terminal
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain), that
          is involved in RNA binding, and C-terminal glycine-rich
          domain (RGG motif) that probably enhances RNA-binding
          via protein-protein and/or protein-RNA interactions.
          Like CIRBP, RBM3 can also bind to both RNA and DNA via
          its RRM domain. .
          Length = 80

 Score = 38.3 bits (89), Expect = 5e-05
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK 96
          KLF+G LS   NE  + ++F+ +G I E  V+K
Sbjct: 2  KLFIGGLSFDTNEQSLEQVFSKYGQISEVVVVK 34


>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering
          time control protein FCA and similar proteins.  This
          subgroup corresponds to the RRM2 of FCA, a gene
          controlling flowering time in Arabidopsis, which
          encodes a flowering time control protein that functions
          in the posttranscriptional regulation of transcripts
          involved in the flowering process. The flowering time
          control protein FCA contains two RNA recognition motifs
          (RRMs), also known as RBDs (RNA binding domains) or RNP
          (ribonucleoprotein domains), and a WW protein
          interaction domain. .
          Length = 80

 Score = 38.3 bits (89), Expect = 5e-05
 Identities = 14/33 (42%), Positives = 25/33 (75%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK 96
          KLFVG L+KQ  E +V ++F+P+G +E+  +++
Sbjct: 1  KLFVGCLNKQATEKEVEEVFSPYGRVEDIYMMR 33


>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in
          azoospermia-associated protein 1 (DAZAP1) and similar
          proteins.  This subfamily corresponds to the RRM2 of
          DAZAP1 or DAZ-associated protein 1, also termed
          proline-rich RNA binding protein (Prrp), a
          multi-functional ubiquitous RNA-binding protein
          expressed most abundantly in the testis and essential
          for normal cell growth, development, and
          spermatogenesis. DAZAP1 is a shuttling protein whose
          acetylated is predominantly nuclear and the
          nonacetylated form is in cytoplasm. DAZAP1 also
          functions as a translational regulator that activates
          translation in an mRNA-specific manner. DAZAP1 was
          initially identified as a binding partner of Deleted in
          Azoospermia (DAZ). It also interacts with numerous
          hnRNPs, including hnRNP U, hnRNP U like-1, hnRNPA1,
          hnRNPA/B, and hnRNP D, suggesting DAZAP1 might
          associate and cooperate with hnRNP particles to
          regulate adenylate-uridylate-rich elements (AU-rich
          element or ARE)-containing mRNAs. DAZAP1 contains two
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), and a C-terminal proline-rich domain. .
          Length = 80

 Score = 37.7 bits (88), Expect = 6e-05
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 63 KKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVL 95
          KK+FVG L     E D+RK F+ FGT+ E  V+
Sbjct: 3  KKIFVGGLPPNVTETDLRKYFSQFGTVTEVVVM 35


>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in
          heterogeneous nuclear ribonucleoprotein A subfamily.
          This subfamily corresponds to the RRM2 of hnRNP A0,
          hnRNP A1, hnRNP A2/B1, hnRNP A3 and similar proteins.
          hnRNP A0 is a low abundance hnRNP protein that has been
          implicated in mRNA stability in mammalian cells. It has
          been identified as the substrate for MAPKAP-K2 and may
          be involved in the lipopolysaccharide (LPS)-induced
          post-transcriptional regulation of tumor necrosis
          factor-alpha (TNF-alpha), cyclooxygenase 2 (COX-2) and
          macrophage inflammatory protein 2 (MIP-2). hnRNP A1 is
          an abundant eukaryotic nuclear RNA-binding protein that
          may modulate splice site selection in pre-mRNA
          splicing. hnRNP A2/B1 is an RNA trafficking response
          element-binding protein that interacts with the hnRNP
          A2 response element (A2RE). Many mRNAs, such as myelin
          basic protein (MBP), myelin-associated oligodendrocytic
          basic protein (MOBP), carboxyanhydrase II (CAII),
          microtubule-associated protein tau, and amyloid
          precursor protein (APP) are trafficked by hnRNP A2/B1.
          hnRNP A3 is also a RNA trafficking response
          element-binding protein that participates in the
          trafficking of A2RE-containing RNA. The hnRNP A
          subfamily is characterized by two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), followed by a long
          glycine-rich region at the C-terminus. .
          Length = 73

 Score = 37.6 bits (88), Expect = 6e-05
 Identities = 12/32 (37%), Positives = 21/32 (65%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVL 95
          KLFVG L +   E+D+R+ F+ +G +E   ++
Sbjct: 1  KLFVGGLKEDVTEEDLREYFSQYGNVESVEIV 32


>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR
          and similar proteins.  This subgroup corresponds to the
          RRM2 of nucleolysin TIAR, also termed TIA-1-related
          protein, a cytotoxic granule-associated RNA-binding
          protein that shows high sequence similarity with 40-kDa
          isoform of T-cell-restricted intracellular antigen-1
          (p40-TIA-1). TIAR is mainly localized in the nucleus of
          hematopoietic and nonhematopoietic cells. It is
          translocated from the nucleus to the cytoplasm in
          response to exogenous triggers of apoptosis. TIAR
          possesses nucleolytic activity against cytolytic
          lymphocyte (CTL) target cells. It can trigger DNA
          fragmentation in permeabilized thymocytes, and thus may
          function as an effector responsible for inducing
          apoptosis. TIAR is composed of three N-terminal, highly
          homologous RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), and a glutamine-rich C-terminal auxiliary
          domain containing a lysosome-targeting motif. It
          interacts with RNAs containing short stretches of
          uridylates and its RRM2 can mediate the specific
          binding to uridylate-rich RNAs. .
          Length = 80

 Score = 37.8 bits (87), Expect = 7e-05
 Identities = 14/32 (43%), Positives = 21/32 (65%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK 96
          +FVG LS +   +D++  FAPFG I +  V+K
Sbjct: 4  VFVGDLSPEITTEDIKSAFAPFGKISDARVVK 35


>gnl|CDD|241204 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA-binding
          protein Musashi homolog 2 (Musashi-2 ) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          Musashi-2 (also termed Msi2) which has been identified
          as a regulator of the hematopoietic stem cell (HSC)
          compartment and of leukemic stem cells after
          transplantation of cells with loss and gain of function
          of the gene. It influences proliferation and
          differentiation of HSCs and myeloid progenitors, and
          further modulates normal hematopoiesis and promotes
          aggressive myeloid leukemia. Musashi-2 contains two
          conserved N-terminal tandem RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), along with other domains
          of unknown function. .
          Length = 76

 Score = 37.4 bits (86), Expect = 1e-04
 Identities = 16/35 (45%), Positives = 23/35 (65%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGP 98
          K+F+G LS Q + D +R  F+ FG I EC V++ P
Sbjct: 1  KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDP 35


>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in
          heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0)
          and similar proteins.  This subfamily corresponds to
          the RRM1 of hnRNP A0 which is a low abundance hnRNP
          protein that has been implicated in mRNA stability in
          mammalian cells. It has been identified as the
          substrate for MAPKAP-K2 and may be involved in the
          lipopolysaccharide (LPS)-induced post-transcriptional
          regulation of tumor necrosis factor-alpha (TNF-alpha),
          cyclooxygenase 2 (COX-2) and macrophage inflammatory
          protein 2 (MIP-2). hnRNP A0 contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          followed by a long glycine-rich region at the
          C-terminus. .
          Length = 79

 Score = 37.1 bits (86), Expect = 1e-04
 Identities = 13/35 (37%), Positives = 22/35 (62%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGP 98
          KLFVG L+ + ++  +R+ F  +G + EC V+  P
Sbjct: 4  KLFVGGLNLKTSDSGLRRHFTRYGKLTECVVMVDP 38


>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in
           nucleolin-like proteins mainly from plants.  This
           subfamily corresponds to the RRM1 of a group of plant
           nucleolin-like proteins, including nucleolin 1 (also
           termed protein nucleolin like 1) and nucleolin 2 (also
           termed protein nucleolin like 2, or protein parallel
           like 1). They play roles in the regulation of ribosome
           synthesis and in the growth and development of plants.
           Like yeast nucleolin, nucleolin-like proteins possess
           two RNA recognition motifs (RRMs), also termed RBDs (RNA
           binding domains) or RNPs (ribonucleoprotein domains).  .
          Length = 77

 Score = 36.9 bits (86), Expect = 1e-04
 Identities = 14/39 (35%), Positives = 21/39 (53%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
           LFVG LS    +DD+ + F   G + +  + +  DG SK
Sbjct: 2   LFVGNLSWSAEQDDLEEFFKECGEVVDVRIAQDDDGRSK 40


>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the
          p54nrb/PSF/PSP1 family.  This subfamily corresponds to
          the RRM1 of the p54nrb/PSF/PSP1 family, including 54
          kDa nuclear RNA- and DNA-binding protein (p54nrb or
          NonO or NMT55), polypyrimidine tract-binding protein
          (PTB)-associated-splicing factor (PSF or POMp100),
          paraspeckle protein 1 (PSP1 or PSPC1), which are
          ubiquitously expressed and are conserved in
          vertebrates. p54nrb is a multi-functional protein
          involved in numerous nuclear processes including
          transcriptional regulation, splicing, DNA unwinding,
          nuclear retention of hyperedited double-stranded RNA,
          viral RNA processing, control of cell proliferation,
          and circadian rhythm maintenance. PSF is also a
          multi-functional protein that binds RNA,
          single-stranded DNA (ssDNA), double-stranded DNA
          (dsDNA) and many factors, and mediates diverse
          activities in the cell. PSP1 is a novel nucleolar
          factor that accumulates within a new nucleoplasmic
          compartment, termed paraspeckles, and diffusely
          distributes in the nucleoplasm. The cellular function
          of PSP1 remains unknown currently. This subfamily also
          includes some p54nrb/PSF/PSP1 homologs from
          invertebrate species, such as the Drosophila
          melanogaster gene no-ontransient A (nonA) encoding
          puff-specific protein Bj6 (also termed NONA) and
          Chironomus tentans hrp65 gene encoding protein Hrp65.
          D. melanogaster NONA is involved in eye development and
          behavior, and may play a role in circadian rhythm
          maintenance, similar to vertebrate p54nrb. C. tentans
          Hrp65 is a component of nuclear fibers associated with
          ribonucleoprotein particles in transit from the gene to
          the nuclear pore. All family members contain a DBHS
          domain (for Drosophila behavior, human splicing), which
          comprises two conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a charged
          protein-protein interaction module. PSF has an
          additional large N-terminal domain that differentiates
          it from other family members. .
          Length = 71

 Score = 36.5 bits (85), Expect = 2e-04
 Identities = 10/34 (29%), Positives = 20/34 (58%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKG 97
          +LFVG L     E++ +++F+ +G + E  + K 
Sbjct: 3  RLFVGNLPNDITEEEFKELFSKYGEVSEVFLNKE 36


>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE.  This
           subgroup corresponds to the RRM of BOULE, the founder
           member of the human DAZ gene family. Invertebrates
           contain a single BOULE, while vertebrates, other than
           catarrhine primates, possess both BOULE and DAZL genes.
           The catarrhine primates possess BOULE, DAZL, and DAZ
           genes. BOULE encodes an RNA-binding protein containing
           an RNA recognition motif (RRM), also known as RBD (RNA
           binding domain) or RNP (ribonucleoprotein domain), and a
           single copy of the DAZ motif. Although its specific
           biochemical functions remains to be investigated, BOULE
           protein may interact with poly(A)-binding proteins
           (PABPs), and act as translational activators of specific
           mRNAs during gametogenesis. .
          Length = 81

 Score = 36.7 bits (85), Expect = 2e-04
 Identities = 15/40 (37%), Positives = 27/40 (67%)

Query: 64  KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
           ++FVG +  + NE+D+RK F+ +GT++E  ++    G SK
Sbjct: 4   RIFVGGIDFKTNENDLRKFFSQYGTVKEVKIVNDRAGVSK 43


>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous
          nuclear ribonucleoprotein A3 (hnRNP A3) and similar
          proteins.  This subgroup corresponds to the RRM1 of
          hnRNP A3 which is a novel RNA trafficking response
          element-binding protein that interacts with the hnRNP
          A2 response element (A2RE) independently of hnRNP A2
          and participates in the trafficking of A2RE-containing
          RNA. hnRNP A3 can shuttle between the nucleus and the
          cytoplasm. It contains two RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), followed by a long
          glycine-rich region at the C-terminus. .
          Length = 81

 Score = 37.0 bits (85), Expect = 2e-04
 Identities = 14/36 (38%), Positives = 25/36 (69%)

Query: 63 KKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGP 98
          +KLF+G LS +  +D +R+ F  +GT+ +C V++ P
Sbjct: 3  RKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDP 38


>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General
           function prediction only].
          Length = 306

 Score = 38.0 bits (87), Expect = 2e-04
 Identities = 13/45 (28%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 60  PPDKKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPD-GTSK 103
             +  LFVG L     E+D+R++F  FG ++   +++  + G S+
Sbjct: 113 EENNTLFVGNLPYDVTEEDLRELFKKFGPVKRVRLVRDRETGKSR 157


>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast
          negative growth regulatory protein NGR1 (RBP1), yeast
          protein NAM8 and similar proteins.  This subfamily
          corresponds to the RRM3 of NGR1 and NAM8. NGR1, also
          termed RNA-binding protein RBP1, is a putative
          glucose-repressible protein that binds both RNA and
          single-stranded DNA (ssDNA) in yeast. It may function
          in regulating cell growth in early log phase, possibly
          through its participation in RNA metabolism. NGR1
          contains two RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), followed by a glutamine-rich stretch that may
          be involved in transcriptional activity. In addition,
          NGR1 has an asparagine-rich region near the carboxyl
          terminus which also harbors a methionine-rich region.
          The family also includes protein NAM8, which is a
          putative RNA-binding protein that acts as a suppressor
          of mitochondrial splicing deficiencies when
          overexpressed in yeast. It may be a non-essential
          component of the mitochondrial splicing machinery. Like
          NGR1, NAM8 contains two RRMs. .
          Length = 72

 Score = 36.1 bits (84), Expect = 2e-04
 Identities = 12/25 (48%), Positives = 16/25 (64%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTI 89
          +FVG L     ED++R +F PFG I
Sbjct: 4  VFVGGLDPAVTEDELRSLFGPFGEI 28


>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding
          protein 45 (RBM45) and similar proteins.  This
          subfamily corresponds to the RRM2 of RBM45, also termed
          developmentally-regulated RNA-binding protein 1 (DRB1),
          a new member of RNA recognition motif (RRM)-type neural
          RNA-binding proteins, which expresses under
          spatiotemporal control. It is encoded by gene drb1 that
          is expressed in neurons, not in glial cells. RBM45
          predominantly localizes in cytoplasm of cultured cells
          and specifically binds to poly(C) RNA. It could play an
          important role during neurogenesis. RBM45 carries four
          RRMs, also known as RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). .
          Length = 74

 Score = 36.2 bits (84), Expect = 2e-04
 Identities = 13/33 (39%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK 96
          +LFV ++ K   E+D+R+ F  FG IE  +++K
Sbjct: 3  RLFV-VIPKSYTEEDLREKFKEFGDIEYVSIVK 34


>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous
          nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and
          similar proteins.  This subgroup corresponds to the
          RRM1 of hnRNP A2/B1 which is an RNA trafficking
          response element-binding protein that interacts with
          the hnRNP A2 response element (A2RE). Many mRNAs, such
          as myelin basic protein (MBP), myelin-associated
          oligodendrocytic basic protein (MOBP), carboxyanhydrase
          II (CAII), microtubule-associated protein tau, and
          amyloid precursor protein (APP) are trafficked by hnRNP
          A2/B1. hnRNP A2/B1 also functions as a splicing factor
          that regulates alternative splicing of the tumor
          suppressors, such as BIN1, WWOX, the antiapoptotic
          proteins c-FLIP and caspase-9B, the insulin receptor
          (IR), and the RON proto-oncogene among others.
          Moreover, the overexpression of hnRNP A2/B1 has been
          described in many cancers. It functions as a nuclear
          matrix protein involving in RNA synthesis and the
          regulation of cellular migration through alternatively
          splicing pre-mRNA. It may play a role in tumor cell
          differentiation. hnRNP A2/B1 contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          followed by a long glycine-rich region at the
          C-terminus. .
          Length = 81

 Score = 36.2 bits (83), Expect = 3e-04
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 63 KKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGP 98
          +KLF+G LS +  E+ +R  +  +G + +C V++ P
Sbjct: 3  RKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDP 38


>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein
          Musashi homologs Musashi-1, Musashi-2 and similar
          proteins.  This subfamily corresponds to the RRM2.in
          Musashi-1 (also termed Msi1), a neural RNA-binding
          protein putatively expressed in central nervous system
          (CNS) stem cells and neural progenitor cells, and
          associated with asymmetric divisions in neural
          progenitor cells. It is evolutionarily conserved from
          invertebrates to vertebrates. Musashi-1 is a homolog of
          Drosophila Musashi and Xenopus laevis nervous
          system-specific RNP protein-1 (Nrp-1). It has been
          implicated in the maintenance of the stem-cell state,
          differentiation, and tumorigenesis. It translationally
          regulates the expression of a mammalian numb gene by
          binding to the 3'-untranslated region of mRNA of Numb,
          encoding a membrane-associated inhibitor of Notch
          signaling, and further influences neural development.
          Moreover, Musashi-1 represses translation by
          interacting with the poly(A)-binding protein and
          competes for binding of the eukaryotic initiation
          factor-4G (eIF-4G). Musashi-2 (also termed Msi2) has
          been identified as a regulator of the hematopoietic
          stem cell (HSC) compartment and of leukemic stem cells
          after transplantation of cells with loss and gain of
          function of the gene. It influences proliferation and
          differentiation of HSCs and myeloid progenitors, and
          further modulates normal hematopoiesis and promotes
          aggressive myeloid leukemia. Both, Musashi-1 and
          Musashi-2, contain two conserved N-terminal tandem RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          along with other domains of unknown function. .
          Length = 74

 Score = 35.9 bits (83), Expect = 3e-04
 Identities = 15/29 (51%), Positives = 20/29 (68%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEEC 92
          K+FVG LS    EDDV+K F+ FG +E+ 
Sbjct: 1  KIFVGGLSANTTEDDVKKYFSQFGKVEDA 29


>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous
          nuclear ribonucleoprotein A1 (hnRNP A1) and similar
          proteins.  This subgroup corresponds to the RRM1 of
          hnRNP A1, also termed helix-destabilizing protein, or
          single-strand RNA-binding protein, or hnRNP core
          protein A1, and is an abundant eukaryotic nuclear
          RNA-binding protein that may modulate splice site
          selection in pre-mRNA splicing. hnRNP A1 has been
          characterized as a splicing silencer, often acting in
          opposition to an activating hnRNP H. It silences exons
          when bound to exonic elements in the alternatively
          spliced transcripts of c-src, HIV, GRIN1, and
          beta-tropomyosin. hnRNP A1 can shuttle between the
          nucleus and the cytoplasm. Thus, it may be involved in
          transport of cellular RNAs, including the packaging of
          pre-mRNA into hnRNP particles and transport of poly A+
          mRNA from the nucleus to the cytoplasm. The cytoplasmic
          hnRNP A1 has high affinity with AU-rich elements,
          whereas the nuclear hnRNP A1 has high affinity with a
          polypyrimidine stretch bordered by AG at the 3' ends of
          introns. hnRNP A1 is also involved in the replication
          of an RNA virus, such as mouse hepatitis virus (MHV),
          through an interaction with the
          transcription-regulatory region of viral RNA. hnRNP A1,
          together with the scaffold protein septin 6, serves as
          host protein to form a complex with NS5b and viral RNA,
          and further plays important roles in the replication of
          Hepatitis C virus (HCV). hnRNP A1 contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          followed by a long glycine-rich region at the
          C-terminus. The RRMs of hnRNP A1 play an important role
          in silencing the exon and the glycine-rich domain is
          responsible for protein-protein interactions. .
          Length = 81

 Score = 36.2 bits (83), Expect = 3e-04
 Identities = 13/37 (35%), Positives = 25/37 (67%)

Query: 63 KKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPD 99
          +KLF+G LS +  ++ +R  F  +GT+ +C V++ P+
Sbjct: 3  RKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN 39


>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl
          cis-trans isomerase-like 4 (PPIase) and similar
          proteins.  This subfamily corresponds to the RRM of
          PPIase, also termed cyclophilin-like protein PPIL4, or
          rotamase PPIL4, a novel nuclear RNA-binding protein
          encoded by cyclophilin-like PPIL4 gene. The precise
          role of PPIase remains unclear. PPIase contains a
          conserved N-terminal peptidyl-prolyl cistrans isomerase
          (PPIase) motif, a central RNA recognition motif (RRM),
          also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), followed by a lysine rich
          domain, and a pair of bipartite nuclear targeting
          sequences (NLS) at the C-terminus.
          Length = 83

 Score = 35.7 bits (83), Expect = 4e-04
 Identities = 14/37 (37%), Positives = 23/37 (62%)

Query: 60 PPDKKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK 96
          PP+  LFV  L+    ++D+  IF+ FG I+ C V++
Sbjct: 1  PPENVLFVCKLNPVTTDEDLEIIFSRFGKIKSCEVIR 37


>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a.k.a. RRM, RBD, or RNP
          domain). 
          Length = 69

 Score = 35.6 bits (83), Expect = 4e-04
 Identities = 11/35 (31%), Positives = 21/35 (60%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPD 99
          L+V  L     E+D+R+ F+P+G +E   +++  D
Sbjct: 1  LYVRNLPPSVTEEDLREFFSPYGKVEGVRLVRNKD 35


>gnl|CDD|241203 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA-binding
          protein Musashi homolog 1 (Musashi-1) and similar
          proteins.  This subgroup corresponds to the RRM1 of
          Musashi-1. The mammalian MSI1 gene encoding Musashi-1
          (also termed Msi1) is a neural RNA-binding protein
          putatively expressed in central nervous system (CNS)
          stem cells and neural progenitor cells and associated
          with asymmetric divisions in neural progenitor cells.
          Musashi-1 is evolutionarily conserved from
          invertebrates to vertebrates. It is a homolog of
          Drosophila Musashi and Xenopus laevis nervous
          system-specific RNP protein-1 (Nrp-1). Musashi-1 has
          been implicated in the maintenance of the stem-cell
          state, differentiation, and tumorigenesis. It
          translationally regulates the expression of a mammalian
          numb gene by binding to the 3'-untranslated region of
          mRNA of Numb, encoding a membrane-associated inhibitor
          of Notch signaling, and further influences neural
          development. Moreover, it represses translation by
          interacting with the poly(A)-binding protein and
          competes for binding of the eukaryotic initiation
          factor-4G (eIF-4G). Musashi-1 contains two conserved
          N-terminal tandem RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), along with other domains
          of unknown function. .
          Length = 77

 Score = 35.8 bits (82), Expect = 4e-04
 Identities = 14/35 (40%), Positives = 24/35 (68%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGP 98
          K+F+G LS Q  ++ +R+ F  FG ++EC V++ P
Sbjct: 2  KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDP 36


>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein
          Musashi homolog Musashi-1, Musashi-2 and similar
          proteins.  This subfamily corresponds to the RRM1 in
          Musashi-1 and Musashi-2. Musashi-1 (also termed Msi1)
          is a neural RNA-binding protein putatively expressed in
          central nervous system (CNS) stem cells and neural
          progenitor cells, and associated with asymmetric
          divisions in neural progenitor cells. It is
          evolutionarily conserved from invertebrates to
          vertebrates. Musashi-1 is a homolog of Drosophila
          Musashi and Xenopus laevis nervous system-specific RNP
          protein-1 (Nrp-1). It has been implicated in the
          maintenance of the stem-cell state, differentiation,
          and tumorigenesis. It translationally regulates the
          expression of a mammalian numb gene by binding to the
          3'-untranslated region of mRNA of Numb, encoding a
          membrane-associated inhibitor of Notch signaling, and
          further influences neural development. Moreover,
          Musashi-1 represses translation by interacting with the
          poly(A)-binding protein and competes for binding of the
          eukaryotic initiation factor-4G (eIF-4G). Musashi-2
          (also termed Msi2) has been identified as a regulator
          of the hematopoietic stem cell (HSC) compartment and of
          leukemic stem cells after transplantation of cells with
          loss and gain of function of the gene. It influences
          proliferation and differentiation of HSCs and myeloid
          progenitors, and further modulates normal hematopoiesis
          and promotes aggressive myeloid leukemia. Both,
          Musashi-1 and Musashi-2, contain two conserved
          N-terminal tandem RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), along with other domains
          of unknown function. .
          Length = 75

 Score = 35.5 bits (82), Expect = 5e-04
 Identities = 14/34 (41%), Positives = 23/34 (67%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGP 98
          +F+G LS Q   + +R+ F+ FG I+EC V++ P
Sbjct: 1  MFIGGLSWQTTAEGLREYFSKFGEIKECMVMRDP 34


>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear
          polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p)
          and similar proteins.  This subfamily corresponds to
          the RRM1 of Hrp1p and similar proteins. Hrp1p or Nab4p,
          also termed cleavage factor IB (CFIB), is a
          sequence-specific trans-acting factor that is essential
          for mRNA 3'-end formation in yeast Saccharomyces
          cerevisiae. It can be UV cross-linked to RNA and
          specifically recognizes the (UA)6 RNA element required
          for both, the cleavage and poly(A) addition, steps.
          Moreover, Hrp1p can shuttle between the nucleus and the
          cytoplasm, and play an additional role in the export of
          mRNAs to the cytoplasm. Hrp1p also interacts with
          Rna15p and Rna14p, two components of CF1A. In addition,
          Hrp1p functions as a factor directly involved in
          modulating the activity of the nonsense-mediated mRNA
          decay (NMD) pathway. It binds specifically to a
          downstream sequence element (DSE)-containing RNA and
          interacts with Upf1p, a component of the surveillance
          complex, further triggering the NMD pathway. Hrp1p
          contains two central RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an
          arginine-glycine-rich region harboring repeats of the
          sequence RGGF/Y. .
          Length = 76

 Score = 34.9 bits (80), Expect = 0.001
 Identities = 11/34 (32%), Positives = 22/34 (64%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGP 98
          +F+G L+ +  +D +R+ F  FG + +CTV++  
Sbjct: 1  MFIGGLNWETTDDSLREYFGQFGEVTDCTVMRDS 34


>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I
           polyadenylate-binding proteins.  This subfamily
           corresponds to the RRM3 of type I poly(A)-binding
           proteins (PABPs), highly conserved proteins that bind to
           the poly(A) tail present at the 3' ends of most
           eukaryotic mRNAs. They have been implicated in the
           regulation of poly(A) tail length during the
           polyadenylation reaction, translation initiation, mRNA
           stabilization by influencing the rate of deadenylation
           and inhibition of mRNA decapping. The family represents
           type I polyadenylate-binding proteins (PABPs), including
           polyadenylate-binding protein 1 (PABP-1 or PABPC1),
           polyadenylate-binding protein 3 (PABP-3 or PABPC3),
           polyadenylate-binding protein 4 (PABP-4 or APP-1 or
           iPABP), polyadenylate-binding protein 5 (PABP-5 or
           PABPC5), polyadenylate-binding protein 1-like
           (PABP-1-like or PABPC1L), polyadenylate-binding protein
           1-like 2 (PABPC1L2 or RBM32), polyadenylate-binding
           protein 4-like (PABP-4-like or PABPC4L), yeast
           polyadenylate-binding protein, cytoplasmic and nuclear
           (PABP or ACBP-67), and similar proteins. PABP-1 is an
           ubiquitously expressed multifunctional protein that may
           play a role in 3' end formation of mRNA, translation
           initiation, mRNA stabilization, protection of poly(A)
           from nuclease activity, mRNA deadenylation, inhibition
           of mRNA decapping, and mRNP maturation. Although PABP-1
           is thought to be a cytoplasmic protein, it is also found
           in the nucleus. PABP-1 may be involved in
           nucleocytoplasmic trafficking and utilization of mRNP
           particles. PABP-1 contains four copies of RNA
           recognition motifs (RRMs), also termed RBDs (RNA binding
           domains) or RNPs (ribonucleoprotein domains), a less
           well conserved linker region, and a proline-rich
           C-terminal conserved domain (CTD). PABP-3 is a
           testis-specific poly(A)-binding protein specifically
           expressed in round spermatids. It is mainly found in
           mammalian and may play an important role in the
           testis-specific regulation of mRNA homeostasis. PABP-3
           shows significant sequence similarity to PABP-1.
           However, it binds to poly(A) with a lower affinity than
           PABP-1. PABP-1 possesses an A-rich sequence in its
           5'-UTR and allows binding of PABP and blockage of
           translation of its own mRNA. In contrast, PABP-3 lacks
           the A-rich sequence in its 5'-UTR. PABP-4 is an
           inducible poly(A)-binding protein (iPABP) that is
           primarily localized to the cytoplasm. It shows
           significant sequence similarity to PABP-1 as well. The
           RNA binding properties of PABP-1 and PABP-4 appear to be
           identical. PABP-5 is encoded by PABPC5 gene within the
           X-specific subinterval, and expressed in fetal brain and
           in a range of adult tissues in mammalian, such as ovary
           and testis. It may play an important role in germ cell
           development. Moreover, unlike other PABPs, PABP-5
           contains only four RRMs, but lacks both the linker
           region and the CTD. PABP-1-like and PABP-1-like 2 are
           the orthologs of PABP-1. PABP-4-like is the ortholog of
           PABP-5. Their cellular functions remain unclear. The
           family also includes the yeast PABP, a conserved poly(A)
           binding protein containing poly(A) tails that can be
           attached to the 3'-ends of mRNAs. The yeast PABP and its
           homologs may play important roles in the initiation of
           translation and in mRNA decay. Like vertebrate PABP-1,
           the yeast PABP contains four RRMs, a linker region, and
           a proline-rich CTD as well. The first two RRMs are
           mainly responsible for specific binding to poly(A). The
           proline-rich region may be involved in protein-protein
           interactions. .
          Length = 80

 Score = 34.5 bits (80), Expect = 0.001
 Identities = 10/39 (25%), Positives = 23/39 (58%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
           ++V  L +  +++ ++++F  +G I    V+K  +G SK
Sbjct: 4   VYVKNLGEDMDDEKLKELFGKYGKITSAKVMKDDEGKSK 42


>gnl|CDD|241028 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in heterogeneous
          nuclear ribonucleoprotein A/B (hnRNP A/B) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          hnRNP A/B, also termed APOBEC1-binding protein 1
          (ABBP-1), an RNA unwinding protein with a high affinity
          for G- followed by U-rich regions. hnRNP A/B has also
          been identified as an APOBEC1-binding protein that
          interacts with apolipoprotein B (apoB) mRNA transcripts
          around the editing site and thus plays an important
          role in apoB mRNA editing. hnRNP A/B contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          followed by a long C-terminal glycine-rich domain that
          contains a potential ATP/GTP binding loop. .
          Length = 80

 Score = 34.6 bits (79), Expect = 0.001
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 61 PDKKLFVGMLSKQQNEDDVRKIFAPFGTIE 90
          P KK+FVG L+ +  E+ +R+ F  FG IE
Sbjct: 3  PVKKIFVGGLNPEATEEKIREYFGEFGEIE 32


>gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding
          protein 34 (RBM34) and similar proteins.  This
          subfamily corresponds to the RRM1 of RBM34, a putative
          RNA-binding protein containing two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains). Although the
          function of RBM34 remains unclear currently, its RRM
          domains may participate in mRNA processing. RBM34 may
          act as an mRNA processing-related protein. .
          Length = 91

 Score = 34.5 bits (80), Expect = 0.001
 Identities = 11/26 (42%), Positives = 16/26 (61%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIE 90
          +FVG L     + D++K+F  FG IE
Sbjct: 3  VFVGNLPLTTKKKDLKKLFKQFGPIE 28


>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in
           SMART/HDAC1-associated repressor protein (SHARP) and
           similar proteins.  This subfamily corresponds to the
           RRM3 of SHARP, also termed Msx2-interacting protein
           (MINT), or SPEN homolog, an estrogen-inducible
           transcriptional repressor that interacts directly with
           the nuclear receptor corepressor SMRT, histone
           deacetylases (HDACs) and components of the NuRD complex.
           SHARP recruits HDAC activity and binds to the steroid
           receptor RNA coactivator SRA through four conserved
           N-terminal RNA recognition motifs (RRMs), also termed
           RBDs (RNA binding domains) or RNPs (ribonucleoprotein
           domains), further suppressing SRA-potentiated steroid
           receptor transcription activity. Thus, SHARP has the
           capacity to modulate both liganded and nonliganded
           nuclear receptors. SHARP also has been identified as a
           component of transcriptional repression complexes in
           Notch/RBP-Jkappa signaling pathways. In addition to the
           N-terminal RRMs, SHARP possesses a C-terminal SPOC
           domain (Spen paralog and ortholog C-terminal domain),
           which is highly conserved among Spen proteins.  .
          Length = 74

 Score = 33.9 bits (78), Expect = 0.002
 Identities = 12/40 (30%), Positives = 19/40 (47%)

Query: 63  KKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTS 102
           + LF+G L K     D+R+ F  FG I +  + K     +
Sbjct: 3   RTLFIGNLEKTTTYSDLREAFERFGEIIDIDIKKQGGNPA 42


>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1
          isoform p40 (p40-TIA-1) and similar proteins.  This
          subgroup corresponds to the RRM2 of p40-TIA-1, the
          40-kDa isoform of T-cell-restricted intracellular
          antigen-1 (TIA-1), and a cytotoxic granule-associated
          RNA-binding protein mainly found in the granules of
          cytotoxic lymphocytes. TIA-1 can be phosphorylated by a
          serine/threonine kinase that is activated during
          Fas-mediated apoptosis, and function as the granule
          component responsible for inducing apoptosis in
          cytolytic lymphocyte (CTL) targets. It is composed of
          three N-terminal highly homologous RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and a
          glutamine-rich C-terminal auxiliary domain containing a
          lysosome-targeting motif. TIA-1 interacts with RNAs
          containing short stretches of uridylates and its RRM2
          can mediate the specific binding to uridylate-rich
          RNAs. .
          Length = 80

 Score = 33.9 bits (77), Expect = 0.002
 Identities = 15/32 (46%), Positives = 21/32 (65%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK 96
          +FVG LS +   DD++  FAPFG I +  V+K
Sbjct: 4  VFVGDLSPEITTDDIKAAFAPFGRISDARVVK 35


>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ)
           autosomal homologs, DAZL (DAZ-like) and BOULE.  This
           subfamily corresponds to the RRM domain of two Deleted
           in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like)
           and BOULE. BOULE is the founder member of the family and
           DAZL arose from BOULE in an ancestor of vertebrates. The
           DAZ gene subsequently originated from a duplication
           transposition of the DAZL gene. Invertebrates contain a
           single DAZ homolog, BOULE, while vertebrates, other than
           catarrhine primates, possess both BOULE and DAZL genes.
           The catarrhine primates possess BOULE, DAZL, and DAZ
           genes. The family members encode closely related
           RNA-binding proteins that are required for fertility in
           numerous organisms. These proteins contain an RNA
           recognition motif (RRM), also known as RBD (RNA binding
           domain) or RNP (ribonucleoprotein domain), and a varying
           number of copies of a DAZ motif, believed to mediate
           protein-protein interactions. DAZL and BOULE contain a
           single copy of the DAZ motif, while DAZ proteins can
           contain 8-24 copies of this repeat. Although their
           specific biochemical functions remain to be
           investigated, DAZL proteins may interact with
           poly(A)-binding proteins (PABPs), and act as
           translational activators of specific mRNAs during
           gametogenesis.  .
          Length = 80

 Score = 33.8 bits (78), Expect = 0.002
 Identities = 11/40 (27%), Positives = 24/40 (60%)

Query: 64  KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
           ++FVG +     E+++R  F+ FG++++  ++    G SK
Sbjct: 4   RIFVGGIPPDTTEEELRDFFSRFGSVKDVKIITDRAGVSK 43


>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in
           azoospermia-associated protein 1 (DAZAP1) and similar
           proteins.  This subfamily corresponds to the RRM1 of
           DAZAP1 or DAZ-associated protein 1, also termed
           proline-rich RNA binding protein (Prrp), a
           multi-functional ubiquitous RNA-binding protein
           expressed most abundantly in the testis and essential
           for normal cell growth, development, and
           spermatogenesis. DAZAP1 is a shuttling protein whose
           acetylated form is predominantly nuclear and the
           nonacetylated form is in cytoplasm. It also functions as
           a translational regulator that activates translation in
           an mRNA-specific manner. DAZAP1 was initially identified
           as a binding partner of Deleted in Azoospermia (DAZ). It
           also interacts with numerous hnRNPs, including hnRNP U,
           hnRNP U like-1, hnRNPA1, hnRNPA/B, and hnRNP D,
           suggesting DAZAP1 might associate and cooperate with
           hnRNP particles to regulate adenylate-uridylate-rich
           elements (AU-rich element or ARE)-containing mRNAs.
           DAZAP1 contains two N-terminal RNA recognition motifs
           (RRMs), also termed RBDs (RNA binding domains) or RNPs
           (ribonucleoprotein domains), and a C-terminal
           proline-rich domain. .
          Length = 82

 Score = 33.6 bits (77), Expect = 0.003
 Identities = 12/37 (32%), Positives = 23/37 (62%)

Query: 64  KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDG 100
           KLFVG LS +  ++ +R+ F+ +G + +C ++K    
Sbjct: 1   KLFVGGLSWETTQETLRRYFSQYGEVVDCVIMKDKTT 37


>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in
          granule-associated RNA binding proteins (p40-TIA-1 and
          TIAR), and yeast nuclear and cytoplasmic polyadenylated
          RNA-binding protein PUB1.  This subfamily corresponds
          to the RRM3 of TIA-1, TIAR, and PUB1. Nucleolysin TIA-1
          isoform p40 (p40-TIA-1 or TIA-1) and nucleolysin
          TIA-1-related protein (TIAR) are granule-associated RNA
          binding proteins involved in inducing apoptosis in
          cytotoxic lymphocyte (CTL) target cells. They share
          high sequence similarity and are expressed in a wide
          variety of cell types. TIA-1 can be phosphorylated by a
          serine/threonine kinase that is activated during
          Fas-mediated apoptosis.TIAR is mainly localized in the
          nucleus of hematopoietic and nonhematopoietic cells. It
          is translocated from the nucleus to the cytoplasm in
          response to exogenous triggers of apoptosis. Both TIA-1
          and TIAR bind specifically to poly(A) but not to
          poly(C) homopolymers. They are composed of three
          N-terminal highly homologous RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a glutamine-rich
          C-terminal auxiliary domain containing a
          lysosome-targeting motif. TIA-1 and TIAR interact with
          RNAs containing short stretches of uridylates and their
          RRM2 can mediate the specific binding to uridylate-rich
          RNAs. The C-terminal auxiliary domain may be
          responsible for interacting with other proteins. In
          addition, TIA-1 and TIAR share a potential serine
          protease-cleavage site (Phe-Val-Arg) localized at the
          junction between their RNA binding domains and their
          C-terminal auxiliary domains. This subfamily also
          includes a yeast nuclear and cytoplasmic polyadenylated
          RNA-binding protein PUB1, termed ARS consensus-binding
          protein ACBP-60, or poly uridylate-binding protein, or
          poly(U)-binding protein, which has been identified as
          both a heterogeneous nuclear RNA-binding protein
          (hnRNP) and a cytoplasmic mRNA-binding protein (mRNP).
          It may be stably bound to a translationally inactive
          subpopulation of mRNAs within the cytoplasm. PUB1 is
          distributed in both, the nucleus and the cytoplasm, and
          binds to poly(A)+ RNA (mRNA or pre-mRNA). Although it
          is one of the major cellular proteins cross-linked by
          UV light to polyadenylated RNAs in vivo, PUB1 is
          nonessential for cell growth in yeast. PUB1 also binds
          to T-rich single stranded DNA (ssDNA); however, there
          is no strong evidence implicating PUB1 in the mechanism
          of DNA replication. PUB1 contains three RRMs, and a GAR
          motif (glycine and arginine rich stretch) that is
          located between RRM2 and RRM3. .
          Length = 73

 Score = 33.4 bits (77), Expect = 0.003
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKG 97
          ++VG L     E+++++ F+PFG IEE  V K 
Sbjct: 3  VYVGNLPHGLTEEELQRTFSPFGAIEEVRVFKD 35


>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and
           CTD-associated factor 4 (SCAF4), SR-related and
           CTD-associated factor 8 (SCAF8) and similar proteins.
           This subfamily corresponds to the RRM in a new class of
           SCAFs (SR-like CTD-associated factors), including SCAF4,
           SCAF8 and similar proteins. The biological role of SCAF4
           remains unclear, but it shows high sequence similarity
           to SCAF8 (also termed CDC5L complex-associated protein
           7, or RNA-binding motif protein 16, or CTD-binding
           SR-like protein RA8). SCAF8 is a nuclear matrix protein
           that interacts specifically with a highly
           serine-phosphorylated form of the carboxy-terminal
           domain (CTD) of the largest subunit of RNA polymerase II
           (pol II). The pol II CTD plays a role in coupling
           transcription and pre-mRNA processing. In addition,
           SCAF8 co-localizes primarily with transcription sites
           that are enriched in nuclear matrix fraction, which is
           known to contain proteins involved in pre-mRNA
           processing. Thus, SCAF8 may play a direct role in
           coupling with both, transcription and pre-mRNA
           processing, processes. SCAF8 and SCAF4 both contain a
           conserved N-terminal CTD-interacting domain (CID), an
           atypical RNA recognition motif (RRM), also termed RBD
           (RNA binding domain) or RNPs (ribonucleoprotein domain),
           and serine/arginine-rich motifs.
          Length = 77

 Score = 33.5 bits (77), Expect = 0.003
 Identities = 12/36 (33%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDG 100
           L++G LSK+  E+D++ +F  +G I+   ++  P G
Sbjct: 5   LWIGHLSKKVTEEDLKNLFEEYGEIQSIDMI-PPRG 39


>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple
           RNA-binding domain-containing protein 1 (MRD1) and
           similar proteins.  This subgroup corresponds to the RRM2
           of MRD1 which is encoded by a novel yeast gene MRD1
           (multiple RNA-binding domain). It is well-conserved in
           yeast and its homologs exist in all eukaryotes. MRD1 is
           present in the nucleolus and the nucleoplasm. It
           interacts with the 35 S precursor rRNA (pre-rRNA) and U3
           small nucleolar RNAs (snoRNAs). It is essential for the
           initial processing at the A0-A2 cleavage sites in the 35
           S pre-rRNA. MRD1 contains 5 conserved RNA recognition
           motifs (RRMs), also termed RBDs (RNA binding domains) or
           RNPs (ribonucleoprotein domains), which may play an
           important structural role in organizing specific rRNA
           processing events. .
          Length = 79

 Score = 33.1 bits (76), Expect = 0.004
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%)

Query: 63  KKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPD-GTSK 103
            +LFV  L     EDD+ K+F+ FG + E  V      G SK
Sbjct: 3   GRLFVRNLPYSCKEDDLEKLFSKFGELSEVHVAIDKKSGKSK 44


>gnl|CDD|241067 cd12623, RRM_PPARGC1A, RNA recognition motif in peroxisome
           proliferator-activated receptor gamma coactivator
           1-alpha (PGC-1alpha, or PPARGC-1-alpha) and similar
           proteins.  This subgroup corresponds to the RRM of
           PGC-1alpha, also termed PPARGC-1-alpha, or ligand effect
           modulator 6, a member of a family of transcription
           coactivators that plays a central role in the regulation
           of cellular energy metabolism. As an inducible
           transcription coactivator, PGC-1alpha can interact with
           a broad range of transcription factors involved in a
           wide variety of biological responses, such as adaptive
           thermogenesis, skeletal muscle fiber type switching,
           glucose/fatty acid metabolism, and heart development.
           PGC-1alpha stimulates mitochondrial biogenesis and
           promotes oxidative metabolism. It participates in the
           regulation of both carbohydrate and lipid metabolism and
           plays a role in disorders such as obesity, diabetes, and
           cardiomyopathy. PGC-1alpha is a multi-domain protein
           containing an N-terminal activation domain region, a
           central region involved in the interaction with at least
           a nuclear receptor, and a C-terminal domain region. The
           N-terminal domain region consists of three leucine-rich
           motifs (L1, NR box 2 and 3), among which the two last
           are required for interaction with nuclear receptors,
           potential nuclear localization signals (NLS), and a
           proline-rich region overlapping a putative repression
           domain. The C-terminus of PGC-1alpha is composed of two
           arginine/serine-rich regions (SR domains), a putative
           dimerization domain, and an RNA recognition motif (RRM),
           also known as RBD (RNA binding domain) or RNP
           (ribonucleoprotein domain). PGC-1alpha could interact
           favorably with single-stranded RNA. .
          Length = 91

 Score = 33.4 bits (76), Expect = 0.005
 Identities = 15/38 (39%), Positives = 20/38 (52%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTS 102
           ++VG +       ++R  F  FG IEECTV    DG S
Sbjct: 5   IYVGKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGDS 42


>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in
          RNA-binding protein 19 (RBM19) and RNA recognition
          motif 2 found in multiple RNA-binding domain-containing
          protein 1 (MRD1).  This subfamily corresponds to the
          RRM3 of RBM19 and RRM2 of MRD1. RBM19, also termed
          RNA-binding domain-1 (RBD-1), is a nucleolar protein
          conserved in eukaryotes involved in ribosome biogenesis
          by processing rRNA and is essential for preimplantation
          development. It has a unique domain organization
          containing 6 conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). MRD1 is encoded by a novel
          yeast gene MRD1 (multiple RNA-binding domain). It is
          well conserved in yeast and its homologs exist in all
          eukaryotes. MRD1 is present in the nucleolus and the
          nucleoplasm. It interacts with the 35 S precursor rRNA
          (pre-rRNA) and U3 small nucleolar RNAs (snoRNAs). It is
          essential for the initial processing at the A0-A2
          cleavage sites in the 35 S pre-rRNA. MRD1 contains 5
          conserved RRMs, which may play an important structural
          role in organizing specific rRNA processing events. .
          Length = 74

 Score = 32.7 bits (75), Expect = 0.005
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEEC 92
          +LFV  L     E+++R++F  FG I E 
Sbjct: 1  RLFVRNLPFTTTEEELRELFEAFGEISEV 29


>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in
          (U)-binding-splicing factor PUF60 and similar proteins.
           This subfamily corresponds to the RRM1 of PUF60, also
          termed FUSE-binding protein-interacting repressor
          (FBP-interacting repressor or FIR), or Ro-binding
          protein 1 (RoBP1), or Siah-binding protein 1
          (Siah-BP1). PUF60 is an essential splicing factor that
          functions as a poly-U RNA-binding protein required to
          reconstitute splicing in depleted nuclear extracts. Its
          function is enhanced through interaction with U2
          auxiliary factor U2AF65. PUF60 also controls human
          c-myc gene expression by binding and inhibiting the
          transcription factor far upstream sequence element
          (FUSE)-binding-protein (FBP), an activator of c-myc
          promoters. PUF60 contains two central RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and a C-terminal
          U2AF (U2 auxiliary factor) homology motifs (UHM) that
          harbors another RRM and binds to tryptophan-containing
          linear peptide motifs (UHM ligand motifs, ULMs) in
          several nuclear proteins. Research indicates that PUF60
          binds FUSE as a dimer, and only the first two RRM
          domains participate in the single-stranded DNA
          recognition. .
          Length = 76

 Score = 32.8 bits (75), Expect = 0.006
 Identities = 11/30 (36%), Positives = 20/30 (66%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECT 93
          +++VG +S +  ED +R+ F+PFG I+   
Sbjct: 2  RVYVGSISFELGEDTIRQAFSPFGPIKSID 31


>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple
           RNA-binding domain-containing protein 1 (MRD1) and
           similar proteins.  This subgroup corresponds to the RRM1
           of MRD1 which is encoded by a novel yeast gene MRD1
           (multiple RNA-binding domain). It is well-conserved in
           yeast and its homologs exist in all eukaryotes. MRD1 is
           present in the nucleolus and the nucleoplasm. It
           interacts with the 35 S precursor rRNA (pre-rRNA) and U3
           small nucleolar RNAs (snoRNAs). MRD1 is essential for
           the initial processing at the A0-A2 cleavage sites in
           the 35 S pre-rRNA. It contains 5 conserved RNA
           recognition motifs (RRMs), also termed RBDs (RNA binding
           domains) or RNPs (ribonucleoprotein domains), which may
           play an important structural role in organizing specific
           rRNA processing events. .
          Length = 76

 Score = 32.6 bits (75), Expect = 0.007
 Identities = 12/40 (30%), Positives = 21/40 (52%)

Query: 64  KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
           ++ V  L K   ED +R+ F   G + +  V++  DG S+
Sbjct: 2   RIIVKNLPKYVTEDRLREHFESKGEVTDVKVMRTRDGKSR 41


>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous
          nuclear ribonucleoprotein A/B (hnRNP A/B) and similar
          proteins.  This subgroup corresponds to the RRM1 of
          hnRNP A/B, also termed APOBEC1-binding protein 1
          (ABBP-1), which is an RNA unwinding protein with a high
          affinity for G- followed by U-rich regions. hnRNP A/B
          has also been identified as an APOBEC1-binding protein
          that interacts with apolipoprotein B (apoB) mRNA
          transcripts around the editing site and thus plays an
          important role in apoB mRNA editing. hnRNP A/B contains
          two RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains), followed by a long C-terminal glycine-rich
          domain that contains a potential ATP/GTP binding loop.
          .
          Length = 75

 Score = 32.3 bits (73), Expect = 0.008
 Identities = 13/36 (36%), Positives = 22/36 (61%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPD 99
          K+FVG LS   ++ D++  F  FG + +CT+   P+
Sbjct: 1  KMFVGGLSWDTSKKDLKDYFTKFGEVTDCTIKMDPN 36


>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering
          time control protein FCA and similar proteins.  This
          subgroup corresponds to the RRM1 of FCA, a gene
          controlling flowering time in Arabidopsis, encoding a
          flowering time control protein that functions in the
          posttranscriptional regulation of transcripts involved
          in the flowering process. FCA contains two RNA
          recognition motifs (RRMs), also known as RBDs (RNA
          binding domains) or RNP (ribonucleoprotein domains),
          and a WW protein interaction domain. .
          Length = 80

 Score = 32.2 bits (73), Expect = 0.008
 Identities = 12/33 (36%), Positives = 19/33 (57%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK 96
          KLFVG + +   E +VR +F   G + E  ++K
Sbjct: 1  KLFVGSVPRTITEQEVRPMFEEHGNVLEVAIIK 33


>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in
           RNA-binding protein 19 (RBM19 or RBD-1) and RNA
           recognition motif 5 in multiple RNA-binding
           domain-containing protein 1 (MRD1).  This subfamily
           corresponds to the RRM6 of RBM19 and RRM5 of MRD1.
           RBM19, also termed RNA-binding domain-1 (RBD-1), is a
           nucleolar protein conserved in eukaryotes. It is
           involved in ribosome biogenesis by processing rRNA and
           is essential for preimplantation development. It has a
           unique domain organization containing 6 conserved RNA
           recognition motifs (RRMs), also termed RBDs (RNA binding
           domains) or RNPs (ribonucleoprotein domains). MRD1 is
           encoded by a novel yeast gene MRD1 (multiple RNA-binding
           domain). It is well-conserved in yeast and its homologs
           exist in all eukaryotes. MRD1 is present in the
           nucleolus and the nucleoplasm. It interacts with the 35
           S precursor rRNA (pre-rRNA) and U3 small nucleolar RNAs
           (snoRNAs). It is essential for the initial processing at
           the A0-A2 cleavage sites in the 35 S pre-rRNA. MRD1
           contains 5 conserved RRMs, which may play an important
           structural role in organizing specific rRNA processing
           events. .
          Length = 76

 Score = 32.2 bits (74), Expect = 0.009
 Identities = 11/41 (26%), Positives = 24/41 (58%)

Query: 63  KKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
            KL V  +  +  + ++R++F+PFG ++   + K  DG+ +
Sbjct: 1   TKLIVRNVPFEATKKELRELFSPFGQVKSVRLPKKFDGSHR 41


>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in
           azoospermia-like (DAZL) proteins.  This subgroup
           corresponds to the RRM of DAZL, also termed
           SPGY-like-autosomal, encoded by the autosomal homolog of
           DAZ gene, DAZL. It is ancestral to the deleted in
           azoospermia (DAZ) protein. DAZL is germ-cell-specific
           RNA-binding protein that contains a RNA recognition
           motif (RRM), also known as RBD (RNA binding domain) or
           RNP (ribonucleoprotein domain), and a DAZ motif, a
           protein-protein interaction domain. Although their
           specific biochemical functions remain to be
           investigated, DAZL proteins may interact with
           poly(A)-binding proteins (PABPs), and act as
           translational activators of specific mRNAs during
           gametogenesis. .
          Length = 82

 Score = 32.1 bits (73), Expect = 0.009
 Identities = 12/39 (30%), Positives = 24/39 (61%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
           +FVG +  + +E ++R  FA +G+++E  ++    G SK
Sbjct: 8   VFVGGIDIRMDETEIRSFFAKYGSVKEVKIITDRTGVSK 46


>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein
           PTB-binding raver-1, raver-2 and similar proteins.  This
           subfamily corresponds to the RRM2 of raver-1 and
           raver-2. Raver-1 is a ubiquitously expressed
           heterogeneous nuclear ribonucleoprotein (hnRNP) that
           serves as a co-repressor of the nucleoplasmic splicing
           repressor polypyrimidine tract-binding protein
           (PTB)-directed splicing of select mRNAs. It shuttles
           between the cytoplasm and the nucleus and can accumulate
           in the perinucleolar compartment, a dynamic nuclear
           substructure that harbors PTB. Raver-1 also modulates
           focal adhesion assembly by binding to the cytoskeletal
           proteins, including alpha-actinin, vinculin, and
           metavinculin (an alternatively spliced isoform of
           vinculin) at adhesion complexes, particularly in
           differentiated muscle tissue. Raver-2 is a novel member
           of the heterogeneous nuclear ribonucleoprotein (hnRNP)
           family. It shows high sequence homology to raver-1.
           Raver-2 exerts a spatio-temporal expression pattern
           during embryogenesis and is mainly limited to
           differentiated neurons and glia cells. Although it
           displays nucleo-cytoplasmic shuttling in heterokaryons,
           raver2 localizes to the nucleus in glia cells and
           neurons. Raver-2 can interact with PTB and may
           participate in PTB-mediated RNA-processing. However,
           there is no evidence indicating that raver-2 can bind to
           cytoplasmic proteins. Both, raver-1 and raver-2, contain
           three N-terminal RNA recognition motifs (RRMs), also
           termed RBDs (RNA binding domains) or RNPs
           (ribonucleoprotein domains), two putative nuclear
           localization signals (NLS) at the N- and C-termini, a
           central leucine-rich region, and a C-terminal region
           harboring two [SG][IL]LGxxP motifs. They binds to RNA
           through the RRMs. In addition, the two [SG][IL]LGxxP
           motifs serve as the PTB-binding motifs in raver1.
           However, raver-2 interacts with PTB through the SLLGEPP
           motif only. .
          Length = 77

 Score = 32.2 bits (74), Expect = 0.009
 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGP-DGTSK 103
           L VG L  +  ++  R++ +PFG +E C ++     G SK
Sbjct: 2   LCVGNLPLEFTDEQFRELVSPFGAVERCFLVYSESTGESK 41


>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate
          putative RNA exonuclease NEF-sp.  This subfamily
          corresponds to the RRM1 of NEF-sp., including
          uncharacterized putative RNA exonuclease NEF-sp found
          in vertebrates. Although its cellular functions remains
          unclear, NEF-sp contains an exonuclease domain and two
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          suggesting it may possess both exonuclease and
          RNA-binding activities. .
          Length = 71

 Score = 32.0 bits (73), Expect = 0.010
 Identities = 7/31 (22%), Positives = 15/31 (48%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTVL 95
          ++ G         DV+++F   G + + T+L
Sbjct: 2  VYAGPFPTSFCLSDVKRLFETCGPVRKVTML 32


>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear
          polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p)
          and similar proteins.  This subfamily corresponds to
          the RRM1 of Hrp1p and similar proteins. Hrp1p or Nab4p,
          also termed cleavage factor IB (CFIB), is a
          sequence-specific trans-acting factor that is essential
          for mRNA 3'-end formation in yeast Saccharomyces
          cerevisiae. It can be UV cross-linked to RNA and
          specifically recognizes the (UA)6 RNA element required
          for both, the cleavage and poly(A) addition steps.
          Moreover, Hrp1p can shuttle between the nucleus and the
          cytoplasm, and play an additional role in the export of
          mRNAs to the cytoplasm. Hrp1p also interacts with
          Rna15p and Rna14p, two components of CF1A. In addition,
          Hrp1p functions as a factor directly involved in
          modulating the activity of the nonsense-mediated mRNA
          decay (NMD) pathway; it binds specifically to a
          downstream sequence element (DSE)-containing RNA and
          interacts with Upf1p, a component of the surveillance
          complex, further triggering the NMD pathway. Hrp1p
          contains two central RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an
          arginine-glycine-rich region harboring repeats of the
          sequence RGGF/Y. .
          Length = 75

 Score = 32.0 bits (73), Expect = 0.010
 Identities = 9/32 (28%), Positives = 19/32 (59%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVL 95
          K+FVG L     E++ ++ F+ FG + +  ++
Sbjct: 1  KIFVGGLPPDVTEEEFKEYFSQFGKVVDAQLM 32


>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila
          sex-lethal (SXL) and similar proteins.  This subfamily
          corresponds to the RRM2 of the sex-lethal protein (SXL)
          which governs sexual differentiation and X chromosome
          dosage compensation in Drosophila melanogaster. It
          induces female-specific alternative splicing of the
          transformer (tra) pre-mRNA by binding to the tra
          uridine-rich polypyrimidine tract at the
          non-sex-specific 3' splice site during the
          sex-determination process. SXL binds also to its own
          pre-mRNA and promotes female-specific alternative
          splicing. SXL contains an N-terminal Gly/Asn-rich
          domain that may be responsible for the protein-protein
          interaction, and tandem RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), that show high preference
          to bind single-stranded, uridine-rich target RNA
          transcripts. .
          Length = 79

 Score = 31.8 bits (72), Expect = 0.012
 Identities = 14/32 (43%), Positives = 22/32 (68%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK 96
          L+V  L +Q  ED++RKIF  +G I +C +L+
Sbjct: 3  LYVTNLPRQLTEDELRKIFEAYGNIVQCNLLR 34


>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in
          Pre-mRNA-splicing factor RBM22 and similar proteins.
          This subgroup corresponds to the RRM of RBM22 (also
          known as RNA-binding motif protein 22, or Zinc finger
          CCCH domain-containing protein 16), a newly discovered
          RNA-binding motif protein which belongs to the SLT11
          gene family. SLT11 gene encoding protein (Slt11p) is a
          splicing factor in yeast, which is required for
          spliceosome assembly. Slt11p has two distinct
          biochemical properties: RNA-annealing and RNA-binding
          activities. RBM22 is the homolog of SLT11 in
          vertebrate. It has been reported to be involved in
          pre-splicesome assembly and to interact with the
          Ca2+-signaling protein ALG-2. It also plays an
          important role in embryogenesis. RBM22 contains a
          conserved RNA recognition motif (RRM), also known as
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain), a zinc finger of the unusual type
          C-x8-C-x5-C-x3-H, and a C-terminus that is unusually
          rich in the amino acids Gly and Pro, including
          sequences of tetraprolines.
          Length = 74

 Score = 31.8 bits (73), Expect = 0.012
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTVL 95
          L+VG L ++  E D+R  F  FG I   TV+
Sbjct: 4  LYVGGLGERVTEKDLRDHFYQFGEIRSITVV 34


>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein
           19 (RBM19) and similar proteins.  This subgroup
           corresponds to the RRM1 of RBM19, also termed
           RNA-binding domain-1 (RBD-1), a nucleolar protein
           conserved in eukaryotes. It is involved in ribosome
           biogenesis by processing rRNA. In addition, it is
           essential for preimplantation development. RBM19 has a
           unique domain organization containing 6 conserved RNA
           recognition motifs (RRMs), also termed RBDs (RNA binding
           domains) or RNPs (ribonucleoprotein domains). .
          Length = 76

 Score = 31.5 bits (72), Expect = 0.014
 Identities = 15/37 (40%), Positives = 20/37 (54%)

Query: 64  KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDG 100
           +L V  L K   ED +RK+F  FGTI +  +    DG
Sbjct: 2   RLIVKNLPKGIKEDKLRKLFEAFGTITDVQLKYTKDG 38


>gnl|CDD|241000 cd12556, RRM2_RBM15B, RNA recognition motif 2 in putative RNA
          binding motif protein 15B (RBM15B) from vertebrate.
          This subgroup corresponds to the RRM2 of RBM15B, also
          termed one twenty-two 3 (OTT3), a paralog of RNA
          binding motif protein 15 (RBM15), also known as
          One-twenty two protein 1 (OTT1). Like RBM15, RBM15B has
          post-transcriptional regulatory activity. It is a
          nuclear protein sharing with RBM15 the association with
          the splicing factor compartment and the nuclear
          envelope as well as the binding to mRNA export factors
          NXF1 and Aly/REF. RBM15B belongs to the Spen (split
          end) protein family, which shares a domain architecture
          comprising of three N-terminal RNA recognition motifs
          (RRMs), also known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and a C-terminal SPOC (Spen
          paralog and ortholog C-terminal) domain. .
          Length = 85

 Score = 31.9 bits (72), Expect = 0.014
 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 63 KKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGP 98
          + LF+G L    +E ++R+ F  +G IEE  V+K P
Sbjct: 9  RNLFIGNLDHNVSEVELRRAFDKYGIIEE-VVIKRP 43


>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal
          pre-messenger RNA splicing protein 24 (Prp24) and
          similar proteins.  This subfamily corresponds to the
          RRM3 of Prp24, also termed U4/U6
          snRNA-associated-splicing factor PRP24 (U4/U6 snRNP),
          an RNA-binding protein with four well conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          It facilitates U6 RNA base-pairing with U4 RNA during
          spliceosome assembly. Prp24 specifically binds free U6
          RNA primarily with RRMs 1 and 2 and facilitates pairing
          of U6 RNA bases with U4 RNA bases. Additionally, it may
          also be involved in dissociation of the U4/U6 complex
          during spliceosome activation. .
          Length = 78

 Score = 31.8 bits (73), Expect = 0.014
 Identities = 11/31 (35%), Positives = 20/31 (64%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTV 94
          +++V  L  + +EDD+R IF+ FG +E   +
Sbjct: 2  EIYVRNLDFKLDEDDLRGIFSKFGEVESIRI 32


>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous
           nuclear ribonucleoprotein A0 (hnRNP A0) and similar
           proteins.  This subgroup corresponds to the RRM2 of
           hnRNP A0, a low abundance hnRNP protein that has been
           implicated in mRNA stability in mammalian cells. It has
           been identified as the substrate for MAPKAP-K2 and may
           be involved in the lipopolysaccharide (LPS)-induced
           post-transcriptional regulation of tumor necrosis
           factor-alpha (TNF-alpha), cyclooxygenase 2 (COX-2) and
           macrophage inflammatory protein 2 (MIP-2). hnRNP A0
           contains two RNA recognition motifs (RRMs), also termed
           RBDs (RNA binding domains) or RNPs (ribonucleoprotein
           domains), followed by a long glycine-rich region at the
           C-terminus. .
          Length = 80

 Score = 31.8 bits (72), Expect = 0.014
 Identities = 14/40 (35%), Positives = 20/40 (50%)

Query: 64  KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
           KLFVG L     E D+ + F+ FG +E+  V+       K
Sbjct: 1   KLFVGGLKGDVGEGDLTEHFSQFGPVEKAEVIADKQTGKK 40


>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8
          (NOL8) and similar proteins.  This model corresponds to
          the RRM of NOL8 (also termed Nop132) encoded by a novel
          NOL8 gene that is up-regulated in the majority of
          diffuse-type, but not intestinal-type, gastric cancers.
          Thus, NOL8 may be a good molecular target for treatment
          of diffuse-type gastric cancer. Also, NOL8 is a
          phosphorylated protein that contains an N-terminal RNA
          recognition motif (RRM), also known as RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), suggesting
          NOL8 is likely to function as a novel RNA-binding
          protein. It may be involved in regulation of gene
          expression at the post-transcriptional level or in
          ribosome biogenesis in cancer cells.
          Length = 78

 Score = 31.8 bits (73), Expect = 0.014
 Identities = 14/35 (40%), Positives = 21/35 (60%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPD 99
          LFVG LS    E D+ + F+ FGT+ +  ++K  D
Sbjct: 2  LFVGGLSPSVTESDLEERFSRFGTVSDVEIIKKKD 36


>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in
          heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP
          A/B, hnRNP DL and similar proteins.  This subfamily
          corresponds to the RRM2 of hnRNP D0, hnRNP A/B, hnRNP
          DL and similar proteins. hnRNP D0, a UUAG-specific
          nuclear RNA binding protein that may be involved in
          pre-mRNA splicing and telomere elongation. hnRNP A/B is
          an RNA unwinding protein with a high affinity for G-
          followed by U-rich regions. It has also been identified
          as an APOBEC1-binding protein that interacts with
          apolipoprotein B (apoB) mRNA transcripts around the
          editing site and thus plays an important role in apoB
          mRNA editing. hnRNP DL (or hnRNP D-like) is a dual
          functional protein that possesses DNA- and RNA-binding
          properties. It has been implicated in mRNA biogenesis
          at the transcriptional and post-transcriptional levels.
          All memembers in this family contain two putative RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and a glycine- and tyrosine-rich C-terminus. .
          Length = 75

 Score = 31.6 bits (72), Expect = 0.014
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEE 91
          K+FVG LS +  E+ +R+ F  FG I E
Sbjct: 1  KIFVGGLSPETTEEKIREYFGKFGNIVE 28


>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic
           activator RIM4 and similar proteins.  This subfamily
           corresponds to the RRM2 of RIM4, also termed regulator
           of IME2 protein 4, a putative RNA binding protein that
           is expressed at elevated levels early in meiosis. It
           functions as a meiotic activator required for both the
           IME1- and IME2-dependent pathways of meiotic gene
           expression, as well as early events of meiosis, such as
           meiotic division and recombination, in Saccharomyces
           cerevisiae. RIM4 contains two RNA recognition motifs
           (RRMs), also termed RBDs (RNA binding domains) or RNPs
           (ribonucleoprotein domains). The family also includes a
           putative RNA-binding protein termed multicopy suppressor
           of sporulation protein Msa1. It is a putative
           RNA-binding protein encoded by a novel gene, msa1, from
           the fission yeast Schizosaccharomyces pombe. Msa1 may be
           involved in the inhibition of sexual differentiation by
           controlling the expression of Ste11-regulated genes,
           possibly through the pheromone-signaling pathway. Like
           RIM4, Msa1 also contains two RRMs, both of which are
           essential for the function of Msa1. .
          Length = 80

 Score = 31.5 bits (72), Expect = 0.015
 Identities = 11/38 (28%), Positives = 22/38 (57%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTS 102
           +FVG LS    ++++ + F+  G I E  ++K  + T+
Sbjct: 6   IFVGQLSPDVTKEELNERFSRHGKILEVNLIKRANHTN 43


>gnl|CDD|241068 cd12624, RRM_PRC, RNA recognition motif in peroxisome
          proliferator-activated receptor gamma
          coactivator-related protein 1 (PRC) and similar
          proteins.  This subgroup corresponds to the RRM of PRC,
          also termed PGC-1-related coactivator, one of the
          members of PGC-1 transcriptional coactivators family,
          including peroxisome proliferator-activated receptor
          gamma coactivators PGC-1alpha and PGC-1beta. Unlike
          PGC-1alpha and PGC-1beta, PRC is ubiquitous and more
          abundantly expressed in proliferating cells than in
          growth-arrested cells. PRC has been implicated in the
          regulation of several metabolic pathways, mitochondrial
          biogenesis, and cell growth. It functions as a
          growth-regulated transcriptional cofactor activating
          many nuclear genes specifying mitochondrial respiratory
          function. PRC directly interacts with nuclear
          transcriptional factors implicated in respiratory chain
          expression including nuclear respiratory factors 1 and
          2 (NRF-1 and NRF-2), CREB (cAMP-response
          element-binding protein), and estrogen-related receptor
          alpha (ERRalpha). It interacts indirectly with the
          NRF-2beta subunit through host cell factor (HCF), a
          cellular protein involved in herpes simplex virus (HSV)
          infection and cell cycle regulation. Furthermore, like
          PGC-1alpha and PGC-1beta, PRC can transactivate a
          number of NRF-dependent nuclear genes required for
          mitochondrial respiratory function, including those
          encoding cytochrome c, 5-aminolevulinate synthase,
          Tfam, and TFB1M, and TFB2M. Further research indicates
          that PRC may also act as a sensor of metabolic stress
          that orchestrates a redox-sensitive program of
          inflammatory gene expression. PRC is a multi-domain
          protein containing an N-terminal activation domain, an
          LXXLL coactivator signature, a central proline-rich
          region, a tetrapeptide motif (DHDY) responsible for HCF
          binding, a C-terminal arginine/serine-rich (SR) domain,
          and an RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain).
          .
          Length = 91

 Score = 31.4 bits (71), Expect = 0.023
 Identities = 9/30 (30%), Positives = 19/30 (63%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTV 94
          +++G +  +    +++  F+ FG IEECT+
Sbjct: 5  VYIGKIPSRMTRSELKDRFSVFGEIEECTI 34


>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4;
          Provisional.
          Length = 144

 Score = 31.9 bits (72), Expect = 0.023
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVL 95
          KLF+G LS   ++  +R  FA FG + +  V+
Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFGDVVDAKVI 67


>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in
          (U)-binding-splicing factor PUF60 and similar proteins.
           This subfamily corresponds to the RRM2 of PUF60, also
          termed FUSE-binding protein-interacting repressor
          (FBP-interacting repressor or FIR), or Ro-binding
          protein 1 (RoBP1), or Siah-binding protein 1
          (Siah-BP1). PUF60 is an essential splicing factor that
          functions as a poly-U RNA-binding protein required to
          reconstitute splicing in depleted nuclear extracts. Its
          function is enhanced through interaction with U2
          auxiliary factor U2AF65. PUF60 also controls human
          c-myc gene expression by binding and inhibiting the
          transcription factor far upstream sequence element
          (FUSE)-binding-protein (FBP), an activator of c-myc
          promoters. PUF60 contains two central RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and a C-terminal
          U2AF (U2 auxiliary factor) homology motifs (UHM) that
          harbors another RRM and binds to tryptophan-containing
          linear peptide motifs (UHM ligand motifs, ULMs) in
          several nuclear proteins. Research indicates that PUF60
          binds FUSE as a dimer, and only the first two RRM
          domains participate in the single-stranded DNA
          recognition. .
          Length = 77

 Score = 31.1 bits (71), Expect = 0.025
 Identities = 10/35 (28%), Positives = 21/35 (60%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGP 98
          +++V  +    +EDD++ +F  FG I+ C++   P
Sbjct: 2  RIYVASVHPDLSEDDIKSVFEAFGKIKSCSLAPDP 36


>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein
          with serine-rich domain 1 (RNPS1) and similar proteins.
           This subfamily corresponds to the RRM of RNPS1 and its
          eukaryotic homologs. RNPS1, also termed RNA-binding
          protein prevalent during the S phase, or SR-related
          protein LDC2, was originally characterized as a general
          pre-mRNA splicing activator, which activates both
          constitutive and alternative splicing of pre-mRNA in
          vitro.It has been identified as a protein component of
          the splicing-dependent mRNP complex, or exon-exon
          junction complex (EJC), and is directly involved in
          mRNA surveillance. Furthermore, RNPS1 is a splicing
          regulator whose activator function is controlled in
          part by CK2 (casein kinase II) protein kinase
          phosphorylation. It can also function as a
          squamous-cell carcinoma antigen recognized by T cells-3
          (SART3)-binding protein, and is involved in the
          regulation of mRNA splicing. RNPS1 contains an
          N-terminal serine-rich (S) domain, a central RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), and the
          C-terminal arginine/serine/proline-rich (RS/P) domain.
          .
          Length = 73

 Score = 31.0 bits (71), Expect = 0.026
 Identities = 10/30 (33%), Positives = 22/30 (73%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTV 94
          L VG L++  N+D +++IF+ +GT+++  +
Sbjct: 1  LHVGKLTRNVNKDHLKEIFSNYGTVKDVDL 30


>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins
           family.  This subfamily corresponds to the RRM2 of Hu
           proteins family which represents a group of RNA-binding
           proteins involved in diverse biological processes. Since
           the Hu proteins share high homology with the Drosophila
           embryonic lethal abnormal vision (ELAV) protein, the Hu
           family is sometimes referred to as the ELAV family.
           Drosophila ELAV is exclusively expressed in neurons and
           is required for the correct differentiation and survival
           of neurons in flies. The neuronal members of the Hu
           family include Hu-antigen B (HuB or ELAV-2 or Hel-N1),
           Hu-antigen C (HuC or ELAV-3 or PLE21), and Hu-antigen D
           (HuD or ELAV-4), which play important roles in neuronal
           differentiation, plasticity and memory. HuB is also
           expressed in gonads. Hu-antigen R (HuR or ELAV-1 or HuA)
           is the ubiquitously expressed Hu family member. It has a
           variety of biological functions mostly related to the
           regulation of cellular response to DNA damage and other
           types of stress. Moreover, HuR has an anti-apoptotic
           function during early cell stress response. It binds to
           mRNAs and enhances the expression of several
           anti-apoptotic proteins, such as p21waf1, p53, and
           prothymosin alpha. HuR also has pro-apoptotic function
           by promoting apoptosis when cell death is unavoidable.
           Furthermore, HuR may be important in muscle
           differentiation, adipogenesis, suppression of
           inflammatory response and modulation of gene expression
           in response to chronic ethanol exposure and amino acid
           starvation. Hu proteins perform their cytoplasmic and
           nuclear molecular functions by coordinately regulating
           functionally related mRNAs. In the cytoplasm, Hu
           proteins recognize and bind to AU-rich RNA elements
           (AREs) in the 3' untranslated regions (UTRs) of certain
           target mRNAs, such as GAP-43, vascular epithelial growth
           factor (VEGF), the glucose transporter GLUT1, eotaxin
           and c-fos, and stabilize those ARE-containing mRNAs.
           They also bind and regulate the translation of some
           target mRNAs, such as neurofilament M, GLUT1, and p27.
           In the nucleus, Hu proteins function as regulators of
           polyadenylation and alternative splicing. Each Hu
           protein contains three RNA recognition motifs (RRMs),
           also termed RBDs (RNA binding domains) or RNPs
           (ribonucleoprotein domains). RRM1 and RRM2 may cooperate
           in binding to an ARE. RRM3 may help to maintain the
           stability of the RNA-protein complex, and might also
           bind to poly(A) tails or be involved in protein-protein
           interactions. .
          Length = 79

 Score = 31.1 bits (71), Expect = 0.026
 Identities = 9/37 (24%), Positives = 17/37 (45%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGT 101
           L+V  L K   + ++  +F+P+G I    +L      
Sbjct: 3   LYVSGLPKTMTQQELEALFSPYGRIITSRILCDNVTG 39


>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in
          serine/arginine-rich splicing factor 4 (SRSF4) and
          similar proteins.  This subfamily corresponds to the
          RRM1 in three serine/arginine (SR) proteins:
          serine/arginine-rich splicing factor 4 (SRSF4 or SRp75
          or SFRS4), serine/arginine-rich splicing factor 5
          (SRSF5 or SRp40 or SFRS5 or HRS), serine/arginine-rich
          splicing factor 6 (SRSF6 or SRp55). SRSF4 plays an
          important role in both, constitutive  and alternative,
          splicing of many pre-mRNAs. It can shuttle between the
          nucleus and cytoplasm. SRSF5 regulates both alternative
          splicing and basal splicing. It is the only SR protein
          efficiently selected from nuclear extracts (NE) by the
          splicing enhancer (ESE) and essential for enhancer
          activation. SRSF6 preferentially interacts with a
          number of purine-rich splicing enhancers (ESEs) to
          activate splicing of the ESE-containing exon. It is the
          only protein from HeLa nuclear extract or purified SR
          proteins that specifically binds B element RNA after UV
          irradiation. SRSF6 may also recognize different types
          of RNA sites. Members in this family contain two
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), followed by a C-terminal RS domains rich in
          serine-arginine dipeptides. .
          Length = 70

 Score = 30.8 bits (70), Expect = 0.027
 Identities = 10/34 (29%), Positives = 18/34 (52%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKG 97
          ++++G L  +  E DV + F  +G I E  +  G
Sbjct: 1  RVYIGRLPYRARERDVERFFKGYGRIREINLKNG 34


>gnl|CDD|241049 cd12605, RRM_RALYL, RNA recognition motif in vertebrate
          RNA-binding Raly-like protein (RALYL).  This subgroup
          corresponds to the RRM of RALYL, also termed
          heterogeneous nuclear ribonucleoprotein C-like 3, or
          hnRNP core protein C-like 3, a putative RNA-binding
          protein that shows high sequence homology with Raly, an
          RNA-binding protein playing a critical role in
          embryonic development. The biological role of RALYL
          remains unclear. Like Raly, RALYL contains two distinct
          domains, an N-terminal RNA recognition motif (RRM),
          also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and a C-terminal auxiliary
          domain. .
          Length = 69

 Score = 30.8 bits (69), Expect = 0.029
 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 62 DKKLFVGMLSKQ-QNEDDVRKIFAPFGTIEECTVLKG 97
          + ++F+G L+     + D+  IFA +G I  C+V KG
Sbjct: 1  NSRVFIGNLNTAIVKKADIEAIFAKYGKIVGCSVHKG 37


>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding
           protein 28 (RBM28) and similar proteins.  This subfamily
           corresponds to the RRM3 of RBM28 and Nop4p. RBM28 is a
           specific nucleolar component of the spliceosomal small
           nuclear ribonucleoproteins (snRNPs), possibly
           coordinating their transition through the nucleolus. It
           specifically associates with U1, U2, U4, U5, and U6
           small nuclear RNAs (snRNAs), and may play a role in the
           maturation of both small nuclear and ribosomal RNAs.
           RBM28 has four RNA recognition motifs (RRMs), also
           termed RBDs (RNA binding domains) or RNPs
           (ribonucleoprotein domains), and an extremely acidic
           region between RRM2 and RRM3. The family also includes
           nucleolar protein 4 (Nop4p or Nop77p) encoded by YPL043W
           from Saccharomyces cerevisiae. It is an essential
           nucleolar protein involved in processing and maturation
           of 27S pre-rRNA and biogenesis of 60S ribosomal
           subunits. Nop4p also contains four RRMs.  .
          Length = 82

 Score = 31.0 bits (71), Expect = 0.029
 Identities = 7/38 (18%), Positives = 21/38 (55%)

Query: 63  KKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDG 100
           + +F+  L     E++++++F+ FG ++   ++K    
Sbjct: 1   RTVFIRNLPFDATEEELKELFSQFGEVKYARIVKDKLT 38


>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1,
           2, 3, 4 family.  These eukaryotic proteins recognize the
           poly-A of mRNA and consists of four tandem RNA
           recognition domains at the N-terminus (rrm: pfam00076)
           followed by a PABP-specific domain (pfam00658) at the
           C-terminus. The protein is involved in the transport of
           mRNA's from the nucleus to the cytoplasm. There are four
           paralogs in Homo sapiens which are expressed in testis
           (GP:11610605_PABP3 ), platelets (SP:Q13310_PABP4 ),
           broadly expressed (SP:P11940_PABP1) and of unknown
           tissue range (SP:Q15097_PABP2).
          Length = 562

 Score = 32.1 bits (73), Expect = 0.031
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 57  TPLPPDKKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
            PL     L+V  L    NED +R++FA FG I    V+K   G S+
Sbjct: 173 APLKKFTNLYVKNLDPSVNEDKLRELFAKFGEITSAAVMKDGSGRSR 219



 Score = 30.2 bits (68), Expect = 0.13
 Identities = 10/39 (25%), Positives = 19/39 (48%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
           L+V  L     ++ +R++F+  G I    V+    G S+
Sbjct: 288 LYVKNLDDTVTDEKLRELFSECGEITSAKVMLDEKGVSR 326


>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous
          nuclear ribonucleoprotein C (hnRNP C)-related proteins.
           This subfamily corresponds to the RRM in the hnRNP
          C-related protein family, including hnRNP C proteins,
          Raly, and Raly-like protein (RALYL). hnRNP C proteins,
          C1 and C2, are produced by a single coding sequence.
          They are the major constituents of the heterogeneous
          nuclear RNA (hnRNA) ribonucleoprotein (hnRNP) complex
          in vertebrates. They bind hnRNA tightly, suggesting a
          central role in the formation of the ubiquitous hnRNP
          complex; they are involved in the packaging of the
          hnRNA in the nucleus and in processing of pre-mRNA such
          as splicing and 3'-end formation. Raly, also termed
          autoantigen p542, is an RNA-binding protein that may
          play a critical role in embryonic development. The
          biological role of RALYL remains unclear. It shows high
          sequence homology with hnRNP C proteins and Raly.
          Members of this family are characterized by an
          N-terminal RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain),
          and a C-terminal auxiliary domain. The Raly proteins
          contain a glycine/serine-rich stretch within the
          C-terminal regions, which is absent in the hnRNP C
          proteins. Thus, the Raly proteins represent a newly
          identified class of evolutionarily conserved
          autoepitopes. .
          Length = 68

 Score = 30.7 bits (70), Expect = 0.032
 Identities = 11/35 (31%), Positives = 24/35 (68%), Gaps = 1/35 (2%)

Query: 64 KLFVGMLSKQQ-NEDDVRKIFAPFGTIEECTVLKG 97
          ++FVG L+  + +++D+ +IF+ +G I   ++ KG
Sbjct: 2  RVFVGNLNTDKVSKEDLEEIFSKYGKILGISLHKG 36


>gnl|CDD|241017 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA-binding
          protein Musashi homolog 2 (Musashi-2) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          Musashi-2 (also termed Msi2) which has been identified
          as a regulator of the hematopoietic stem cell (HSC)
          compartment and of leukemic stem cells after
          transplantation of cells with loss and gain of function
          of the gene. It influences proliferation and
          differentiation of HSCs and myeloid progenitors, and
          further modulates normal hematopoiesis and promotes
          aggressive myeloid leukemia. Musashi-2 contains two
          conserved N-terminal tandem RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), along with other domains
          of unknown function. .
          Length = 79

 Score = 30.8 bits (69), Expect = 0.032
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 63 KKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVL 95
          KK+FVG LS     +DV++ F  FG +E+  ++
Sbjct: 4  KKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLM 36


>gnl|CDD|240999 cd12555, RRM2_RBM15, RNA recognition motif 2 in vertebrate RNA
          binding motif protein 15 (RBM15).  This subgroup
          corresponds to the RRM2 of RBM15, also termed
          one-twenty two protein 1 (OTT1), conserved in
          eukaryotes, a novel mRNA export factor and component of
          the NXF1 pathway. It binds to NXF1 and serves as
          receptor for the RNA export element RTE. It also
          possesses mRNA export activity and can facilitate the
          access of DEAD-box protein DBP5 to mRNA at the nuclear
          pore complex (NPC). RBM15 belongs to the Spen (split
          end) protein family, which contain three N-terminal RNA
          recognition motifs (RRMs), also known as RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain), and
          a C-terminal SPOC (Spen paralog and ortholog
          C-terminal) domain. This family also includes a
          RBM15-MKL1 (OTT-MAL) fusion protein that RBM15 is
          N-terminally fused to megakaryoblastic leukemia 1
          protein (MKL1) at the C-terminus in a translocation
          involving chromosome 1 and 22, resulting in acute
          megakaryoblastic leukemia. The fusion protein could
          interact with the mRNA export machinery. Although it
          maintains the specific transactivator function of MKL1,
          the fusion protein cannot activate RTE-mediated mRNA
          expression and has lost the post-transcriptional
          activator function of RBM15. However, it has
          transdominant suppressor function contributing to its
          oncogenic properties. .
          Length = 87

 Score = 31.1 bits (70), Expect = 0.032
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 62 DKKLFVGMLSKQQNEDDVRKIFAPFGTIEE 91
          ++ LF+G L     E D+R+ F  FG I E
Sbjct: 7  NRTLFLGNLDITVTETDLRRAFDRFGVITE 36


>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54
          kDa nuclear RNA- and DNA-binding protein (p54nrb).
          This subgroup corresponds to the RRM1 of p54nrb, also
          termed non-POU domain-containing octamer-binding
          protein (NonO), or 55 kDa nuclear protein (NMT55), or
          DNA-binding p52/p100 complex 52 kDa subunit. p54nrb is
          a multifunctional protein involved in numerous nuclear
          processes including transcriptional regulation,
          splicing, DNA unwinding, nuclear retention of
          hyperedited double-stranded RNA, viral RNA processing,
          control of cell proliferation, and circadian rhythm
          maintenance. It is ubiquitously expressed and highly
          conserved in vertebrates. p54nrb binds both, single-
          and double-stranded RNA and DNA, and also possesses
          inherent carbonic anhydrase activity. It forms a
          heterodimer with paraspeckle component 1 (PSPC1 or
          PSP1), localizing to paraspeckles in an RNA-dependent
          manneras well as with polypyrimidine tract-binding
          protein-associated-splicing factor (PSF). p54nrb
          contains two conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), at the N-terminus. .
          Length = 71

 Score = 30.6 bits (69), Expect = 0.033
 Identities = 12/33 (36%), Positives = 19/33 (57%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK 96
          +LFVG L     E+++RK+F  +G   E  + K
Sbjct: 3  RLFVGNLPPDITEEEMRKLFEKYGKAGEIFIHK 35


>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein
          homolog TRA2-alpha, TRA2-beta and similar proteins.
          This subfamily corresponds to the RRM of two mammalian
          homologs of Drosophila transformer-2 (Tra2),
          TRA2-alpha, TRA2-beta (also termed SFRS10), and similar
          proteins found in eukaryotes. TRA2-alpha is a 40-kDa
          serine/arginine-rich (SR) protein that specifically
          binds to gonadotropin-releasing hormone (GnRH) exonic
          splicing enhancer on exon 4 (ESE4) and is necessary for
          enhanced GnRH pre-mRNA splicing. It strongly stimulates
          GnRH intron A excision in a dose-dependent manner. In
          addition, TRA2-alpha can interact with either 9G8 or
          SRp30c, which may also be crucial for ESE-dependent
          GnRH pre-mRNA splicing. TRA2-beta is a
          serine/arginine-rich (SR) protein that controls the
          pre-mRNA alternative splicing of the
          calcitonin/calcitonin gene-related peptide (CGRP), the
          survival motor neuron 1 (SMN1) protein and the tau
          protein. Both, TRA2-alpha and TRA2-beta, contains a
          well conserved RNA recognition motif (RRM), also termed
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain), flanked by the N- and C-terminal
          arginine/serine (RS)-rich regions. .
          Length = 78

 Score = 30.7 bits (70), Expect = 0.034
 Identities = 10/25 (40%), Positives = 16/25 (64%)

Query: 70 LSKQQNEDDVRKIFAPFGTIEECTV 94
          LS    E D+R++F+ +G IE+  V
Sbjct: 7  LSLYTTERDLREVFSRYGPIEKVQV 31


>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous
          nuclear ribonucleoprotein A1 (hnRNP A1) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          hnRNP A1, also termed helix-destabilizing protein, or
          single-strand RNA-binding protein, or hnRNP core
          protein A1, an abundant eukaryotic nuclear RNA-binding
          protein that may modulate splice site selection in
          pre-mRNA splicing. hnRNP A1 has been characterized as a
          splicing silencer, often acting in opposition to an
          activating hnRNP H. It silences exons when bound to
          exonic elements in the alternatively spliced
          transcripts of c-src, HIV, GRIN1, and beta-tropomyosin.
          hnRNP A1 can shuttle between the nucleus and the
          cytoplasm. Thus, it may be involved in transport of
          cellular RNAs, including the packaging of pre-mRNA into
          hnRNP particles and transport of poly A+ mRNA from the
          nucleus to the cytoplasm. The cytoplasmic hnRNP A1 has
          high affinity with AU-rich elements, whereas the
          nuclear hnRNP A1 has high affinity with a
          polypyrimidine stretch bordered by AG at the 3' ends of
          introns. hnRNP A1 is also involved in the replication
          of an RNA virus, such as mouse hepatitis virus (MHV),
          through an interaction with the
          transcription-regulatory region of viral RNA. Moreover,
          hnRNP A1, together with the scaffold protein septin 6,
          serves as host proteins to form a complex with NS5b and
          viral RNA, and further play important roles in the
          replication of Hepatitis C virus (HCV). hnRNP A1
          contains two RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), followed by a long glycine-rich region at the
          C-terminus. The RRMs of hnRNP A1 play an important role
          in silencing the exon and the glycine-rich domain is
          responsible for protein-protein interactions. .
          Length = 77

 Score = 30.7 bits (69), Expect = 0.034
 Identities = 11/28 (39%), Positives = 16/28 (57%)

Query: 63 KKLFVGMLSKQQNEDDVRKIFAPFGTIE 90
          KK+FVG + +   E  +R  F  +G IE
Sbjct: 1  KKIFVGGIKEDTEEHHLRDYFEQYGKIE 28


>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in
           serine/arginine-rich splicing factor 3 (SRSF3) and
           similar proteins.  This subfamily corresponds to the RRM
           of two serine/arginine (SR) proteins,
           serine/arginine-rich splicing factor 3 (SRSF3) and
           serine/arginine-rich splicing factor 7 (SRSF7). SRSF3,
           also termed pre-mRNA-splicing factor SRp20, modulates
           alternative splicing by interacting with RNA
           cis-elements in a concentration- and cell
           differentiation-dependent manner. It is also involved in
           termination of transcription, alternative RNA
           polyadenylation, RNA export, and protein translation.
           SRSF3 is critical for cell proliferation, and tumor
           induction and maintenance. It can shuttle between the
           nucleus and cytoplasm. SRSF7, also termed splicing
           factor 9G8, plays a crucial role in both constitutive
           splicing and alternative splicing of many pre-mRNAs. Its
           localization and functions are tightly regulated by
           phosphorylation. SRSF7 is predominantly present in the
           nuclear and can shuttle between nucleus and cytoplasm.
           It cooperates with the export protein, Tap/NXF1, helps
           mRNA export to the cytoplasm, and enhances the
           expression of unspliced mRNA. Moreover, SRSF7 inhibits
           tau E10 inclusion through directly interacting with the
           proximal downstream intron of E10, a clustering region
           for frontotemporal dementia with Parkinsonism (FTDP)
           mutations. Both SRSF3 and SRSF7 contain a single
           N-terminal RNA recognition motif (RRM), also termed RBD
           (RNA binding domain) or RNP (ribonucleoprotein domain),
           and a C-terminal RS domain rich in serine-arginine
           dipeptides. The RRM domain is involved in RNA binding,
           and the RS domain has been implicated in protein
           shuttling and protein-protein interactions. .
          Length = 73

 Score = 30.3 bits (69), Expect = 0.037
 Identities = 9/37 (24%), Positives = 18/37 (48%)

Query: 64  KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDG 100
           K++VG L  +  + ++   F  +G +    V + P G
Sbjct: 1   KVYVGNLGPRATKRELEDEFEKYGPLRSVWVARNPPG 37


>gnl|CDD|241047 cd12603, RRM_hnRNPC, RNA recognition motif in vertebrate
          heterogeneous nuclear ribonucleoprotein C1/C2 (hnRNP
          C1/C2).  This subgroup corresponds to the RRM of
          heterogeneous nuclear ribonucleoprotein C (hnRNP)
          proteins C1 and C2, produced by a single coding
          sequence. They are the major constituents of the
          heterogeneous nuclear RNA (hnRNA) ribonucleoprotein
          (hnRNP) complex in vertebrates. They bind hnRNA
          tightly, suggesting a central role in the formation of
          the ubiquitous hnRNP complex. They are involved in the
          packaging of hnRNA in the nucleus and in processing of
          pre-mRNA such as splicing and 3'-end formation. hnRNP C
          proteins contain two distinct domains, an N-terminal
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain), and
          a C-terminal auxiliary domain that includes the
          variable region, the basic region and the KSG box rich
          in repeated Lys-Ser-Gly sequences, the leucine zipper,
          and the acidic region. The RRM is capable of binding
          poly(U). The KSG box may bind to RNA. The leucine
          zipper may be involved in dimer formation. The acidic
          and hydrophilic C-teminus harbors a putative nucleoside
          triphosphate (NTP)-binding fold and a protein kinase
          phosphorylation site. .
          Length = 71

 Score = 30.4 bits (68), Expect = 0.045
 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 62 DKKLFVGMLSKQQ-NEDDVRKIFAPFGTIEECTVLKG 97
          + ++F+G L+     + DV  IF+ +G I  C+V KG
Sbjct: 1  NSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKG 37


>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint
           family.  The proteins represented by this model contain
           three RNA recognition motifs (rrm: pfam00076) and have
           been characterized as poly-pyrimidine tract binding
           proteins associated with RNA splicing factors. In the
           case of PUF60 (GP|6176532), in complex with p54, and in
           the presence of U2AF, facilitates association of U2
           snRNP with pre-mRNA.
          Length = 612

 Score = 31.6 bits (71), Expect = 0.050
 Identities = 10/37 (27%), Positives = 21/37 (56%)

Query: 64  KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDG 100
           +++V  +    +E D++ +F  FG I +C + + P G
Sbjct: 206 RIYVASVHPDLSETDIKSVFEAFGEIVKCQLARAPTG 242



 Score = 30.8 bits (69), Expect = 0.10
 Identities = 11/27 (40%), Positives = 19/27 (70%)

Query: 64  KLFVGMLSKQQNEDDVRKIFAPFGTIE 90
           +++VG +S +  ED +R+ F PFG I+
Sbjct: 109 RVYVGSISFELREDTIRRAFDPFGPIK 135


>gnl|CDD|241031 cd12587, RRM1_PSF, RNA recognition motif 1 in vertebrate
          polypyrimidine tract-binding protein
          (PTB)-associated-splicing factor (PSF).  This subgroup
          corresponds to the RRM1 of PSF, also termed proline-
          and glutamine-rich splicing factor, or 100 kDa
          DNA-pairing protein (POMp100), or 100 kDa subunit of
          DNA-binding p52/p100 complex, a multifunctional protein
          that mediates diverse activities in the cell. It is
          ubiquitously expressed and highly conserved in
          vertebrates. PSF binds not only RNA but also both
          single-stranded DNA (ssDNA) and double-stranded DNA
          (dsDNA) and facilitates the renaturation of
          complementary ssDNAs. Besides, it promotes the
          formation of D-loops in superhelical duplex DNA, and is
          involved in cell proliferation. PSF can also interact
          with multiple factors. It is an RNA-binding component
          of spliceosomes and binds to insulin-like growth factor
          response element (IGFRE). PSF functions as a
          transcriptional repressor interacting with Sin3A and
          mediating silencing through the recruitment of histone
          deacetylases (HDACs) to the DNA binding domain (DBD) of
          nuclear hormone receptors. Additionally, PSF is an
          essential pre-mRNA splicing factor and is dissociated
          from PTB and binds to U1-70K and serine-arginine (SR)
          proteins during apoptosis. PSF forms a heterodimer with
          the nuclear protein p54nrb, also known as non-POU
          domain-containing octamer-binding protein (NonO). The
          PSF/p54nrb complex displays a variety of functions,
          such as DNA recombination and RNA synthesis,
          processing, and transport. PSF contains two conserved
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          which are responsible for interactions with RNA and for
          the localization of the protein in speckles. It also
          contains an N-terminal region rich in proline, glycine,
          and glutamine residues, which may play a role in
          interactions recruiting other molecules. .
          Length = 71

 Score = 29.9 bits (67), Expect = 0.054
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKG 97
          +LFVG L     ED+ +K+FA +G   E  + KG
Sbjct: 3  RLFVGNLPADITEDEFKKLFAKYGEPGEVFINKG 36


>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I
           polyadenylate-binding proteins.  This subfamily
           corresponds to the RRM2 of type I poly(A)-binding
           proteins (PABPs), highly conserved proteins that bind to
           the poly(A) tail present at the 3' ends of most
           eukaryotic mRNAs. They have been implicated in the
           regulation of poly(A) tail length during the
           polyadenylation reaction, translation initiation, mRNA
           stabilization by influencing the rate of deadenylation
           and inhibition of mRNA decapping. The family represents
           type I polyadenylate-binding proteins (PABPs), including
           polyadenylate-binding protein 1 (PABP-1 or PABPC1),
           polyadenylate-binding protein 3 (PABP-3 or PABPC3),
           polyadenylate-binding protein 4 (PABP-4 or APP-1 or
           iPABP), polyadenylate-binding protein 5 (PABP-5 or
           PABPC5), polyadenylate-binding protein 1-like
           (PABP-1-like or PABPC1L), polyadenylate-binding protein
           1-like 2 (PABPC1L2 or RBM32), polyadenylate-binding
           protein 4-like (PABP-4-like or PABPC4L), yeast
           polyadenylate-binding protein, cytoplasmic and nuclear
           (PABP or ACBP-67), and similar proteins. PABP-1 is a
           ubiquitously expressed multifunctional protein that may
           play a role in 3' end formation of mRNA, translation
           initiation, mRNA stabilization, protection of poly(A)
           from nuclease activity, mRNA deadenylation, inhibition
           of mRNA decapping, and mRNP maturation. Although PABP-1
           is thought to be a cytoplasmic protein, it is also found
           in the nucleus. PABP-1 may be involved in
           nucleocytoplasmic trafficking and utilization of mRNP
           particles. PABP-1 contains four copies of RNA
           recognition motifs (RRMs), also termed RBDs (RNA binding
           domains) or RNPs (ribonucleoprotein domains), a less
           well conserved linker region, and a proline-rich
           C-terminal conserved domain (CTD). PABP-3 is a
           testis-specific poly(A)-binding protein specifically
           expressed in round spermatids. It is mainly found in
           mammalian and may play an important role in the
           testis-specific regulation of mRNA homeostasis. PABP-3
           shows significant sequence similarity to PABP-1.
           However, it binds to poly(A) with a lower affinity than
           PABP-1. Moreover, PABP-1 possesses an A-rich sequence in
           its 5'-UTR and allows binding of PABP and blockage of
           translation of its own mRNA. In contrast, PABP-3 lacks
           the A-rich sequence in its 5'-UTR. PABP-4 is an
           inducible poly(A)-binding protein (iPABP) that is
           primarily localized to the cytoplasm. It shows
           significant sequence similarity to PABP-1 as well. The
           RNA binding properties of PABP-1 and PABP-4 appear to be
           identical. PABP-5 is encoded by PABPC5 gene within the
           X-specific subinterval, and expressed in fetal brain and
           in a range of adult tissues in mammalian, such as ovary
           and testis. It may play an important role in germ cell
           development. Unlike other PABPs, PABP-5 contains only
           four RRMs, but lacks both the linker region and the CTD.
           PABP-1-like and PABP-1-like 2 are the orthologs of
           PABP-1. PABP-4-like is the ortholog of PABP-5. Their
           cellular functions remain unclear. The family also
           includes the yeast PABP, a conserved poly(A) binding
           protein containing poly(A) tails that can be attached to
           the 3'-ends of mRNAs. The yeast PABP and its homologs
           may play important roles in the initiation of
           translation and in mRNA decay. Like vertebrate PABP-1,
           the yeast PABP contains four RRMs, a linker region, and
           a proline-rich CTD as well. The first two RRMs are
           mainly responsible for specific binding to poly(A). The
           proline-rich region may be involved in protein-protein
           interactions. .
          Length = 77

 Score = 29.8 bits (68), Expect = 0.064
 Identities = 12/39 (30%), Positives = 18/39 (46%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
           +F+  L K  +   +   F+ FG I  C V    +G SK
Sbjct: 5   IFIKNLDKSIDNKALYDTFSAFGNILSCKVATDENGGSK 43


>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear
          ribonucleoprotein 70 kDa (U1-70K) and similar proteins.
           This subfamily corresponds to the RRM of U1-70K, also
          termed snRNP70, a key component of the U1 snRNP
          complex, which is one of the key factors facilitating
          the splicing of pre-mRNA via interaction at the 5'
          splice site, and is involved in regulation of
          polyadenylation of some viral and cellular genes,
          enhancing or inhibiting efficient poly(A) site usage.
          U1-70K plays an essential role in targeting the U1
          snRNP to the 5' splice site through protein-protein
          interactions with regulatory RNA-binding splicing
          factors, such as the RS protein ASF/SF2. Moreover,
          U1-70K protein can specifically bind to stem-loop I of
          the U1 small nuclear RNA (U1 snRNA) contained in the U1
          snRNP complex. It also mediates the binding of U1C,
          another U1-specific protein, to the U1 snRNP complex.
          U1-70K contains a conserved RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), followed by an adjacent
          glycine-rich region at the N-terminal half, and two
          serine/arginine-rich (SR) domains at the C-terminal
          half. The RRM is responsible for the binding of
          stem-loop I of U1 snRNA molecule. Additionally, the
          most prominent immunodominant region that can be
          recognized by auto-antibodies from autoimmune patients
          may be located within the RRM. The SR domains are
          involved in protein-protein interaction with SR
          proteins that mediate 5' splice site recognition. For
          instance, the first SR domain is necessary and
          sufficient for ASF/SF2 Binding. The family also
          includes Drosophila U1-70K that is an essential
          splicing factor required for viability in flies, but
          its SR domain is dispensable. The yeast U1-70k doesn't
          contain easily recognizable SR domains and shows low
          sequence similarity in the RRM region with other U1-70k
          proteins and therefore not included in this family. The
          RRM domain is dispensable for yeast U1-70K function.
          Length = 91

 Score = 29.9 bits (68), Expect = 0.065
 Identities = 10/28 (35%), Positives = 15/28 (53%)

Query: 63 KKLFVGMLSKQQNEDDVRKIFAPFGTIE 90
          K LFV  L+    E  +R+ F  +G I+
Sbjct: 2  KTLFVARLNYDTTESKLRREFEEYGPIK 29


>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif. (a.k.a. RRM, RBD, or RNP
           domain).  The RRM motif is probably diagnostic of an RNA
           binding protein. RRMs are found in a variety of RNA
           binding proteins, including various hnRNP proteins,
           proteins implicated in regulation of alternative
           splicing, and protein components of snRNPs. The motif
           also appears in a few single stranded DNA binding
           proteins.
          Length = 56

 Score = 29.4 bits (67), Expect = 0.066
 Identities = 9/23 (39%), Positives = 15/23 (65%)

Query: 79  VRKIFAPFGTIEECTVLKGPDGT 101
           + K+F+PFG +E+  +LK   G 
Sbjct: 1   LYKLFSPFGNVEKIKLLKKKPGF 23


>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33
          (Cyp33) and similar proteins.  This subfamily
          corresponds to the RRM of Cyp33, also termed
          peptidyl-prolyl cis-trans isomerase E (PPIase E), or
          cyclophilin E, or rotamase E. Cyp33 is a nuclear
          RNA-binding cyclophilin with an N-terminal RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), and a
          C-terminal PPIase domain. Cyp33 possesses RNA-binding
          activity and preferentially binds to polyribonucleotide
          polyA and polyU, but hardly to polyG and polyC. It
          binds specifically to mRNA, which can stimulate its
          PPIase activity. Moreover, Cyp33 interacts with the
          third plant homeodomain (PHD3) zinc finger cassette of
          the mixed lineage leukemia (MLL) proto-oncoprotein and
          a poly-A RNA sequence through its RRM domain. It
          further mediates downregulation of the expression of
          MLL target genes HOXC8, HOXA9, CDKN1B, and C-MYC, in a
          proline isomerase-dependent manner. Cyp33 also
          possesses a PPIase activity that catalyzes cis-trans
          isomerization of the peptide bond preceding a proline,
          which has been implicated in the stimulation of folding
          and conformational changes in folded and unfolded
          proteins. The PPIase activity can be inhibited by the
          immunosuppressive drug cyclosporin A. .
          Length = 73

 Score = 29.9 bits (68), Expect = 0.067
 Identities = 10/25 (40%), Positives = 16/25 (64%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTI 89
          L+VG L+++ +E  +   F PFG I
Sbjct: 1  LYVGGLAEEVDEKVLHAAFIPFGDI 25


>gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous
          nuclear ribonucleoprotein D-like (hnRNP DL) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          hnRNP DL (or hnRNP D-like), also termed AU-rich element
          RNA-binding factor, or JKT41-binding protein (protein
          laAUF1 or JKTBP), is a dual functional protein that
          possesses DNA- and RNA-binding properties. It has been
          implicated in mRNA biogenesis at the transcriptional
          and post-transcriptional levels. hnRNP DL binds
          single-stranded DNA (ssDNA) or double-stranded DNA
          (dsDNA) in a non-sequencespecific manner, and interacts
          with poly(G) and poly(A) tenaciously. It contains two
          putative two RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), and a glycine- and tyrosine-rich C-terminus.
          .
          Length = 75

 Score = 30.0 bits (67), Expect = 0.071
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIE 90
          K+FVG LS    E+ +++ F  FG IE
Sbjct: 1  KVFVGGLSPDTTEEQIKEYFGAFGEIE 27


>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis
          thaliana phragmoplastin interacting protein 1 (PHIP1)
          and similar proteins.  This subfamily corresponds to
          the RRM1 of PHIP1. A. thaliana PHIP1 and its homologs
          represent a novel class of plant-specific RNA-binding
          proteins that may play a unique role in the polarized
          mRNA transport to the vicinity of the cell plate. The
          family members consist of multiple functional domains,
          including a lysine-rich domain (KRD domain) that
          contains three nuclear localization motifs (KKKR/NK),
          two RNA recognition motifs (RRMs), and three CCHC-type
          zinc fingers. PHIP1 is a peripheral membrane protein
          and is localized at the cell plate during cytokinesis
          in plants. In addition to phragmoplastin, PHIP1
          interacts with two Arabidopsis small GTP-binding
          proteins, Rop1 and Ran2. However, PHIP1 interacted only
          with the GTP-bound form of Rop1 but not the GDP-bound
          form. It also binds specifically to Ran2 mRNA. .
          Length = 72

 Score = 29.6 bits (67), Expect = 0.072
 Identities = 12/35 (34%), Positives = 20/35 (57%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPD 99
          ++VG +     ED++R  F+  G IEE  ++  PD
Sbjct: 1  VYVGGIPYYSTEDEIRSYFSYCGEIEELDLMTFPD 35


>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast
          nucleolar protein 3 (Npl3p) and similar proteins.  This
          subfamily corresponds to the RRM1 of Npl3p, also termed
          mitochondrial targeting suppressor 1 protein, or
          nuclear polyadenylated RNA-binding protein 1. Npl3p is
          a major yeast RNA-binding protein that competes with
          3'-end processing factors, such as Rna15, for binding
          to the nascent RNA, protecting the transcript from
          premature termination and coordinating transcription
          termination and the packaging of the fully processed
          transcript for export. It specifically recognizes a
          class of G/U-rich RNAs. Npl3p is a multi-domain protein
          containing two central RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), separated by a short
          linker and a C-terminal domain rich in glycine,
          arginine and serine residues. .
          Length = 67

 Score = 29.7 bits (67), Expect = 0.074
 Identities = 11/41 (26%), Positives = 20/41 (48%), Gaps = 11/41 (26%)

Query: 57 TPLPPDKKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKG 97
           P PPD            +E  +R+IF+P+G ++E  ++  
Sbjct: 5  RPFPPD-----------TSESAIREIFSPYGAVKEVKMISN 34


>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras
          GTPase-activating protein-binding protein G3BP1, G3BP2
          and similar proteins.  This subfamily corresponds to
          the RRM domain in the G3BP family of RNA-binding and
          SH3 domain-binding proteins. G3BP acts at the level of
          RNA metabolism in response to cell signaling, possibly
          as RNA transcript stabilizing factors or an RNase.
          Members include G3BP1, G3BP2 and similar proteins.
          These proteins associate directly with the SH3 domain
          of GTPase-activating protein (GAP), which functions as
          an inhibitor of Ras. They all contain an N-terminal
          nuclear transfer factor 2 (NTF2)-like domain, an acidic
          domain, a domain containing PXXP motif(s), an RNA
          recognition motif (RRM), and an Arg-Gly-rich region
          (RGG-rich region, or arginine methylation motif).
          Length = 81

 Score = 29.7 bits (67), Expect = 0.078
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 60 PPDKKLFVGMLSKQQNEDDVRKIFAPFGTIEE 91
          P   +LFVG L     ED++++ F  FG + E
Sbjct: 1  PDSHQLFVGNLPHDITEDELKEFFKEFGNVLE 32


>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding
           protein 11 (RBM11).  This subfamily corresponds to the
           RRM or RBM11, a novel tissue-specific splicing regulator
           that is selectively expressed in brain, cerebellum and
           testis, and to a lower extent in kidney. RBM11 is
           localized in the nucleoplasm and enriched in
           SRSF2-containing splicing speckles. It may play a role
           in the modulation of alternative splicing during neuron
           and germ cell differentiation. RBM11 contains an
           N-terminal RNA recognition motif (RRM), also termed RBD
           (RNA binding domain) or RNP (ribonucleoprotein domain),
           and a region lacking known homology at the C-terminus.
           The RRM of RBM11 is responsible for RNA binding, whereas
           the C-terminal region permits nuclear localization and
           homodimerization. .
          Length = 75

 Score = 29.5 bits (66), Expect = 0.093
 Identities = 13/42 (30%), Positives = 23/42 (54%)

Query: 62  DKKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
           D+ LFVG L  +  E+ + ++F   G + + T+ K  +G  K
Sbjct: 1   DRTLFVGNLECRVREEILYELFLQAGPLTKVTICKDKEGKPK 42


>gnl|CDD|241048 cd12604, RRM_RALY, RNA recognition motif in vertebrate
          RNA-binding protein Raly.  This subgroup corresponds to
          the RRM of Raly, also termed autoantigen p542, or
          heterogeneous nuclear ribonucleoprotein C-like 2, or
          hnRNP core protein C-like 2, or hnRNP associated with
          lethal yellow protein homolog, an RNA-binding protein
          that may play a critical role in embryonic development.
          It is encoded by Raly, a ubiquitously expressed gene of
          unknown function. Raly shows a high degree of identity
          with the 5' sequences of p542 gene encoding
          autoantigen, which can cross-react with EBNA-1 of the
          Epstein Barr virus. Raly contains two distinct domains,
          an N-terminal RNA recognition motif (RRM), also termed
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain), and a C-terminal auxiliary domain that
          includes a unique glycine/serine-rich stretch. .
          Length = 76

 Score = 29.2 bits (65), Expect = 0.10
 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 62 DKKLFVGMLSKQQ-NEDDVRKIFAPFGTIEECTVLKG 97
          + ++F+G L+     + DV  IF+ +G +  C+V KG
Sbjct: 1  NSRVFIGNLNTAVVKKSDVETIFSKYGRVVGCSVHKG 37


>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2
          and similar proteins.  This subfamily corresponds to
          the RRM2 of yeast protein gar2, a novel nucleolar
          protein required for 18S rRNA and 40S ribosomal subunit
          accumulation. It shares similar domain architecture
          with nucleolin from vertebrates and NSR1 from
          Saccharomyces cerevisiae. The highly phosphorylated
          N-terminal domain of gar2 is made up of highly acidic
          regions separated from each other by basic sequences,
          and contains multiple phosphorylation sites. The
          central domain of gar2 contains two closely adjacent
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains). The C-terminal RGG (or GAR) domain of gar2 is
          rich in glycine, arginine and phenylalanine residues. .
          Length = 73

 Score = 28.9 bits (65), Expect = 0.13
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPD 99
          LFVG LS   +ED + + F  +G I    +   PD
Sbjct: 1  LFVGNLSFDADEDSIYEAFGEYGEISSVRLPTDPD 35


>gnl|CDD|241027 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in heterogeneous
          nuclear ribonucleoprotein D0 (hnRNP D0) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          hnRNP D0, also termed AU-rich element RNA-binding
          protein 1, a UUAG-specific nuclear RNA binding protein
          that may be involved in pre-mRNA splicing and telomere
          elongation. hnRNP D0 contains two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), in the middle and
          an RGG box rich in glycine and arginine residues in the
          C-terminal part. Each of RRMs can bind solely to the
          UUAG sequence specifically. .
          Length = 75

 Score = 29.2 bits (65), Expect = 0.14
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIE 90
          K+FVG LS    E+ +R+ F  FG +E
Sbjct: 1  KIFVGGLSPDTPEEKIREYFGAFGEVE 27


>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding
          protein 43 (TDP-43) and similar proteins.  This
          subfamily corresponds to the RRM2 of TDP-43 (also
          termed TARDBP), a ubiquitously expressed pathogenic
          protein whose normal function and abnormal aggregation
          are directly linked to the genetic disease cystic
          fibrosis, and two neurodegenerative disorders:
          frontotemporal lobar degeneration (FTLD) and
          amyotrophic lateral sclerosis (ALS). TDP-43 binds both
          DNA and RNA, and has been implicated in transcriptional
          repression, pre-mRNA splicing and translational
          regulation. TDP-43 is a dimeric protein with two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and a C-terminal glycine-rich domain. The RRMs are
          responsible for DNA and RNA binding; they bind to TAR
          DNA and RNA sequences with UG-repeats. The glycine-rich
          domain can interact with the hnRNP family proteins to
          form the hnRNP-rich complex involved in splicing
          inhibition. It is also essential for the cystic
          fibrosis transmembrane conductance regulator (CFTR)
          exon 9-skipping activity. .
          Length = 71

 Score = 28.8 bits (65), Expect = 0.16
 Identities = 11/27 (40%), Positives = 20/27 (74%)

Query: 63 KKLFVGMLSKQQNEDDVRKIFAPFGTI 89
          +K+FVG L++   E+D+R+ F+ FG +
Sbjct: 1  RKVFVGRLTEDMTEEDLRQYFSQFGEV 27


>gnl|CDD|178752 PLN03213, PLN03213, repressor of silencing 3; Provisional.
          Length = 759

 Score = 30.2 bits (67), Expect = 0.18
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIE 90
          +L VG L +    DD+ KIF+P GT++
Sbjct: 12 RLHVGGLGESVGRDDLLKIFSPMGTVD 38


>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins
          family.  This subfamily corresponds to the RRM1 of the
          Hu proteins family which represents a group of
          RNA-binding proteins involved in diverse biological
          processes. Since the Hu proteins share high homology
          with the Drosophila embryonic lethal abnormal vision
          (ELAV) protein, the Hu family is sometimes referred to
          as the ELAV family. Drosophila ELAV is exclusively
          expressed in neurons and is required for the correct
          differentiation and survival of neurons in flies. The
          neuronal members of the Hu family include Hu-antigen B
          (HuB or ELAV-2 or Hel-N1), Hu-antigen C (HuC or ELAV-3
          or PLE21), and Hu-antigen D (HuD or ELAV-4), which play
          important roles in neuronal differentiation, plasticity
          and memory. HuB is also expressed in gonads. Hu-antigen
          R (HuR or ELAV-1 or HuA) is the ubiquitously expressed
          Hu family member. It has a variety of biological
          functions mostly related to the regulation of cellular
          response to DNA damage and other types of stress. HuR
          has an anti-apoptotic function during early cell stress
          response. It binds to mRNAs and enhances the expression
          of several anti-apoptotic proteins, such as p21waf1,
          p53, and prothymosin alpha. HuR also has pro-apoptotic
          function by promoting apoptosis when cell death is
          unavoidable. Furthermore, HuR may be important in
          muscle differentiation, adipogenesis, suppression of
          inflammatory response and modulation of gene expression
          in response to chronic ethanol exposure and amino acid
          starvation. Hu proteins perform their cytoplasmic and
          nuclear molecular functions by coordinately regulating
          functionally related mRNAs. In the cytoplasm, Hu
          proteins recognize and bind to AU-rich RNA elements
          (AREs) in the 3' untranslated regions (UTRs) of certain
          target mRNAs, such as GAP-43, vascular epithelial
          growth factor (VEGF), the glucose transporter GLUT1,
          eotaxin and c-fos, and stabilize those ARE-containing
          mRNAs. They also bind and regulate the translation of
          some target mRNAs, such as neurofilament M, GLUT1, and
          p27. In the nucleus, Hu proteins function as regulators
          of polyadenylation and alternative splicing. Each Hu
          protein contains three RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). RRM1 and RRM2 may
          cooperate in binding to an ARE. RRM3 may help to
          maintain the stability of the RNA-protein complex, and
          might also bind to poly(A) tails or be involved in
          protein-protein interactions. .
          Length = 78

 Score = 28.5 bits (64), Expect = 0.18
 Identities = 10/32 (31%), Positives = 19/32 (59%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK 96
          L V  L +   +D++R +F+  G IE C +++
Sbjct: 4  LIVNYLPQNMTQDEIRSLFSSIGEIESCKLIR 35


>gnl|CDD|241038 cd12594, RRM1_SRSF4, RNA recognition motif 1 in vertebrate
          serine/arginine-rich splicing factor 4 (SRSF4).  This
          subgroup corresponds to the RRM1 of SRSF4, also termed
          pre-mRNA-splicing factor SRp75, or SRP001LB, or
          splicing factor, arginine/serine-rich 4 (SFRS4). SRSF4
          is a splicing regulatory serine/arginine (SR) protein
          that plays an important role in both constitutive
          splicing and alternative splicing of many pre-mRNAs.
          For instance, it interacts with heterogeneous nuclear
          ribonucleoproteins, hnRNP G and hnRNP E2, and further
          regulates the 5' splice site of tau exon 10, whose
          misregulation causes frontotemporal dementia. SFSF4
          also induces production of HIV-1 vpr mRNA through the
          inhibition of the 5'-splice site of exon 3. In
          addition, it activates splicing of the cardiac troponin
          T (cTNT) alternative exon by direct interactions with
          the cTNT exon 5 enhancer RNA. SRSF4 can shuttle between
          the nucleus and cytoplasm. It contains an N-terminal
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain), a
          glycine-rich region, an internal region homologous to
          the RRM, and a very long, highly phosphorylated
          C-terminal SR domains rich in serine-arginine
          dipeptides. .
          Length = 74

 Score = 28.4 bits (63), Expect = 0.20
 Identities = 12/34 (35%), Positives = 19/34 (55%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKG 97
          ++++G LS Q  E DV + F  +G I E  +  G
Sbjct: 1  RVYIGRLSYQARERDVERFFKGYGKILEVDLKNG 34


>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor.  This
          model describes the ELAV/HuD subfamily of splicing
          factors found in metazoa. HuD stands for the human
          paraneoplastic encephalomyelitis antigen D of which
          there are 4 variants in human. ELAV stnds for the
          Drosophila Embryonic lethal abnormal visual protein.
          ELAV-like splicing factors are also known in human as
          HuB (ELAV-like protein 2), HuC (ELAV-like protein 3,
          Paraneoplastic cerebellar degeneration-associated
          antigen) and HuR (ELAV-like protein 1). These genes are
          most closely related to the sex-lethal subfamily of
          splicing factors found in Dipteran insects (TIGR01659).
          These proteins contain 3 RNA-recognition motifs (rrm:
          pfam00076).
          Length = 352

 Score = 29.9 bits (67), Expect = 0.21
 Identities = 9/36 (25%), Positives = 18/36 (50%)

Query: 61 PDKKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK 96
              L V  L +   ++++R +F   G IE C +++
Sbjct: 2  SKTNLIVNYLPQTMTQEEIRSLFTSIGEIESCKLVR 37



 Score = 26.8 bits (59), Expect = 2.0
 Identities = 10/28 (35%), Positives = 15/28 (53%)

Query: 62  DKKLFVGMLSKQQNEDDVRKIFAPFGTI 89
              L+V  L K   + ++  IF+PFG I
Sbjct: 89  GANLYVSGLPKTMTQHELESIFSPFGQI 116



 Score = 26.1 bits (57), Expect = 3.9
 Identities = 9/34 (26%), Positives = 19/34 (55%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGP 98
           +FV  LS   +E  + ++F PFG ++   +++  
Sbjct: 272 IFVYNLSPDTDETVLWQLFGPFGAVQNVKIIRDL 305


>gnl|CDD|240794 cd12348, RRM1_SHARP, RNA recognition motif 1 in
           SMART/HDAC1-associated repressor protein (SHARP) and
           similar proteins.  This subfamily corresponds to the
           RRM1 of SHARP, also termed Msx2-interacting protein
           (MINT), or SPEN homolog, an estrogen-inducible
           transcriptional repressor that interacts directly with
           the nuclear receptor corepressor SMRT, histone
           deacetylases (HDACs) and components of the NuRD complex.
           SHARP recruits HDAC activity and binds to the steroid
           receptor RNA coactivator SRA through four conserved
           N-terminal RNA recognition motifs (RRMs), also termed
           RBDs (RNA binding domains) or RNPs (ribonucleoprotein
           domains), further suppressing SRA-potentiated steroid
           receptor transcription activity. Thus, SHARP has the
           capacity to modulate both liganded and nonliganded
           nuclear receptors. SHARP also has been identified as a
           component of transcriptional repression complexes in
           Notch/RBP-Jkappa signaling pathways. In addition to the
           N-terminal RRMs, SHARP possesses a C-terminal SPOC
           domain (Spen paralog and ortholog C-terminal domain),
           which is highly conserved among Spen proteins.  .
          Length = 75

 Score = 28.6 bits (64), Expect = 0.21
 Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 2/40 (5%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVL--KGPDGTS 102
           L+VG L +   E+ + + F  +G +E   +L  +G DG  
Sbjct: 2   LWVGNLPENVREERISEHFKRYGRVESVKILPKRGSDGGV 41


>gnl|CDD|240805 cd12359, RRM2_VICKZ, RNA recognition motif 2 in the VICKZ family
           proteins.  This subfamily corresponds to the RRM2 of
           IGF-II mRNA-binding proteins (IGF2BPs or IMPs) in the
           VICKZ family that have been implicated in the
           post-transcriptional regulation of several different
           RNAs and in subcytoplasmic localization of mRNAs during
           embryogenesis. IGF2BPs are composed of two RNA
           recognition motifs (RRMs), also termed RBDs (RNA binding
           domains) or RNPs (ribonucleoprotein domains), and four
           hnRNP K homology (KH) domains. .
          Length = 76

 Score = 28.5 bits (64), Expect = 0.21
 Identities = 6/39 (15%), Positives = 18/39 (46%)

Query: 63  KKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGT 101
           +K+ +  +      +D+  + + +GT++ C  +     T
Sbjct: 1   RKIQISNIPPHVRWEDLDSLLSTYGTVKNCEQVPTKSET 39


>gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous
          nuclear ribonucleoprotein A3 (hnRNP A3) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          hnRNP A3, a novel RNA trafficking response
          element-binding protein that interacts with the hnRNP
          A2 response element (A2RE) independently of hnRNP A2
          and participates in the trafficking of A2RE-containing
          RNA. hnRNP A3 can shuttle between the nucleus and the
          cytoplasm. It contains two RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), followed by a long
          glycine-rich region at the C-terminus. .
          Length = 80

 Score = 28.4 bits (63), Expect = 0.25
 Identities = 12/34 (35%), Positives = 19/34 (55%)

Query: 63 KKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK 96
          KK+FVG + +   E  +R  F  +G IE   V++
Sbjct: 1  KKIFVGGIKEDTEEYHLRDYFEKYGKIETIEVME 34


>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in
          heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP
          A/B, hnRNP DL and similar proteins.  This subfamily
          corresponds to the RRM1 in hnRNP D0, hnRNP A/B, hnRNP
          DL and similar proteins. hnRNP D0 is a UUAG-specific
          nuclear RNA binding protein that may be involved in
          pre-mRNA splicing and telomere elongation. hnRNP A/B is
          an RNA unwinding protein with a high affinity for G-
          followed by U-rich regions. hnRNP A/B has also been
          identified as an APOBEC1-binding protein that interacts
          with apolipoprotein B (apoB) mRNA transcripts around
          the editing site and thus plays an important role in
          apoB mRNA editing. hnRNP DL (or hnRNP D-like) is a dual
          functional protein that possesses DNA- and RNA-binding
          properties. It has been implicated in mRNA biogenesis
          at the transcriptional and post-transcriptional levels.
          All members in this family contain two putative RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and a glycine- and tyrosine-rich C-terminus. .
          Length = 74

 Score = 28.3 bits (63), Expect = 0.26
 Identities = 12/34 (35%), Positives = 21/34 (61%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGP 98
          +FVG LS    + D+++ F+ FG + +CT+   P
Sbjct: 1  MFVGGLSWDTTKKDLKEYFSKFGEVVDCTIKIDP 34


>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding
          protein 19 (RBM19) and similar proteins.  This subgroup
          corresponds to the RRM3 of RBM19, also termed
          RNA-binding domain-1 (RBD-1), which is a nucleolar
          protein conserved in eukaryotes. It is involved in
          ribosome biogenesis by processing rRNA. In addition, it
          is essential for preimplantation development. RBM19 has
          a unique domain organization containing 6 conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains). .
          Length = 79

 Score = 28.1 bits (63), Expect = 0.26
 Identities = 9/29 (31%), Positives = 18/29 (62%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEEC 92
          +LF+  L+    E+D+ K+F+ +G + E 
Sbjct: 4  RLFIRNLAYTCTEEDLEKLFSKYGPLSEV 32


>gnl|CDD|240802 cd12356, RRM_PPARGC1B, RNA recognition motif in peroxisome
          proliferator-activated receptor gamma coactivator
          1-beta (PGC-1-beta) and similar proteins.  This
          subfamily corresponds to the RRM of PGC-1beta, also
          termed PPAR-gamma coactivator 1-beta, or PPARGC-1-beta,
          or PGC-1-related estrogen receptor alpha coactivator,
          which is one of the members of PGC-1 transcriptional
          coactivators family, including PGC-1alpha and
          PGC-1-related coactivator (PRC). PGC-1beta plays a
          nonredundant role in controlling mitochondrial
          oxidative energy metabolism and affects both, insulin
          sensitivity and mitochondrial biogenesis, and functions
          in a number of oxidative tissues. It is involved in
          maintaining baseline mitochondrial function and cardiac
          contractile function following pressure overload
          hypertrophy by preserving glucose metabolism and
          preventing oxidative stress. PGC-1beta induces
          hypertriglyceridemia in response to dietary fats
          through activating hepatic lipogenesis and lipoprotein
          secretion. It can stimulate apolipoprotein C3 (APOC3)
          expression, further mediating hypolipidemic effect of
          nicotinic acid. PGC-1beta also drives nuclear
          respiratory factor 1 (NRF-1) target gene expression and
          NRF-1 and estrogen related receptor alpha
          (ERRalpha)-dependent mitochondrial biogenesis. The
          modulation of the expression of PGC-1beta can trigger
          ERRalpha-induced adipogenesis. PGC-1beta is also a
          potent regulator inducing angiogenesis in skeletal
          muscle. The transcriptional activity of PGC-1beta can
          be increased through binding to host cell factor (HCF),
          a cellular protein involved in herpes simplex virus
          (HSV) infection and cell cycle regulation. PGC-1beta is
          a multi-domain protein containing an N-terminal
          activation domain, an LXXLL coactivator signature, a
          tetrapeptide motif (DHDY) responsible for HCF binding,
          two glutamic/aspartic acid-rich acidic domains, and an
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain). In
          contrast to PGC-1alpha, PGC-1beta lacks most of the
          arginine/serine (SR)-rich domain that is responsible
          for the regulation of RNA processing. .
          Length = 79

 Score = 28.3 bits (63), Expect = 0.27
 Identities = 12/31 (38%), Positives = 19/31 (61%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTVL 95
          +++  LS   +  +++K F  FG IEEC VL
Sbjct: 5  IYIRNLSSSMSSTELKKRFEVFGEIEECKVL 35


>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast
          nucleolar protein 13 (Nop13p) and similar proteins.
          This subfamily corresponds to the RRM2 of Nop13p
          encoded by YNL175c from Saccharomyces cerevisiae. It
          shares high sequence similarity with nucleolar protein
          12 (Nop12p). Both Nop12p and Nop13p are not essential
          for growth. However, unlike Nop12p that is localized to
          the nucleolus, Nop13p localizes primarily to the
          nucleolus but is also present in the nucleoplasm to a
          lesser extent. Nop13p contains two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains). .
          Length = 73

 Score = 28.2 bits (63), Expect = 0.28
 Identities = 12/25 (48%), Positives = 15/25 (60%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTI 89
          LFVG LS +  ED++R  F   G I
Sbjct: 1  LFVGNLSFETTEDELRAHFGRVGRI 25


>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split
          end) protein family.  This subfamily corresponds to the
          RRM3 domain in the Spen (split end) protein family
          which includes RNA binding motif protein 15 (RBM15),
          putative RNA binding motif protein 15B (RBM15B) and
          similar proteins found in Metazoa. RBM15, also termed
          one-twenty two protein 1 (OTT1), conserved in
          eukaryotes, is a novel mRNA export factor and is a
          novel component of the NXF1 pathway. It binds to NXF1
          and serves as receptor for the RNA export element RTE.
          It also possess mRNA export activity and can facilitate
          the access of DEAD-box protein DBP5 to mRNA at the
          nuclear pore complex (NPC). RNA-binding protein 15B
          (RBM15B), also termed one twenty-two 3 (OTT3), is a
          paralog of RBM15 and therefore has post-transcriptional
          regulatory activity. It is a nuclear protein sharing
          with RBM15 the association with the splicing factor
          compartment and the nuclear envelope as well as the
          binding to mRNA export factors NXF1 and Aly/REF.
          Members in this family belong to the Spen (split end)
          protein family, which shares a domain architecture
          comprising of three N-terminal RNA recognition motifs
          (RRMs), also known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and a C-terminal SPOC (Spen
          paralog and ortholog C-terminal) domain. .
          Length = 72

 Score = 27.9 bits (63), Expect = 0.30
 Identities = 9/33 (27%), Positives = 14/33 (42%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKG 97
          L+VG L    +  ++ + F  FG I       G
Sbjct: 1  LWVGGLGPWTSLAELEREFDRFGAIRRIDYDPG 33


>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein
           PTB-binding raver-1, raver-2 and similar proteins.  This
           subfamily corresponds to the RRM3 of raver-1 and
           raver-2. Raver-1 is a ubiquitously expressed
           heterogeneous nuclear ribonucleoprotein (hnRNP) that
           serves as a co-repressor of the nucleoplasmic splicing
           repressor polypyrimidine tract-binding protein
           (PTB)-directed splicing of select mRNAs. It shuttles
           between the cytoplasm and the nucleus and can accumulate
           in the perinucleolar compartment, a dynamic nuclear
           substructure that harbors PTB. Raver-1 also modulates
           focal adhesion assembly by binding to the cytoskeletal
           proteins, including alpha-actinin, vinculin, and
           metavinculin (an alternatively spliced isoform of
           vinculin) at adhesion complexes, particularly in
           differentiated muscle tissue. Raver-2 is a novel member
           of the heterogeneous nuclear ribonucleoprotein (hnRNP)
           family. It shows high sequence homology to raver-1.
           Raver-2 exerts a spatio-temporal expression pattern
           during embryogenesis and is mainly limited to
           differentiated neurons and glia cells. Although it
           displays nucleo-cytoplasmic shuttling in heterokaryons,
           raver2 localizes to the nucleus in glia cells and
           neurons. Raver-2 can interact with PTB and may
           participate in PTB-mediated RNA-processing. However,
           there is no evidence indicating that raver-2 can bind to
           cytoplasmic proteins. Both, raver-1 and raver-2, contain
           three N-terminal RNA recognition motifs (RRMs), also
           termed RBDs (RNA binding domains) or RNPs
           (ribonucleoprotein domains), two putative nuclear
           localization signals (NLS) at the N- and C-termini, a
           central leucine-rich region, and a C-terminal region
           harboring two [SG][IL]LGxxP motifs. They binds to RNA
           through the RRMs. In addition, the two [SG][IL]LGxxP
           motifs serve as the PTB-binding motifs in raver1.
           However, raver-2 interacts with PTB through the SLLGEPP
           motif only. .
          Length = 92

 Score = 28.4 bits (64), Expect = 0.33
 Identities = 12/42 (28%), Positives = 20/42 (47%), Gaps = 1/42 (2%)

Query: 63  KKLFVGMLSKQQNEDDV-RKIFAPFGTIEECTVLKGPDGTSK 103
           + LFV  L K   +  + RK+F+  G    C +   P+G  +
Sbjct: 3   RCLFVDRLPKTFRDVSILRKLFSQVGKPTFCQLAIAPNGQPR 44


>gnl|CDD|241089 cd12645, RRM_SRSF3, RNA recognition motif in vertebrate
           serine/arginine-rich splicing factor 3 (SRSF3).  This
           subgroup corresponds to the RRM of SRSF3, also termed
           pre-mRNA-splicing factor SRp20, a splicing regulatory
           serine/arginine (SR) protein that modulates alternative
           splicing by interacting with RNA cis-elements in a
           concentration- and cell differentiation-dependent
           manner. It is also involved in termination of
           transcription, alternative RNA polyadenylation, RNA
           export, and protein translation. SRSF3 is critical for
           cell proliferation and tumor induction and maintenance.
           SRSF3 can shuttle between the nucleus and cytoplasm. It
           contains a single N-terminal RNA recognition motif
           (RRM), also termed RBD (RNA binding domain) or RNP
           (ribonucleoprotein domain), and a C-terminal RS domain
           rich in serine-arginine dipeptides. The RRM domain is
           involved in RNA binding, and the RS domain has been
           implicated in protein shuttling and protein-protein
           interactions. .
          Length = 81

 Score = 28.1 bits (62), Expect = 0.33
 Identities = 12/41 (29%), Positives = 21/41 (51%)

Query: 60  PPDKKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDG 100
           P D K++VG L    N+ ++ + F  +G +    V + P G
Sbjct: 2   PLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPG 42


>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding
           protein 7 (RBM7) and similar proteins.  This subfamily
           corresponds to the RRM of RBM7, RBM11 and their
           eukaryotic homologous. RBM7 is an ubiquitously expressed
           pre-mRNA splicing factor that enhances messenger RNA
           (mRNA) splicing in a cell-specific manner or in a
           certain developmental process, such as spermatogenesis.
           It interacts with splicing factors SAP145 (the
           spliceosomal splicing factor 3b subunit 2) and SRp20,
           and may play a more specific role in meiosis entry and
           progression. Together with additional testis-specific
           RNA-binding proteins, RBM7 may regulate the splicing of
           specific pre-mRNA species that are important in the
           meiotic cell cycle. RBM11 is a novel tissue-specific
           splicing regulator that is selectively expressed in
           brain, cerebellum and testis, and to a lower extent in
           kidney. It is localized in the nucleoplasm and enriched
           in SRSF2-containing splicing speckles. It may play a
           role in the modulation of alternative splicing during
           neuron and germ cell differentiation. Both, RBM7 and
           RBM11, contain an N-terminal RNA recognition motif
           (RRM), also termed RBD (RNA binding domain) or RNP
           (ribonucleoprotein domain), and a region lacking known
           homology at the C-terminus. The RRM is responsible for
           RNA binding, whereas the C-terminal region permits
           nuclear localization and homodimerization. .
          Length = 75

 Score = 28.1 bits (63), Expect = 0.33
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 62  DKKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
           D+ LFVG L  +  E+ + ++F   G +E   + K P+G  K
Sbjct: 1   DRTLFVGNLDARVTEEILYELFLQAGPLEGVKIPKDPNGKPK 42


>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding
           protein 19 (RBM19), yeast multiple RNA-binding
           domain-containing protein 1 (MRD1) and similar proteins.
            This subfamily corresponds to the RRM1 of RBM19 and
           MRD1. RBM19, also termed RNA-binding domain-1 (RBD-1),
           is a nucleolar protein conserved in eukaryotes. It is
           involved in ribosome biogenesis by processing rRNA and
           is essential for preimplantation development. It has a
           unique domain organization containing 6 conserved RNA
           recognition motifs (RRMs), also termed RBDs (RNA binding
           domains) or RNPs (ribonucleoprotein domains). MRD1 is
           encoded by a novel yeast gene MRD1 (multiple RNA-binding
           domain). It is well-conserved in yeast and its homologs
           exist in all eukaryotes. MRD1 is present in the
           nucleolus and the nucleoplasm. It interacts with the 35
           S precursor rRNA (pre-rRNA) and U3 small nucleolar RNAs
           (snoRNAs). It is essential for the initial processing at
           the A0-A2 cleavage sites in the 35 S pre-rRNA. MRD1
           contains 5 conserved RRMs, which may play an important
           structural role in organizing specific rRNA processing
           events. .
          Length = 77

 Score = 28.0 bits (63), Expect = 0.36
 Identities = 11/41 (26%), Positives = 20/41 (48%), Gaps = 1/41 (2%)

Query: 64  KLFVGMLSKQQNEDDVRKIF-APFGTIEECTVLKGPDGTSK 103
           +L V  L     E ++++ F    G I +  +L+  DG S+
Sbjct: 2   RLIVKNLPASLTEAELKEHFSKHGGEITDVKLLRTEDGKSR 42


>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell
           carcinoma antigen recognized by T-cells 3 (SART3) and
           similar proteins.  This subfamily corresponds to the
           RRM1 of SART3, also termed Tat-interacting protein of
           110 kDa (Tip110), an RNA-binding protein expressed in
           the nucleus of the majority of proliferating cells,
           including normal cells and malignant cells, but not in
           normal tissues except for the testes and fetal liver. It
           is involved in the regulation of mRNA splicing probably
           via its complex formation with RNA-binding protein with
           a serine-rich domain (RNPS1), a pre-mRNA-splicing
           factor. SART3 has also been identified as a nuclear
           Tat-interacting protein that regulates Tat
           transactivation activity through direct interaction and
           functions as an important cellular factor for HIV-1 gene
           expression and viral replication. In addition, SART3 is
           required for U6 snRNP targeting to Cajal bodies. It
           binds specifically and directly to the U6 snRNA,
           interacts transiently with the U6 and U4/U6 snRNPs, and
           promotes the reassembly of U4/U6 snRNPs after splicing
           in vitro. SART3 contains an N-terminal
           half-a-tetratricopeptide repeat (HAT)-rich domain, a
           nuclearlocalization signal (NLS) domain, and two
           C-terminal RNA recognition motifs (RRMs), also termed
           RBDs (RNA binding domains) or RNPs (ribonucleoprotein
           domains). .
          Length = 72

 Score = 27.6 bits (62), Expect = 0.37
 Identities = 14/39 (35%), Positives = 22/39 (56%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
           +FV  L     ED++RK+F+  G I +  ++K   G SK
Sbjct: 2   VFVSNLDYSVPEDELRKLFSKCGEITDVRLVKNYKGKSK 40


>gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding
          protein MRN1 and similar proteins.  This subgroup
          corresponds to the RRM2 of MRN1, also termed multicopy
          suppressor of RSC-NHP6 synthetic lethality protein 1,
          or post-transcriptional regulator of 69 kDa, which is a
          RNA-binding protein found in yeast. Although its
          specific biological role remains unclear, MRN1 might be
          involved in translational regulation. Members in this
          family contain four copies of conserved RNA recognition
          motif (RRM), also known as RBD (RNA binding domain) or
          RNP (ribonucleoprotein domain). .
          Length = 78

 Score = 27.8 bits (62), Expect = 0.37
 Identities = 8/34 (23%), Positives = 22/34 (64%)

Query: 63 KKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK 96
          + +++G L +  +E+++R+    FG I++  ++K
Sbjct: 4  RNVYIGNLPESYSEEELREDLEKFGPIDQIKIVK 37


>gnl|CDD|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous
          nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and
          similar proteins.  This subgroup corresponds to the
          RRM2 of hnRNP A2/B1, an RNA trafficking response
          element-binding protein that interacts with the hnRNP
          A2 response element (A2RE). Many mRNAs, such as myelin
          basic protein (MBP), myelin-associated oligodendrocytic
          basic protein (MOBP), carboxyanhydrase II (CAII),
          microtubule-associated protein tau, and amyloid
          precursor protein (APP) are trafficked by hnRNP A2/B1.
          hnRNP A2/B1 also functions as a splicing factor that
          regulates alternative splicing of the tumor
          suppressors, such as BIN1, WWOX, the antiapoptotic
          proteins c-FLIP and caspase-9B, the insulin receptor
          (IR), and the RON proto-oncogene among others.
          Overexpression of hnRNP A2/B1 has been described in
          many cancers. It functions as a nuclear matrix protein
          involving in RNA synthesis and the regulation of
          cellular migration through alternatively splicing
          pre-mRNA. It may play a role in tumor cell
          differentiation. hnRNP A2/B1 contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          followed by a long glycine-rich region at the
          C-terminus. .
          Length = 80

 Score = 28.1 bits (62), Expect = 0.38
 Identities = 11/33 (33%), Positives = 18/33 (54%)

Query: 63 KKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVL 95
          KKLFVG + +   E  +R  F  +G I+   ++
Sbjct: 1  KKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEII 33


>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant
          Mei2-like proteins.  This subgroup corresponds to the
          RRM1 of Mei2-like proteins that represent an ancient
          eukaryotic RNA-binding proteins family. Their
          corresponding Mei2-like genes appear to have arisen
          early in eukaryote evolution, been lost from some
          lineages such as Saccharomyces cerevisiae and
          metazoans, and diversified in the plant lineage. The
          plant Mei2-like genes may function in cell fate
          specification during development, rather than as
          stimulators of meiosis. Members in this family contain
          three RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains). The C-terminal RRM (RRM3) is unique to
          Mei2-like proteins and it is highly conserved between
          plants and fungi. Up to date, the intracellular
          localization, RNA target(s), cellular interactions and
          phosphorylation states of Mei2-like proteins in plants
          remain unclear. .
          Length = 77

 Score = 27.6 bits (62), Expect = 0.41
 Identities = 8/26 (30%), Positives = 15/26 (57%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIE 90
          LFV  ++    ++++R +F  FG I 
Sbjct: 4  LFVRNINSNVEDEELRALFEQFGDIR 29


>gnl|CDD|240875 cd12429, RRM_DNAJC17, RNA recognition motif in the DnaJ homolog
          subfamily C member 17.  The CD corresponds to the RRM
          of some eukaryotic DnaJ homolog subfamily C member 17
          and similar proteins. DnaJ/Hsp40 (heat shock protein
          40) proteins are highly conserved and play crucial
          roles in protein translation, folding, unfolding,
          translocation, and degradation. They act primarily by
          stimulating the ATPase activity of Hsp70s, an important
          chaperonine family. Members in this family contains an
          N-terminal DnaJ domain or J-domain, which mediates the
          interaction with Hsp70. They also contains a RNA
          recognition motif (RRM), also known as RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), at the
          C-terminus, which may play an essential role in RNA
          binding. .
          Length = 74

 Score = 27.6 bits (62), Expect = 0.42
 Identities = 8/22 (36%), Positives = 15/22 (68%)

Query: 75 NEDDVRKIFAPFGTIEECTVLK 96
          +ED++RKIF+ +G + +  V  
Sbjct: 17 SEDELRKIFSKYGDVSDVVVSS 38


>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit
          4 (THOC4) and similar proteins.  This subgroup
          corresponds to the RRM of THOC4, also termed
          transcriptional coactivator Aly/REF, or ally of AML-1
          and LEF-1, or bZIP-enhancing factor BEF, an mRNA
          transporter protein with a well conserved RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain). It is
          involved in RNA transportation from the nucleus. THOC4
          was initially identified as a transcription coactivator
          of LEF-1 and AML-1 for the TCRalpha enhancer function.
          In addition, THOC4 specifically binds to rhesus (RH)
          promoter in erythroid. It might be a novel
          transcription cofactor for erythroid-specific genes. .
          Length = 75

 Score = 27.6 bits (62), Expect = 0.45
 Identities = 11/31 (35%), Positives = 20/31 (64%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTV 94
          KL V  L    ++DD++++FA FG +++  V
Sbjct: 2  KLLVSNLDFGVSDDDIKELFAEFGALKKAAV 32


>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in
           granule-associated RNA binding proteins p40-TIA-1 and
           TIAR.  This subfamily corresponds to the RRM1 of
           nucleolysin TIA-1 isoform p40 (p40-TIA-1 or TIA-1) and
           nucleolysin TIA-1-related protein (TIAR), both of which
           are granule-associated RNA binding proteins involved in
           inducing apoptosis in cytotoxic lymphocyte (CTL) target
           cells. TIA-1 and TIAR share high sequence similarity.
           They are expressed in a wide variety of cell types.
           TIA-1 can be phosphorylated by a serine/threonine kinase
           that is activated during Fas-mediated apoptosis.TIAR is
           mainly localized in the nucleus of hematopoietic and
           nonhematopoietic cells. It is translocated from the
           nucleus to the cytoplasm in response to exogenous
           triggers of apoptosis. Both, TIA-1 and TIAR, bind
           specifically to poly(A) but not to poly(C) homopolymers.
           They are composed of three N-terminal highly homologous
           RNA recognition motifs (RRMs), also termed RBDs (RNA
           binding domains) or RNPs (ribonucleoprotein domains),
           and a glutamine-rich C-terminal auxiliary domain
           containing a lysosome-targeting motif. TIA-1 and TIAR
           interact with RNAs containing short stretches of
           uridylates and their RRM2 can mediate the specific
           binding to uridylate-rich RNAs. The C-terminal auxiliary
           domain may be responsible for interacting with other
           proteins. In addition, TIA-1 and TIAR share a potential
           serine protease-cleavage site (Phe-Val-Arg) localized at
           the junction between their RNA binding domains and their
           C-terminal auxiliary domains.
          Length = 72

 Score = 27.7 bits (62), Expect = 0.46
 Identities = 10/38 (26%), Positives = 20/38 (52%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTS 102
           L+VG L +   ED + ++F+  G I+ C +++      
Sbjct: 1   LYVGNLDRTVTEDLLAELFSQIGPIKSCKLIREHGNDP 38


>gnl|CDD|241039 cd12595, RRM1_SRSF5, RNA recognition motif 1 in vertebrate
          serine/arginine-rich splicing factor 5 (SRSF5).  This
          subgroup corresponds to the RRM1 of SRSF5, also termed
          delayed-early protein HRS, or pre-mRNA-splicing factor
          SRp40, or splicing factor, arginine/serine-rich 5
          (SFRS5). SFSF5 is an essential splicing regulatory
          serine/arginine (SR) protein that regulates both
          alternative splicing and basal splicing. It is the only
          SR protein efficiently selected from nuclear extracts
          (NE) by the splicing enhancer (ESE) and it is necessary
          for enhancer activation. SRSF5 also functions as a
          factor required for insulin-regulated splice site
          selection for protein kinase C (PKC) betaII mRNA. It is
          involved in the regulation of PKCbetaII exon inclusion
          by insulin via its increased phosphorylation by a
          phosphatidylinositol 3-kinase (PI 3-kinase) signaling
          pathway. Moreover, SRSF5 can regulate alternative
          splicing in exon 9 of glucocorticoid receptor pre-mRNA
          in a dose-dependent manner. SRSF5 contains two
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), followed by a C-terminal RS domains rich in
          serine-arginine dipeptides. The specific RNA binding by
          SRSF5 requires the phosphorylation of its SR domain.  .
          Length = 70

 Score = 27.6 bits (61), Expect = 0.47
 Identities = 10/34 (29%), Positives = 19/34 (55%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKG 97
          ++F+G L+    E DV + F  +G I +  + +G
Sbjct: 1  RVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRG 34


>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous
          nuclear ribonucleoprotein D0 (hnRNP D0) and similar
          proteins.  This subgroup corresponds to the RRM1 of
          hnRNP D0, also termed AU-rich element RNA-binding
          protein 1, which is a UUAG-specific nuclear RNA binding
          protein that may be involved in pre-mRNA splicing and
          telomere elongation. hnRNP D0 contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          in the middle and an RGG box rich in glycine and
          arginine residues in the C-terminal part. Each of RRMs
          can bind solely to the UUAG sequence specifically. .
          Length = 74

 Score = 27.3 bits (60), Expect = 0.54
 Identities = 11/34 (32%), Positives = 20/34 (58%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGP 98
          +F+G LS    + D++  F+ FG + +CT+   P
Sbjct: 1  MFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDP 34


>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate
          heterogeneous nuclear ribonucleoprotein R (hnRNP R).
          This subgroup corresponds to the RRM3 of hnRNP R. a
          ubiquitously expressed nuclear RNA-binding protein that
          specifically bind mRNAs with a preference for poly(U)
          stretches. Upon binding of RNA, hnRNP R forms
          oligomers, most probably dimers. hnRNP R has been
          implicated in mRNA processing and mRNA transport, and
          also acts as a regulator to modify binding to ribosomes
          and RNA translation. hnRNP R is predominantly located
          in axons of motor neurons and to a much lower degree in
          sensory axons. In axons of motor neurons, it also
          functions as a cytosolic protein and interacts with
          wild type of survival motor neuron (SMN) proteins
          directly, further providing a molecular link between
          SMN and the spliceosome. Moreover, hnRNP R plays an
          important role in neural differentiation and
          development, as well as in retinal development and
          light-elicited cellular activities. hnRNP R contains an
          acidic auxiliary N-terminal region, followed by two
          well-defined and one degenerated RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a C-terminal RGG
          motif; hnRNP R binds RNA through its RRM domains. .
          Length = 72

 Score = 27.3 bits (60), Expect = 0.57
 Identities = 13/34 (38%), Positives = 18/34 (52%)

Query: 63 KKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK 96
          K LFV  L+    E+ + K F+ FG +E    LK
Sbjct: 2  KVLFVRNLATTVTEEILEKSFSEFGKLERVKKLK 35


>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and
           cytoplasmic polyadenylated RNA-binding protein PUB1 and
           similar proteins.  This subgroup corresponds to the RRM1
           of yeast protein PUB1, also termed ARS consensus-binding
           protein ACBP-60, or poly uridylate-binding protein, or
           poly(U)-binding protein. PUB1 has been identified as
           both, a heterogeneous nuclear RNA-binding protein
           (hnRNP) and a cytoplasmic mRNA-binding protein (mRNP),
           which may be stably bound to a translationally inactive
           subpopulation of mRNAs within the cytoplasm. It is
           distributed in both, the nucleus and the cytoplasm, and
           binds to poly(A)+ RNA (mRNA or pre-mRNA). Although it is
           one of the major cellular proteins cross-linked by UV
           light to polyadenylated RNAs in vivo, PUB1 is
           nonessential for cell growth in yeast. PUB1 also binds
           to T-rich single stranded DNA (ssDNA); however, there is
           no strong evidence implicating PUB1 in the mechanism of
           DNA replication. PUB1 contains three RNA recognition
           motifs (RRMs), also termed RBDs (RNA binding domains) or
           RNPs (ribonucleoprotein domains), and a GAR motif
           (glycine and arginine rich stretch) that is located
           between RRM2 and RRM3. .
          Length = 74

 Score = 27.1 bits (60), Expect = 0.66
 Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
           L+VG L  +  ED +++IF   G ++   ++  PD  +K
Sbjct: 1   LYVGNLDPRVTEDILKQIFQVGGPVQNVKII--PDKNNK 37


>gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous
          nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP
          DL) and similar proteins.  This subgroup corresponds to
          the RRM1 of hnRNP DL (or hnRNP D-like), also termed
          AU-rich element RNA-binding factor, or JKT41-binding
          protein (protein laAUF1 or JKTBP), which is a dual
          functional protein that possesses DNA- and RNA-binding
          properties. It has been implicated in mRNA biogenesis
          at the transcriptional and post-transcriptional levels.
          hnRNP DL binds single-stranded DNA (ssDNA) or
          double-stranded DNA (dsDNA) in a non-sequencespecific
          manner, and interacts with poly(G) and poly(A)
          tenaciously. It contains two putative two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and a glycine- and tyrosine-rich C-terminus. .
          Length = 76

 Score = 27.3 bits (60), Expect = 0.72
 Identities = 11/35 (31%), Positives = 21/35 (60%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGP 98
          K+F+G LS   ++ D+ +  + FG + +CT+   P
Sbjct: 1  KMFIGGLSWDTSKKDLTEYLSRFGEVLDCTIKTDP 35


>gnl|CDD|241016 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA-binding
          protein Musashi homolog 1 (Musashi-1) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          Musashi-1. The mammalian MSI1 gene encoding Musashi-1
          (also termed Msi1) is a neural RNA-binding protein
          putatively expressed in central nervous system (CNS)
          stem cells and neural progenitor cells, and associated
          with asymmetric divisions in neural progenitor cells.
          Musashi-1 is evolutionarily conserved from
          invertebrates to vertebrates. It is a homolog of
          Drosophila Musashi and Xenopus laevis nervous
          system-specific RNP protein-1 (Nrp-1) and has been
          implicated in the maintenance of the stem-cell state,
          differentiation, and tumorigenesis. It translationally
          regulates the expression of a mammalian numb gene by
          binding to the 3'-untranslated region of mRNA of Numb,
          encoding a membrane-associated inhibitor of Notch
          signaling, and further influences neural development.
          It represses translation by interacting with the
          poly(A)-binding protein and competes for binding of the
          eukaryotic initiation factor-4G (eIF-4G). Musashi-1
          contains two conserved N-terminal tandem RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          along with other domains of unknown function. .
          Length = 74

 Score = 26.9 bits (59), Expect = 0.72
 Identities = 11/32 (34%), Positives = 20/32 (62%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVL 95
          K+FVG LS     +DV++ F  FG +++  ++
Sbjct: 1  KIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLM 32


>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic
          RNA-binding protein 18 and similar proteins.  This
          subfamily corresponds to the RRM of RBM18, a putative
          RNA-binding protein containing a well-conserved RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain). The
          biological role of RBM18 remains unclear. .
          Length = 80

 Score = 27.2 bits (61), Expect = 0.73
 Identities = 8/27 (29%), Positives = 17/27 (62%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIE 90
          +L++G L  +  E  + K+F+ +G I+
Sbjct: 1  RLWIGNLDSRLTEFHLLKLFSKYGKIK 27


>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding
          protein 34 (RBM34) and similar proteins.  This
          subfamily corresponds to the RRM2 of RBM34, a putative
          RNA-binding protein containing two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains). Although the
          function of RBM34 remains unclear currently, its RRM
          domains may participate in mRNA processing. RBM34 may
          act as an mRNA processing-related protein. .
          Length = 73

 Score = 26.7 bits (60), Expect = 0.74
 Identities = 10/25 (40%), Positives = 14/25 (56%)

Query: 66 FVGMLSKQQNEDDVRKIFAPFGTIE 90
          FVG L     E+++RK F   G +E
Sbjct: 3  FVGNLPFDIEEEELRKHFEDCGDVE 27


>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar
           protein 4 (Nop4p) and similar proteins.  This subgroup
           corresponds to the RRM1 of Nop4p (also known as Nop77p),
           encoded by YPL043W from Saccharomyces cerevisiae. It is
           an essential nucleolar protein involved in processing
           and maturation of 27S pre-rRNA and biogenesis of 60S
           ribosomal subunits. Nop4p has four RNA recognition
           motifs (RRMs), also termed RBDs (RNA binding domains) or
           RNPs (ribonucleoprotein domains). .
          Length = 79

 Score = 27.1 bits (60), Expect = 0.84
 Identities = 11/40 (27%), Positives = 20/40 (50%), Gaps = 1/40 (2%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPD-GTSK 103
           LFV  L+    ++D+   F+    I+   V+  P+ G S+
Sbjct: 2   LFVRNLAFSVTQEDLTDFFSDVAPIKHAVVVTDPETGESR 41


>gnl|CDD|240888 cd12442, RRM_RBM48, RNA recognition motif in RNA-binding protein
          48 (RBM48) and similar proteins.  This subfamily
          corresponds to the RRM of RBM48, a putative RNA-binding
          protein of unknown function. It contains one RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain). .
          Length = 100

 Score = 27.3 bits (61), Expect = 0.85
 Identities = 9/21 (42%), Positives = 15/21 (71%)

Query: 76 EDDVRKIFAPFGTIEECTVLK 96
          E ++ ++FA +GTIEE  +L 
Sbjct: 24 EKELLELFALYGTIEEYRLLD 44


>gnl|CDD|184753 PRK14581, hmsF, outer membrane N-deacetylase; Provisional.
          Length = 672

 Score = 28.0 bits (62), Expect = 0.90
 Identities = 17/67 (25%), Positives = 24/67 (35%), Gaps = 16/67 (23%)

Query: 11  TPLPPDKKLFVGMLSKQQNEDDNLSHCFHLLFPHLQCFPWDLI------WTCTPLPPDKK 64
             LP    L           DD  S  +  ++P L+ + W  +      W  T    DKK
Sbjct: 102 PTLPDKAVLLTF--------DDGYSSFYRRVYPLLKAYKWSAVLAPVGTWIDT--ATDKK 151

Query: 65  LFVGMLS 71
           +  G LS
Sbjct: 152 VDFGGLS 158


>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene
           single-strand binding proteins (MSSP) family.  This
           subfamily corresponds to the RRM2 of c-myc gene
           single-strand binding proteins (MSSP) family, including
           single-stranded DNA-binding protein MSSP-1 (also termed
           RBMS1 or SCR2) and MSSP-2 (also termed RBMS2 or SCR3).
           All MSSP family members contain two RNA recognition
           motifs (RRMs), also termed RBDs (RNA binding domains) or
           RNPs (ribonucleoprotein domains), both of which are
           responsible for the specific DNA binding activity. Both,
           MSSP-1 and -2, have been identified as protein factors
           binding to a putative DNA replication
           origin/transcriptional enhancer sequence present
           upstream from the human c-myc gene in both single- and
           double-stranded forms. Thus they have been implied in
           regulating DNA replication, transcription, apoptosis
           induction, and cell-cycle movement, via the interaction
           with C-MYC, the product of protooncogene c-myc.
           Moreover, they family includes a new member termed
           RNA-binding motif, single-stranded-interacting protein 3
           (RBMS3), which is not a transcriptional regulator. RBMS3
           binds with high affinity to A/U-rich stretches of RNA,
           and to A/T-rich DNA sequences, and functions as a
           regulator of cytoplasmic activity. In addition, a
           putative meiosis-specific RNA-binding protein termed
           sporulation-specific protein 5 (SPO5, or meiotic
           RNA-binding protein 1, or meiotically up-regulated gene
           12 protein), encoded by Schizosaccharomyces pombe
           Spo5/Mug12 gene, is also included in this family. SPO5
           is a novel meiosis I regulator that may function in the
           vicinity of the Mei2 dot. .
          Length = 79

 Score = 26.9 bits (60), Expect = 0.90
 Identities = 9/39 (23%), Positives = 19/39 (48%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
           L++  L    +E D+  +  P+G +    +L+   G S+
Sbjct: 3   LYISNLPLHMDEQDLETMLKPYGQVISTRILRDSKGQSR 41


>gnl|CDD|240777 cd12331, RRM_NRD1_SEB1_like, RNA recognition motif in
          Saccharomyces cerevisiae protein Nrd1,
          Schizosaccharomyces pombe Rpb7-binding protein seb1 and
          similar proteins.  This subfamily corresponds to the
          RRM of Nrd1 and Seb1. Nrd1 is a novel heterogeneous
          nuclear ribonucleoprotein (hnRNP)-like RNA-binding
          protein encoded by gene NRD1 (for nuclear pre-mRNA
          down-regulation) from yeast S. cerevisiae. It is
          implicated in 3' end formation of small nucleolar and
          small nuclear RNAs transcribed by polymerase II, and
          plays a critical role in pre-mRNA metabolism. Nrd1
          contains an RNA recognition motif (RRM), also termed
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain), a short arginine-, serine-, and glutamate-rich
          segment similar to the regions rich in RE and RS
          dipeptides (RE/RS domains) in many metazoan splicing
          factors, and a proline- and glutamine-rich C-terminal
          domain (P+Q domain) similar to domains found in several
          yeast hnRNPs. Disruption of NRD1 gene is lethal to
          yeast cells. Its N-terminal domain is sufficient for
          viability, which may facilitate interactions with RNA
          polymerase II where Nrd1 may function as an auxiliary
          factor. By contrast, the RRM, RE/RS domains, and P+Q
          domain are dispensable. Seb1 is an RNA-binding protein
          encoded by gene seb1 (for seven binding) from fission
          yeast S. pombe. It is essential for cell viability and
          bound directly to Rpb7 subunit of RNA polymerase II.
          Seb1 is involved in processing of polymerase II
          transcripts. It also contains one RRM motif and a
          region rich in arginine-serine dipeptides (RS domain).
          Length = 79

 Score = 26.8 bits (59), Expect = 0.91
 Identities = 10/30 (33%), Positives = 16/30 (53%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTV 94
          LF G ++    E D+R  F  FG ++ C +
Sbjct: 6  LFPGGVTFNMIEYDLRSGFGRFGEVQSCIL 35


>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated
          protein SR140 and similar proteins.  This subgroup
          corresponds to the RRM of SR140 (also termed U2
          snRNP-associated SURP motif-containing protein
          orU2SURP, or 140 kDa Ser/Arg-rich domain protein) which
          is a putative splicing factor mainly found in higher
          eukaryotes. Although it is initially identified as one
          of the 17S U2 snRNP-associated proteins, the molecular
          and physiological function of SR140 remains unclear.
          SR140 contains an N-terminal RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), a SWAP/SURP domain that is
          found in a number of pre-mRNA splicing factors in the
          middle region, and a C-terminal arginine/serine-rich
          domain (RS domain).
          Length = 84

 Score = 26.8 bits (60), Expect = 1.0
 Identities = 8/25 (32%), Positives = 15/25 (60%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTI 89
          L+VG L+ +  E+ + + F  FG +
Sbjct: 4  LYVGNLNPKVTEEVLCQEFGRFGPL 28


>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate
          paraspeckle protein 1 (PSP1).  This subgroup
          corresponds to the RRM1 of PSPC1, also termed
          paraspeckle component 1 (PSPC1), a novel nucleolar
          factor that accumulates within a new nucleoplasmic
          compartment, termed paraspeckles, and diffusely
          distributes in the nucleoplasm. It is ubiquitously
          expressed and highly conserved in vertebrates. Its
          cellular function remains unknown currently, however,
          PSPC1 forms a novel heterodimer with the nuclear
          protein p54nrb, also known as non-POU domain-containing
          octamer-binding protein (NonO), which localizes to
          paraspeckles in an RNA-dependent manner. PSPC1 contains
          two conserved RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), at the N-terminus. .
          Length = 71

 Score = 26.4 bits (58), Expect = 1.2
 Identities = 11/28 (39%), Positives = 16/28 (57%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEE 91
          +LFVG L     E+D +K+F  +G   E
Sbjct: 3  RLFVGNLPTDITEEDFKKLFEKYGEPSE 30


>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic
           translation initiation factor 3 subunit G (eIF-3G) and
           similar proteins.  This subfamily corresponds to the RRM
           of eIF-3G and similar proteins. eIF-3G, also termed
           eIF-3 subunit 4, or eIF-3-delta, or eIF3-p42, or
           eIF3-p44, is the RNA-binding subunit of eIF3, a large
           multisubunit complex that plays a central role in the
           initiation of translation by binding to the 40 S
           ribosomal subunit and promoting the binding of
           methionyl-tRNAi and mRNA. eIF-3G binds 18 S rRNA and
           beta-globin mRNA, and therefore appears to be a
           nonspecific RNA-binding protein. eIF-3G is one of the
           cytosolic targets and interacts with mature
           apoptosis-inducing factor (AIF). eIF-3G contains one RNA
           recognition motif (RRM), also termed RBD (RNA binding
           domain) or RNP (ribonucleoprotein domain). This family
           also includes yeast eIF3-p33, a homolog of vertebrate
           eIF-3G, plays an important role in the initiation phase
           of protein synthesis in yeast. It binds both, mRNA and
           rRNA, fragments due to an RRM near its C-terminus. .
          Length = 77

 Score = 26.3 bits (59), Expect = 1.3
 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 70  LSKQQNEDDVRKIFAPFGTIEECTVLKGPD-GTSK 103
           LS+  +EDD+R++F PFG I    + K  + G S+
Sbjct: 7   LSEDADEDDLRELFRPFGPISRVYLAKDKETGQSR 41


>gnl|CDD|240882 cd12436, RRM1_2_MATR3_like, RNA recognition motif 1 and 2 in the
          matrin 3 family of nuclear proteins.  This subfamily
          corresponds to the RRM of the matrin 3 family of
          nuclear proteins consisting of Matrin 3 (MATR3),
          nuclear protein 220 (NP220) and similar proteins. MATR3
          is a highly conserved inner nuclear matrix protein that
          has been implicated in various biological processes.
          NP220 is a large nucleoplasmic DNA-binding protein that
          binds to cytidine-rich sequences, such as CCCCC (G/C),
          in double-stranded DNA (dsDNA). Both, Matrin 3 and
          NP220, contain two RNA recognition motif (RRM), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a Cys2-His2 zinc
          finger-like motif at the C-terminal region. .
          Length = 76

 Score = 26.5 bits (59), Expect = 1.3
 Identities = 8/41 (19%), Positives = 14/41 (34%), Gaps = 10/41 (24%)

Query: 56 CTPLPPDKKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK 96
           + LP               E ++ K+  PFG ++    L 
Sbjct: 5  LSNLPEGG----------YTEAELLKLAEPFGKVDHYIFLP 35


>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2
          and similar proteins.  This subfamily corresponds to
          the RRM1 of yeast protein gar2, a novel nucleolar
          protein required for 18S rRNA and 40S ribosomal subunit
          accumulation. It shares similar domain architecture
          with nucleolin from vertebrates and NSR1 from
          Saccharomyces cerevisiae. The highly phosphorylated
          N-terminal domain of gar2 is made up of highly acidic
          regions separated from each other by basic sequences,
          and contains multiple phosphorylation sites. The
          central domain of gar2 contains two closely adjacent
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains). The C-terminal RGG (or GAR) domain of gar2 is
          rich in glycine, arginine and phenylalanine residues. .
          Length = 76

 Score = 26.2 bits (58), Expect = 1.4
 Identities = 11/32 (34%), Positives = 18/32 (56%)

Query: 64 KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVL 95
           LFVG LS   +++ ++  F  FGT+    V+
Sbjct: 1  TLFVGNLSWSVDDEWLKAEFEKFGTVVGARVI 32


>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding
          protein 19 (RBM19 or RBD-1) and similar proteins.  This
          subfamily corresponds to the RRM5 of RBM19 and RRM4 of
          MRD1. RBM19, also termed RNA-binding domain-1 (RBD-1),
          is a nucleolar protein conserved in eukaryotes involved
          in ribosome biogenesis by processing rRNA and is
          essential for preimplantation development. It has a
          unique domain organization containing 6 conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains). .
          Length = 82

 Score = 26.0 bits (58), Expect = 1.6
 Identities = 11/35 (31%), Positives = 18/35 (51%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPD 99
          LFV  L+ +  E+ ++K F   G +   T+ K  D
Sbjct: 3  LFVKNLNFKTTEETLKKHFEKCGGVRSVTIAKKKD 37


>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I
          polyadenylate-binding proteins.  This subfamily
          corresponds to the RRM1 of type I poly(A)-binding
          proteins (PABPs), highly conserved proteins that bind
          to the poly(A) tail present at the 3' ends of most
          eukaryotic mRNAs. They have been implicated in the
          regulation of poly(A) tail length during the
          polyadenylation reaction, translation initiation, mRNA
          stabilization by influencing the rate of deadenylation
          and inhibition of mRNA decapping. The family represents
          type I polyadenylate-binding proteins (PABPs),
          including polyadenylate-binding protein 1 (PABP-1 or
          PABPC1), polyadenylate-binding protein 3 (PABP-3 or
          PABPC3), polyadenylate-binding protein 4 (PABP-4 or
          APP-1 or iPABP), polyadenylate-binding protein 5
          (PABP-5 or PABPC5), polyadenylate-binding protein
          1-like (PABP-1-like or PABPC1L), polyadenylate-binding
          protein 1-like 2 (PABPC1L2 or RBM32),
          polyadenylate-binding protein 4-like (PABP-4-like or
          PABPC4L), yeast polyadenylate-binding protein,
          cytoplasmic and nuclear (PABP or ACBP-67), and similar
          proteins. PABP-1 is a ubiquitously expressed
          multifunctional protein that may play a role in 3' end
          formation of mRNA, translation initiation, mRNA
          stabilization, protection of poly(A) from nuclease
          activity, mRNA deadenylation, inhibition of mRNA
          decapping, and mRNP maturation. Although PABP-1 is
          thought to be a cytoplasmic protein, it is also found
          in the nucleus. PABP-1 may be involved in
          nucleocytoplasmic trafficking and utilization of mRNP
          particles. PABP-1 contains four copies of RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains), a
          less well conserved linker region, and a proline-rich
          C-terminal conserved domain (CTD). PABP-3 is a
          testis-specific poly(A)-binding protein specifically
          expressed in round spermatids. It is mainly found in
          mammalian and may play an important role in the
          testis-specific regulation of mRNA homeostasis. PABP-3
          shows significant sequence similarity to PABP-1.
          However, it binds to poly(A) with a lower affinity than
          PABP-1. Moreover, PABP-1 possesses an A-rich sequence
          in its 5'-UTR and allows binding of PABP and blockage
          of translation of its own mRNA. In contrast, PABP-3
          lacks the A-rich sequence in its 5'-UTR. PABP-4 is an
          inducible poly(A)-binding protein (iPABP) that is
          primarily localized to the cytoplasm. It shows
          significant sequence similarity to PABP-1 as well. The
          RNA binding properties of PABP-1 and PABP-4 appear to
          be identical. PABP-5 is encoded by PABPC5 gene within
          the X-specific subinterval, and expressed in fetal
          brain and in a range of adult tissues in mammals, such
          as ovary and testis. It may play an important role in
          germ cell development. Moreover, unlike other PABPs,
          PABP-5 contains only four RRMs, but lacks both the
          linker region and the CTD. PABP-1-like and PABP-1-like
          2 are the orthologs of PABP-1. PABP-4-like is the
          ortholog of PABP-5. Their cellular functions remain
          unclear. The family also includes yeast PABP, a
          conserved poly(A) binding protein containing poly(A)
          tails that can be attached to the 3'-ends of mRNAs. The
          yeast PABP and its homologs may play important roles in
          the initiation of translation and in mRNA decay. Like
          vertebrate PABP-1, the yeast PABP contains four RRMs, a
          linker region, and a proline-rich CTD as well. The
          first two RRMs are mainly responsible for specific
          binding to poly(A). The proline-rich region may be
          involved in protein-protein interactions. .
          Length = 80

 Score = 26.3 bits (59), Expect = 1.6
 Identities = 9/25 (36%), Positives = 14/25 (56%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTI 89
          L+VG L     E  + +IF+P G +
Sbjct: 2  LYVGDLHPDVTEAMLYEIFSPAGPV 26


>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B
           subunit 4 (SF3B4) and similar proteins.  This subfamily
           corresponds to the RRM2 of SF3B4, also termed
           pre-mRNA-splicing factor SF3b 49 kDa (SF3b50), or
           spliceosome-associated protein 49 (SAP 49). SF3B4 is a
           component of the multiprotein complex splicing factor 3b
           (SF3B), an integral part of the U2 small nuclear
           ribonucleoprotein (snRNP) and the U11/U12 di-snRNP. SF3B
           is essential for the accurate excision of introns from
           pre-messenger RNA, and is involved in the recognition of
           the pre-mRNA's branch site within the major and minor
           spliceosomes. SF3B4 functions to tether U2 snRNP with
           pre-mRNA at the branch site during spliceosome assembly.
           It is an evolutionarily highly conserved protein with
           orthologs across diverse species. SF3B4 contains two
           closely adjacent N-terminal RNA recognition motifs
           (RRMs), also termed RBDs (RNA binding domains) or RNPs
           (ribonucleoprotein domains). It binds directly to
           pre-mRNA and also interacts directly and highly
           specifically with another SF3B subunit called SAP 145. .
          Length = 83

 Score = 26.1 bits (58), Expect = 1.7
 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTI-EECTVLKGPD-GTSK 103
           LF+G L  + +E  +   F+ FG I +   +++ PD G SK
Sbjct: 4   LFIGNLDPEVDEKLLYDTFSAFGVILQTPKIMRDPDTGNSK 44


>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate
          heterogeneous nuclear ribonucleoprotein Q (hnRNP Q).
          This subgroup corresponds to the RRM3 of hnRNP Q, also
          termed glycine- and tyrosine-rich RNA-binding protein
          (GRY-RBP), or NS1-associated protein 1 (NASP1), or
          synaptotagmin-binding, cytoplasmic RNA-interacting
          protein (SYNCRIP). It is a ubiquitously expressed
          nuclear RNA-binding protein identified as a component
          of the spliceosome complex, as well as a component of
          the apobec-1 editosome. As an alternatively spliced
          version of NSAP, it acts as an interaction partner of a
          multifunctional protein required for viral replication,
          and is implicated in the regulation of specific mRNA
          transport. hnRNP Q has also been identified as SYNCRIP
          that is a dual functional protein participating in both
          viral RNA replication and translation. As a
          synaptotagmin-binding protein, hnRNP Q plays a putative
          role in organelle-based mRNA transport along the
          cytoskeleton. Moreover, hnRNP Q has been found in
          protein complexes involved in translationally coupled
          mRNA turnover and mRNA splicing. It functions as a
          wild-type survival motor neuron (SMN)-binding protein
          that may participate in pre-mRNA splicing and modulate
          mRNA transport along microtubuli. hnRNP Q contains an
          acidic auxiliary N-terminal region, followed by two
          well defined and one degenerated RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a C-terminal RGG
          motif; hnRNP Q binds RNA through its RRM domains. .
          Length = 72

 Score = 26.1 bits (57), Expect = 1.7
 Identities = 13/34 (38%), Positives = 17/34 (50%)

Query: 63 KKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK 96
          K LFV  L+    E+ + K F  FG +E    LK
Sbjct: 2  KVLFVRNLANTVTEEILEKAFGQFGKLERVKKLK 35


>gnl|CDD|240908 cd12462, RRM_SCAF8, RNA recognition motif in SR-related and
          CTD-associated factor 8 (SCAF8) and similar proteins.
          This subgroup corresponds to the RRM of SCAF8 (also
          termed CDC5L complex-associated protein 7, or
          RNA-binding motif protein 16, or CTD-binding SR-like
          protein RA8), a nuclear matrix protein that interacts
          specifically with a highly serine-phosphorylated form
          of the carboxy-terminal domain (CTD) of the largest
          subunit of RNA polymerase II (pol II). The pol II CTD
          plays a role in coupling transcription and pre-mRNA
          processing. SCAF8 co-localizes primarily with
          transcription sites that are enriched in nuclear matrix
          fraction, which is known to contain proteins involved
          in pre-mRNA processing. Thus, SCAF8 may play a direct
          role in coupling with both, transcription and pre-mRNA
          processing, processes. SCAF8, together with SCAF4,
          represents a new class of SCAFs (SR-like CTD-associated
          factors). They contain a conserved N-terminal
          CTD-interacting domain (CID), an atypical RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), and
          serine/arginine-rich motifs.
          Length = 79

 Score = 26.2 bits (57), Expect = 1.8
 Identities = 10/31 (32%), Positives = 18/31 (58%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTVL 95
          L+VG + K+  + D+  +F  FG IE   ++
Sbjct: 5  LWVGQVDKKATQQDLTNLFEEFGQIESINMI 35


>gnl|CDD|220555 pfam10079, DUF2317, Uncharacterized protein conserved in bacteria
          (DUF2317).  Members of this family of hypothetical
          bacterial proteins have no known function.
          Length = 541

 Score = 26.8 bits (60), Expect = 2.1
 Identities = 13/40 (32%), Positives = 17/40 (42%), Gaps = 4/40 (10%)

Query: 9  TCTPLPPDKKLFVGMLSKQQNEDDNLSHCFHLLFPHLQCF 48
           C  LP   KLF   L    ++ + L   FH  FP  + F
Sbjct: 4  ECISLPETSKLFADYL----SQKEELKSFFHYDFPDEEAF 39


>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins
          family, Drosophila sex-lethal (SXL), and similar
          proteins.  This subfamily corresponds to the RRM1 of Hu
          proteins and SXL. The Hu proteins family represents a
          group of RNA-binding proteins involved in diverse
          biological processes. Since the Hu proteins share high
          homology with the Drosophila embryonic lethal abnormal
          vision (ELAV) protein, the Hu family is sometimes
          referred to as the ELAV family. Drosophila ELAV is
          exclusively expressed in neurons and is required for
          the correct differentiation and survival of neurons in
          flies. The neuronal members of the Hu family include
          Hu-antigen B (HuB or ELAV-2 or Hel-N1), Hu-antigen C
          (HuC or ELAV-3 or PLE21), and Hu-antigen D (HuD or
          ELAV-4), which play important roles in neuronal
          differentiation, plasticity and memory. HuB is also
          expressed in gonads. Hu-antigen R (HuR or ELAV-1 or
          HuA) is ubiquitously expressed Hu family member. It has
          a variety of biological functions mostly related to the
          regulation of cellular response to DNA damage and other
          types of stress. Hu proteins perform their cytoplasmic
          and nuclear molecular functions by coordinately
          regulating functionally related mRNAs. In the
          cytoplasm, Hu proteins recognize and bind to AU-rich
          RNA elements (AREs) in the 3' untranslated regions
          (UTRs) of certain target mRNAs, such as GAP-43,
          vascular epithelial growth factor (VEGF), the glucose
          transporter GLUT1, eotaxin and c-fos, and stabilize
          those ARE-containing mRNAs. They also bind and regulate
          the translation of some target mRNAs, such as
          neurofilament M, GLUT1, and p27. In the nucleus, Hu
          proteins function as regulators of polyadenylation and
          alternative splicing. Each Hu protein contains three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an ARE. RRM3
          may help to maintain the stability of the RNA-protein
          complex, and might also bind to poly(A) tails or be
          involved in protein-protein interactions. This family
          also includes the sex-lethal protein (SXL) from
          Drosophila melanogaster. SXL governs sexual
          differentiation and X chromosome dosage compensation in
          flies. It induces female-specific alternative splicing
          of the transformer (tra) pre-mRNA by binding to the tra
          uridine-rich polypyrimidine tract at the
          non-sex-specific 3' splice site during the
          sex-determination process. SXL binds to its own
          pre-mRNA and promotes female-specific alternative
          splicing. It contains an N-terminal Gly/Asn-rich domain
          that may be responsible for the protein-protein
          interaction, and tandem RRMs that show high preference
          to bind single-stranded, uridine-rich target RNA
          transcripts. .
          Length = 77

 Score = 25.8 bits (57), Expect = 2.1
 Identities = 9/28 (32%), Positives = 15/28 (53%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEEC 92
          L V  L +   ++++R +F   G IE C
Sbjct: 3  LIVNYLPQDMTQEELRSLFEAIGPIESC 30


>gnl|CDD|222673 pfam14315, DUF4380, Domain of unknown function (DUF4380).  This
           family of proteins is found in bacteria, archaea and
           eukaryotes. Proteins in this family are typically
           between 288 and 372 amino acids in length. There are two
           completely conserved residues (G and E) that may be
           functionally important.
          Length = 274

 Score = 26.9 bits (60), Expect = 2.1
 Identities = 10/42 (23%), Positives = 17/42 (40%), Gaps = 1/42 (2%)

Query: 45  LQCFPWDLIWTCTPLPPDKKLFVGMLSKQQNEDDVRKIFAPF 86
           L    W  +W  T L P  ++FV +     +    R +  P+
Sbjct: 133 LTPVEWA-LWFLTRLAPGGRVFVPLAPAGDHPLSRRLVPWPY 173


>gnl|CDD|240910 cd12464, RRM_G3BP2, RNA recognition motif in ras
          GTPase-activating protein-binding protein 2 (G3BP2) and
          similar proteins.  This subgroup corresponds to the RRM
          of G3BP2, also termed GAP SH3 domain-binding protein 2,
          a cytoplasmic protein that interacts with both
          IkappaBalpha and IkappaBalpha/NF-kappaB complexes,
          indicating that G3BP2 may play a role in the control of
          nucleocytoplasmic distribution of IkappaBalpha and
          cytoplasmic anchoring of the IkappaBalpha/NF-kappaB
          complex. G3BP2 contains an N-terminal nuclear transfer
          factor 2 (NTF2)-like domain, an acidic domain, a domain
          containing five PXXP motifs, an RNA recognition motif
          (RRM domain), and an Arg-Gly-rich region (RGG-rich
          region, or arginine methylation motif). It binds to the
          SH3 domain of RasGAP, a multi-functional protein
          controlling Ras activity, through its N-terminal
          NTF2-like domain. The acidic domain is sufficient for
          the interaction of G3BP2 with the IkappaBalpha
          cytoplasmic retention sequence. Furthermore, G3BP2
          might influence stability or translational efficiency
          of particular mRNAs by binding to RNA-containing
          structures within the cytoplasm through its RNA-binding
          domain.
          Length = 83

 Score = 26.1 bits (57), Expect = 2.1
 Identities = 11/32 (34%), Positives = 18/32 (56%)

Query: 60 PPDKKLFVGMLSKQQNEDDVRKIFAPFGTIEE 91
          P   +LFVG L    +E ++++ F  FG + E
Sbjct: 3  PDSHQLFVGNLPHDIDESELKEFFMSFGNVVE 34


>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell
           carcinoma antigen recognized by T-cells 3 (SART3) and
           similar proteins.  This subfamily corresponds to the
           RRM2 of SART3, also termed Tat-interacting protein of
           110 kDa (Tip110), is an RNA-binding protein expressed in
           the nucleus of the majority of proliferating cells,
           including normal cells and malignant cells, but not in
           normal tissues except for the testes and fetal liver. It
           is involved in the regulation of mRNA splicing probably
           via its complex formation with RNA-binding protein with
           a serine-rich domain (RNPS1), a pre-mRNA-splicing
           factor. SART3 has also been identified as a nuclear
           Tat-interacting protein that regulates Tat
           transactivation activity through direct interaction and
           functions as an important cellular factor for HIV-1 gene
           expression and viral replication. In addition, SART3 is
           required for U6 snRNP targeting to Cajal bodies. It
           binds specifically and directly to the U6 snRNA,
           interacts transiently with the U6 and U4/U6 snRNPs, and
           promotes the reassembly of U4/U6 snRNPs after splicing
           in vitro. SART3 contains an N-terminal
           half-a-tetratricopeptide repeat (HAT)-rich domain, a
           nuclearlocalization signal (NLS) domain, and two
           C-terminal RNA recognition motifs (RRMs), also termed
           RBDs (RNA binding domains) or RNPs (ribonucleoprotein
           domains). .
          Length = 81

 Score = 25.8 bits (57), Expect = 2.1
 Identities = 10/41 (24%), Positives = 19/41 (46%)

Query: 63  KKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
            KLFV  L     ++++ K+F   G ++   ++    G  K
Sbjct: 3   HKLFVSGLPFSVTKEELEKLFKKHGVVKSVRLVTNRSGKPK 43


>gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family
          proteins.  Thid subfamily corresponds to the RRM1 of
          IGF2BPs (or IMPs) found in the VICKZ family that have
          been implicated in the post-transcriptional regulation
          of several different RNAs and in subcytoplasmic
          localization of mRNAs during embryogenesis. IGF2BPs are
          composed of two RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and four hnRNP K homology
          (KH) domains.
          Length = 73

 Score = 25.8 bits (57), Expect = 2.2
 Identities = 9/20 (45%), Positives = 14/20 (70%)

Query: 65 LFVGMLSKQQNEDDVRKIFA 84
          L++G LS   NE D+R++F 
Sbjct: 1  LYIGNLSSDVNESDLRQLFE 20


>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit,
           splicing factor.  These splicing factors consist of an
           N-terminal arginine-rich low complexity domain followed
           by three tandem RNA recognition motifs (pfam00076). The
           well-characterized members of this family are auxilliary
           components of the U2 small nuclear ribonuclearprotein
           splicing factor (U2AF). These proteins are closely
           related to the CC1-like subfamily of splicing factors
           (TIGR01622). Members of this subfamily are found in
           plants, metazoa and fungi.
          Length = 509

 Score = 26.8 bits (59), Expect = 2.2
 Identities = 10/41 (24%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 64  KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKG-PDGTSK 103
           ++++G L     ED ++++   FG ++   ++K    G SK
Sbjct: 297 RIYIGNLPLYLGEDQIKELLESFGDLKAFNLIKDIATGLSK 337


>gnl|CDD|233331 TIGR01255, pyr_form_ly_1, formate acetyltransferase 1.  Alternate
           names: pyruvate formate-lyase; formate
           C-acetyltransferase This enzyme converts formate +
           acetyl-CoA into pyruvate + CoA. This model describes
           formate acetyltransferase 1. More distantly related
           putative formate acetyltransferases have also been
           identified, including formate acetyltransferase 2 from
           E. coli, which is excluded from this model [Energy
           metabolism, Fermentation].
          Length = 744

 Score = 26.8 bits (59), Expect = 2.2
 Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 13/65 (20%)

Query: 30  EDDNLSHCFHLLFPHLQCFPWDLIWTCTPLPP---DKKL--FVGMLSKQQNEDDVRKIFA 84
           ED  L H   + F     F  D + +   +P    DK+L   VGM    Q    +++ F 
Sbjct: 49  EDVTLEHYEEVGFD----FDTDRVSSIDSIPAGYIDKELELIVGM----QTSAPLKRNFM 100

Query: 85  PFGTI 89
           PFG I
Sbjct: 101 PFGGI 105


>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family.  This
           subfamily corresponds to the RRM of the ist3 family that
           includes fungal U2 small nuclear ribonucleoprotein
           (snRNP) component increased sodium tolerance protein 3
           (ist3), X-linked 2 RNA-binding motif proteins (RBMX2)
           found in Metazoa and plants, and similar proteins. Gene
           IST3 encoding ist3, also termed U2 snRNP protein SNU17
           (Snu17p), is a novel yeast Saccharomyces cerevisiae
           protein required for the first catalytic step of
           splicing and for progression of spliceosome assembly. It
           binds specifically to the U2 snRNP and is an intrinsic
           component of prespliceosomes and spliceosomes. Yeast
           ist3 contains an atypical RNA recognition motif (RRM),
           also termed RBD (RNA binding domain) or RNP
           (ribonucleoprotein domain). In the yeast pre-mRNA
           retention and splicing complex, the atypical RRM of ist3
           functions as a scaffold that organizes the other two
           constituents, Bud13p (bud site selection 13) and Pml1p
           (pre-mRNA leakage 1). Fission yeast Schizosaccharomyces
           pombe gene cwf29 encoding ist3, also termed cell cycle
           control protein cwf29, is an RNA-binding protein
           complexed with cdc5 protein 29. It also contains one
           RRM. The biological function of RBMX2 remains unclear.
           It shows high sequence similarity to yeast ist3 protein
           and harbors one RRM as well. .
          Length = 89

 Score = 25.7 bits (57), Expect = 2.4
 Identities = 10/40 (25%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPD-GTSK 103
           +++G L  +  E D+  +F+ +G I +  +++    G SK
Sbjct: 12  IYIGGLPYELTEGDILCVFSQYGEIVDINLVRDKKTGKSK 51


>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in
          heterogeneous nuclear ribonucleoprotein R (hnRNP R) and
          similar proteins.  This subfamily corresponds to the
          RRM3 in hnRNP R, hnRNP Q, and APOBEC-1 complementation
          factor (ACF). hnRNP R is a ubiquitously expressed
          nuclear RNA-binding protein that specifically bind
          mRNAs with a preference for poly(U) stretches and has
          been implicated in mRNA processing and mRNA transport,
          and also acts as a regulator to modify binding to
          ribosomes and RNA translation. hnRNP Q is also a
          ubiquitously expressed nuclear RNA-binding protein. It
          has been identified as a component of the spliceosome
          complex, as well as a component of the apobec-1
          editosome, and has been implicated in the regulation of
          specific mRNA transport. ACF is an RNA-binding subunit
          of a core complex that interacts with apoB mRNA to
          facilitate C to U RNA editing. It may also act as an
          apoB mRNA recognition factor and chaperone and play a
          key role in cell growth and differentiation. This
          family also includes two functionally unknown
          RNA-binding proteins, RBM46 and RBM47. All members
          contain three conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains).
          Length = 72

 Score = 25.7 bits (57), Expect = 2.5
 Identities = 9/28 (32%), Positives = 17/28 (60%)

Query: 63 KKLFVGMLSKQQNEDDVRKIFAPFGTIE 90
          K L+V  L     E+ +R++F+ +G +E
Sbjct: 2  KVLYVRNLPLSTTEEQLRELFSEYGEVE 29


>gnl|CDD|240705 cd12259, RRM_SRSF11_SREK1, RNA recognition motif in
          serine/arginine-rich splicing factor 11 (SRSF11),
          splicing regulatory glutamine/lysine-rich protein 1
          (SREK1) and similar proteins.  This subfamily
          corresponds to the RRM domain of SRSF11 (SRp54 or p54),
          SREK1 ( SFRS12 or SRrp86) and similar proteins, a group
          of proteins containing regions rich in serine-arginine
          dipeptides (SR protein family). These are involved in
          bridge-complex formation and splicing by mediating
          protein-protein interactions across either introns or
          exons. SR proteins have been identified as crucial
          regulators of alternative splicing. Different SR
          proteins display different substrate specificity, have
          distinct functions in alternative splicing of different
          pre-mRNAs, and can even negatively regulate splicing.
          All SR family members are characterized by the presence
          of one or two N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and the C-terminal regions
          rich in serine and arginine dipeptides (SR domains).
          The RRM domain is responsible for RNA binding and
          specificity in both alternative and constitutive
          splicing. In contrast, SR domains are thought to be
          protein-protein interaction domains that are often
          interchangeable. .
          Length = 76

 Score = 25.7 bits (57), Expect = 2.5
 Identities = 9/25 (36%), Positives = 14/25 (56%)

Query: 70 LSKQQNEDDVRKIFAPFGTIEECTV 94
          +S Q  E+ +R +F   G IEE  +
Sbjct: 7  VSPQATEEQMRTLFGFLGKIEELRL 31


>gnl|CDD|241012 cd12568, RRM3_MRD1, RNA recognition motif 3 in yeast multiple
           RNA-binding domain-containing protein 1 (MRD1) and
           similar proteins.  This subgroup corresponds to the RRM3
           of MRD1 which is encoded by a novel yeast gene MRD1
           (multiple RNA-binding domain). It is well-conserved in
           yeast and its homologs exist in all eukaryotes. MRD1 is
           present in the nucleolus and the nucleoplasm. It
           interacts with the 35 S precursor rRNA (pre-rRNA) and U3
           small nucleolar RNAs (snoRNAs). MRD1 is essential for
           the initial processing at the A0-A2 cleavage sites in
           the 35 S pre-rRNA. It contains 5 conserved RNA
           recognition motifs (RRMs), also termed RBDs (RNA binding
           domains) or RNPs (ribonucleoprotein domains), which may
           play an important structural role in organizing specific
           rRNA processing events. .
          Length = 72

 Score = 25.4 bits (56), Expect = 2.6
 Identities = 9/26 (34%), Positives = 14/26 (53%), Gaps = 2/26 (7%)

Query: 76  EDDVRKIFAPFGTIEECTVLKGPDGT 101
            +++R +F P G +    VL  P GT
Sbjct: 14  AEELRDLFEPHGKLTR--VLMPPAGT 37


>gnl|CDD|239453 cd03337, TCP1_gamma, TCP-1 (CTT or eukaryotic type II) chaperonin
           family, gamma subunit. Chaperonins are involved in
           productive folding of proteins. They share a common
           general morphology, a double toroid of 2 stacked rings.
           In contrast to bacterial group I chaperonins (GroEL),
           each ring of the eukaryotic cytosolic chaperonin (CTT)
           consists of eight different, but homologous subunits.
           Their common function is to sequester nonnative proteins
           inside their central cavity and promote folding by using
           energy derived from ATP hydrolysis. The best studied in
           vivo substrates of CTT are actin and tubulin.
          Length = 480

 Score = 26.5 bits (59), Expect = 2.6
 Identities = 10/19 (52%), Positives = 11/19 (57%), Gaps = 2/19 (10%)

Query: 79  VRKIFAPFGTIEECTVLKG 97
           V KI  P G IE+  VL G
Sbjct: 197 VEKI--PGGEIEDSRVLDG 213


>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein
           interacting with the FHA domain of pKI-67 (NIFK) and
           similar proteins.  This subgroup corresponds to the RRM
           of NIFK and Nop15p. NIFK, also termed MKI67 FHA
           domain-interacting nucleolar phosphoprotein, or
           nucleolar phosphoprotein Nopp34, is a putative
           RNA-binding protein interacting with the forkhead
           associated (FHA) domain of pKi-67 antigen in a
           mitosis-specific and phosphorylation-dependent manner.
           It is nucleolar in interphase but associates with
           condensed mitotic chromosomes. This family also includes
           Saccharomyces cerevisiae YNL110C gene encoding ribosome
           biogenesis protein 15 (Nop15p), also termed nucleolar
           protein 15. Both, NIFK and Nop15p, contain an RNA
           recognition motif (RRM), also termed RBD (RNA binding
           domain) or RNP (ribonucleoprotein domain). .
          Length = 74

 Score = 25.6 bits (57), Expect = 2.7
 Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 1/40 (2%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPD-GTSK 103
           +++G L     E ++RK F+ FGT+    + +    G SK
Sbjct: 2   VYIGHLPHGFYEPELRKYFSQFGTVTRLRLSRSKKTGKSK 41


>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate
          Hu-antigen C (HuC).  This subgroup corresponds to the
          RRM3 of HuC, also termed ELAV-like protein 3 (ELAV-3),
          or paraneoplastic cerebellar degeneration-associated
          antigen, or paraneoplastic limbic encephalitis antigen
          21 (PLE21), one of the neuronal members of the Hu
          family. The neuronal Hu proteins play important roles
          in neuronal differentiation, plasticity and memory.
          Like other Hu proteins, HuC contains three RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an AU-rich
          RNA element (ARE). The AU-rich element binding of HuC
          can be inhibited by flavonoids. RRM3 may help to
          maintain the stability of the RNA-protein complex, and
          might also bind to poly(A) tails or be involved in
          protein-protein interactions. .
          Length = 85

 Score = 25.8 bits (56), Expect = 2.8
 Identities = 10/32 (31%), Positives = 19/32 (59%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK 96
          +FV  LS + +E  + ++F PFG +    V++
Sbjct: 4  IFVYNLSPEADESVLWQLFGPFGAVTNVKVIR 35


>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger
          CCHC-type and RNA-binding motif-containing protein 1
          (ZCRB1) and similar proteins.  This subfamily
          corresponds to the RRM of ZCRB1, also termed MADP-1, or
          U11/U12 small nuclear ribonucleoprotein 31 kDa protein
          (U11/U12 snRNP 31 or U11/U12-31K), a novel
          multi-functional nuclear factor, which may be involved
          in morphine dependence, cold/heat stress, and
          hepatocarcinoma. It is located in the nucleoplasm, but
          outside the nucleolus. ZCRB1 is one of the components
          of U11/U12 snRNPs that bind to U12-type pre-mRNAs and
          form a di-snRNP complex, simultaneously recognizing the
          5' splice site and branchpoint sequence. ZCRB1 is
          characterized by an RNA recognition motif (RRM), also
          termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and a CCHC-type Zinc finger
          motif. In addition, it contains core nucleocapsid
          motifs, and Lys- and Glu-rich domains.  .
          Length = 78

 Score = 25.4 bits (56), Expect = 3.0
 Identities = 7/21 (33%), Positives = 15/21 (71%)

Query: 76 EDDVRKIFAPFGTIEECTVLK 96
           +D+ KIF+ +G + + T++K
Sbjct: 15 NNDLHKIFSKYGKVVKVTIVK 35


>gnl|CDD|240917 cd12473, RRM2_MSSP1, RNA recognition motif 2 found in vertebrate
           single-stranded DNA-binding protein MSSP-1.  This
           subgroup corresponds to the RRM2 of MSSP-1, also termed
           RNA-binding motif, single-stranded-interacting protein 1
           (RBMS1), or suppressor of CDC2 with RNA-binding motif 2
           (SCR2). MSSP-1 is a double- and single-stranded DNA
           binding protein that belongs to the c-myc single-strand
           binding proteins (MSSP) family. It specifically
           recognizes the sequence CT(A/T)(A/T)T, and stimulates
           DNA replication in the system using SV40 DNA. MSSP-1 is
           identical with Scr2, a human protein which complements
           the defect of cdc2 kinase in Schizosaccharomyces pombe.
           MSSP-1 has been implied in regulating DNA replication,
           transcription, apoptosis induction, and cell-cycle
           movement, via the interaction with c-MYC, the product of
           protooncogene c-myc. MSSP-1 contains two RNA recognition
           motifs (RRMs), also termed RBDs (RNA binding domains) or
           RNPs (ribonucleoprotein domains), both of which are
           responsible for the specific DNA binding activity as
           well as induction of apoptosis. .
          Length = 85

 Score = 25.4 bits (55), Expect = 3.2
 Identities = 10/39 (25%), Positives = 20/39 (51%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
           L++  L    +E ++  +  PFG +    +L+   GTS+
Sbjct: 3   LYISNLPLSMDEQELENMLKPFGQVISTRILRDSSGTSR 41


>gnl|CDD|241109 cd12665, RRM2_RAVER1, RNA recognition motif 2 found in vertebrate
          ribonucleoprotein PTB-binding 1 (raver-1).  This
          subgroup corresponds to the RRM2 of raver-1, a
          ubiquitously expressed heterogeneous nuclear
          ribonucleoprotein (hnRNP) that serves as a co-repressor
          of the nucleoplasmic splicing repressor polypyrimidine
          tract-binding protein (PTB)-directed splicing of select
          mRNAs. It shuttles between the cytoplasm and the
          nucleus and can accumulate in the perinucleolar
          compartment, a dynamic nuclear substructure that
          harbors PTB. Raver-1 also modulates focal adhesion
          assembly by binding to the cytoskeletal proteins,
          including alpha-actinin, vinculin, and metavinculin (an
          alternatively spliced isoform of vinculin) at adhesion
          complexes, particularly in differentiated muscle
          tissue. Raver-1 contains three N-terminal RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          two putative nuclear localization signals (NLS) at the
          N- and C-termini, a central leucine-rich region, and a
          C-terminal region harboring two PTB-binding
          [SG][IL]LGxxP motifs. Raver1 binds to PTB through the
          PTB-binding motifs at its C-terminal half, and binds to
          other partners, such as RNA having the sequence
          UCAUGCAGUCUG, through its N-terminal RRMs.
          Interestingly, the 12-nucleotide RNA having the
          sequence UCAUGCAGUCUG with micromolar affinity is found
          in vinculin mRNA. Additional research indicates that
          the RRM1 of raver-1 directs its interaction with the
          tail domain of activated vinculin. Then the
          raver1/vinculin tail (Vt) complex binds to vinculin
          mRNA, which is permissive for vinculin binding to
          F-actin. .
          Length = 77

 Score = 25.3 bits (55), Expect = 3.6
 Identities = 10/23 (43%), Positives = 14/23 (60%), Gaps = 4/23 (17%)

Query: 70 LSKQQNEDDVRKIFAPFGTIEEC 92
           ++QQ E+ VR    PFG +E C
Sbjct: 11 YTQQQFEELVR----PFGNLERC 29


>gnl|CDD|240907 cd12461, RRM_SCAF4, RNA recognition motif found in SR-related and
          CTD-associated factor 4 (SCAF4) and similar proteins.
          The CD corresponds to the RRM of SCAF4 (also termed
          splicing factor, arginine/serine-rich 15 or SFR15, or
          CTD-binding SR-like protein RA4) that belongs to a new
          class of SCAFs (SR-like CTD-associated factors).
          Although its biological function remains unclear, SCAF4
          shows high sequence similarity to SCAF8 that interacts
          specifically with a highly serine-phosphorylated form
          of the carboxy-terminal domain (CTD) of the largest
          subunit of RNA polymerase II (pol II) and may play a
          direct role in coupling with both, transcription and
          pre-mRNA processing, processes. SCAF4 and SCAF8 both
          contain a conserved N-terminal CTD-interacting domain
          (CID), an atypical RNA recognition motif (RRM), also
          termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and serine/arginine-rich
          motifs.
          Length = 81

 Score = 25.4 bits (55), Expect = 4.0
 Identities = 11/31 (35%), Positives = 17/31 (54%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTVL 95
          L+VG L K+  + DV  +   FG IE   ++
Sbjct: 7  LWVGQLDKRTTQQDVTSLLEEFGPIESINMI 37


>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large
           nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa
           subunit (U2AF65) and similar proteins.  This subfamily
           corresponds to the RRM2 of U2AF65 and dU2AF50. U2AF65,
           also termed U2AF2, is the large subunit of U2 small
           nuclear ribonucleoprotein (snRNP) auxiliary factor
           (U2AF), which has been implicated in the recruitment of
           U2 snRNP to pre-mRNAs and is a highly conserved
           heterodimer composed of large and small subunits. U2AF65
           specifically recognizes the intron polypyrimidine tract
           upstream of the 3' splice site and promotes binding of
           U2 snRNP to the pre-mRNA branchpoint. U2AF65 also plays
           an important role in the nuclear export of mRNA. It
           facilitates the formation of a messenger
           ribonucleoprotein export complex, containing both the
           NXF1 receptor and the RNA substrate. Moreover, U2AF65
           interacts directly and specifically with expanded CAG
           RNA, and serves as an adaptor to link expanded CAG RNA
           to NXF1 for RNA export. U2AF65 contains an N-terminal RS
           domain rich in arginine and serine, followed by a
           proline-rich segment and three C-terminal RNA
           recognition motifs (RRMs), also termed RBDs (RNA binding
           domains) or RNPs (ribonucleoprotein domains). The
           N-terminal RS domain stabilizes the interaction of U2
           snRNP with the branch point (BP) by contacting the
           branch region, and further promotes base pair
           interactions between U2 snRNA and the BP. The
           proline-rich segment mediates protein-protein
           interactions with the RRM domain of the small U2AF
           subunit (U2AF35 or U2AF1). The RRM1 and RRM2 are
           sufficient for specific RNA binding, while RRM3 is
           responsible for protein-protein interactions. The family
           also includes Splicing factor U2AF 50 kDa subunit
           (dU2AF50), the Drosophila ortholog of U2AF65. dU2AF50
           functions as an essential pre-mRNA splicing factor in
           flies. It associates with intronless mRNAs and plays a
           significant and unexpected role in the nuclear export of
           a large number of intronless mRNAs.
          Length = 77

 Score = 24.9 bits (55), Expect = 4.1
 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 64  KLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK-GPDGTSK 103
           K+F+G L    +ED V+++   FG ++   ++K    G SK
Sbjct: 2   KIFIGGLPNYLSEDQVKELLESFGKLKAFNLVKDSATGLSK 42


>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate
          Hu-antigen D (HuD).  This subgroup corresponds to the
          RRM3 of HuD, also termed ELAV-like protein 4 (ELAV-4),
          or paraneoplastic encephalomyelitis antigen HuD, one of
          the neuronal members of the Hu family. The neuronal Hu
          proteins play important roles in neuronal
          differentiation, plasticity and memory. HuD has been
          implicated in various aspects of neuronal function,
          such as the commitment and differentiation of neuronal
          precursors as well as synaptic remodeling in mature
          neurons. HuD also functions as an important regulator
          of mRNA expression in neurons by interacting with
          AU-rich RNA element (ARE) and stabilizing multiple
          transcripts. Moreover, HuD regulates the nuclear
          processing/stability of N-myc pre-mRNA in neuroblastoma
          cells. And it also regulates the neurite elongation and
          morphological differentiation. HuD specifically bound
          poly(A) RNA. Like other Hu proteins, HuD contains three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an ARE. RRM3
          may help to maintain the stability of the RNA-protein
          complex, and might also bind to poly(A) tails or be
          involved in protein-protein interactions. .
          Length = 86

 Score = 25.4 bits (55), Expect = 4.1
 Identities = 10/32 (31%), Positives = 18/32 (56%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLK 96
          +FV  LS   +E  + ++F PFG +    V++
Sbjct: 6  IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIR 37


>gnl|CDD|184118 PRK13531, PRK13531, regulatory ATPase RavA; Provisional.
          Length = 498

 Score = 25.7 bits (57), Expect = 4.6
 Identities = 10/18 (55%), Positives = 13/18 (72%)

Query: 16  DKKLFVGMLSKQQNEDDN 33
           DK  F  ML+ QQ+E+DN
Sbjct: 182 DKANFRSMLTSQQDENDN 199


>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding
           protein 7 (RBM7).  This subfamily corresponds to the RRM
           of RBM7, a ubiquitously expressed pre-mRNA splicing
           factor that enhances messenger RNA (mRNA) splicing in a
           cell-specific manner or in a certain developmental
           process, such as spermatogenesis. RBM7 interacts with
           splicing factors SAP145 (the spliceosomal splicing
           factor 3b subunit 2) and SRp20. It may play a more
           specific role in meiosis entry and progression. Together
           with additional testis-specific RNA-binding proteins,
           RBM7 may regulate the splicing of specific pre-mRNA
           species that are important in the meiotic cell cycle.
           RBM7 contains an N-terminal RNA recognition motif (RRM),
           also termed RBD (RNA binding domain) or RNP
           (ribonucleoprotein domain), and a region lacking known
           homology at the C-terminus. .
          Length = 75

 Score = 24.9 bits (54), Expect = 4.7
 Identities = 13/42 (30%), Positives = 22/42 (52%)

Query: 62  DKKLFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
           D+ LFVG L  +  E+ + ++F   G + +  + K  DG  K
Sbjct: 1   DRTLFVGNLDPKVTEELIFELFLQAGPVIKVKIPKDKDGKPK 42


>gnl|CDD|240685 cd12239, RRM2_RBM40_like, RNA recognition motif 2 in RNA-binding
          protein 40 (RBM40) and similar proteins.  This
          subfamily corresponds to the RRM2 of RBM40 and the RRM
          of RBM41. RBM40, also known as RNA-binding
          region-containing protein 3 (RNPC3) or U11/U12 small
          nuclear ribonucleoprotein 65 kDa protein (U11/U12-65K
          protein). It serves as a bridging factor between the
          U11 and U12 snRNPs. It contains two RNA recognition
          motifs (RRMs), also known as RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), connected by a
          linker that includes a proline-rich region. It binds to
          the U11-associated 59K protein via its RRM1 and employs
          the RRM2 to bind hairpin III of the U12 small nuclear
          RNA (snRNA). The proline-rich region might be involved
          in protein-protein interactions. RBM41 contains only
          one RRM. Its biological function remains unclear. .
          Length = 82

 Score = 24.4 bits (54), Expect = 6.6
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 63 KKLFVGMLSKQQNEDDVRKIFAPF 86
          K+L+V  LSK+  E+D+  IF  F
Sbjct: 2  KRLYVKNLSKRVTEEDLVYIFGRF 25


>gnl|CDD|233825 TIGR02344, chap_CCT_gamma, T-complex protein 1, gamma subunit.
           Members of this family, all eukaryotic, are part of the
           group II chaperonin complex called CCT (chaperonin
           containing TCP-1) or TRiC. The archaeal equivalent group
           II chaperonin is often called the thermosome. Both are
           somewhat related to the group I chaperonin of bacterial,
           GroEL/GroES. This family consists exclusively of the CCT
           gamma chain (part of a paralogous family) from animals,
           plants, fungi, and other eukaryotes.
          Length = 525

 Score = 25.5 bits (56), Expect = 7.2
 Identities = 11/19 (57%), Positives = 12/19 (63%), Gaps = 2/19 (10%)

Query: 79  VRKIFAPFGTIEECTVLKG 97
           V KI  P G IE+  VLKG
Sbjct: 197 VEKI--PGGDIEDSCVLKG 213


>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding
           protein 43 (TDP-43) and similar proteins.  This
           subfamily corresponds to the RRM1 of TDP-43 (also termed
           TARDBP), a ubiquitously expressed pathogenic protein
           whose normal function and abnormal aggregation are
           directly linked to the genetic disease cystic fibrosis,
           and two neurodegenerative disorders: frontotemporal
           lobar degeneration (FTLD) and amyotrophic lateral
           sclerosis (ALS). TDP-43 binds both DNA and RNA, and has
           been implicated in transcriptional repression, pre-mRNA
           splicing and translational regulation. TDP-43 is a
           dimeric protein with two RNA recognition motifs (RRMs),
           also termed RBDs (RNA binding domains) or RNPs
           (ribonucleoprotein domains), and a C-terminal
           glycine-rich domain. The RRMs are responsible for DNA
           and RNA binding; they bind to TAR DNA and RNA sequences
           with UG-repeats. The glycine-rich domain can interact
           with the hnRNP family proteins to form the hnRNP-rich
           complex involved in splicing inhibition. It is also
           essential for the cystic fibrosis transmembrane
           conductance regulator (CFTR) exon 9-skipping activity. .
          Length = 77

 Score = 24.3 bits (53), Expect = 7.5
 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 1/29 (3%)

Query: 76  EDDVRKIFAPFGTIEECTVLKGPD-GTSK 103
           E D++  F+ FG +    V K P  G SK
Sbjct: 13  EQDLKDYFSTFGELLMVQVKKDPKTGQSK 41


>gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast
          nucleolar protein 12 (Nop12p) and similar proteins.
          This subgroup corresponds to the RRM2 of Nop12p, which
          is encoded by YOL041C from Saccharomyces cerevisiae. It
          is a novel nucleolar protein required for pre-25S rRNA
          processing and normal rates of cell growth at low
          temperatures. Nop12p shares high sequence similarity
          with nucleolar protein 13 (Nop13p). Both, Nop12p and
          Nop13p, are not essential for growth. However, unlike
          Nop13p that localizes primarily to the nucleolus but is
          also present in the nucleoplasm to a lesser extent,
          Nop12p is localized to the nucleolus. Nop12p contains
          two RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains). .
          Length = 79

 Score = 24.1 bits (52), Expect = 9.0
 Identities = 10/34 (29%), Positives = 19/34 (55%)

Query: 65 LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGP 98
          +FVG L  +  E+ + ++F   G IE   +++ P
Sbjct: 2  VFVGNLGFEDVEEGLWRVFGKCGGIEYVRIVRDP 35


>gnl|CDD|240918 cd12474, RRM2_MSSP2, RNA recognition motif 2 found in vertebrate
           single-stranded DNA-binding protein MSSP-2.  This
           subgroup corresponds to the RRM2 of MSSP-2, also termed
           RNA-binding motif, single-stranded-interacting protein 2
           (RBMS2), or suppressor of CDC2 with RNA-binding motif 3
           (SCR3). MSSP-2 is a double- and single-stranded DNA
           binding protein that belongs to the c-myc single-strand
           binding proteins (MSSP) family. It specifically
           recognizes the sequence T(C/A)TT, and stimulates DNA
           replication in the system using SV40 DNA. MSSP-2 is
           identical with Scr3, a human protein which complements
           the defect of cdc2 kinase in Schizosaccharomyces pombe.
           MSSP-2 has been implied in regulating DNA replication,
           transcription, apoptosis induction, and cell-cycle
           movement, via the interaction with C-MYC, the product of
           protooncogene c-myc. MSSP-2 contains two RNA recognition
           motifs (RRMs), also termed RBDs (RNA binding domains) or
           RNPs (ribonucleoprotein domains), both of which are
           responsible for the specific DNA binding activity as
           well as induction of apoptosis. .
          Length = 86

 Score = 24.2 bits (52), Expect = 9.4
 Identities = 10/39 (25%), Positives = 20/39 (51%)

Query: 65  LFVGMLSKQQNEDDVRKIFAPFGTIEECTVLKGPDGTSK 103
           L++  L    +E ++  +  PFG +    +L+   GTS+
Sbjct: 3   LYISNLPLSMDEQELESMLKPFGQVISTRILRDASGTSR 41


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.323    0.143    0.487 

Gapped
Lambda     K      H
   0.267   0.0783    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 5,314,700
Number of extensions: 427608
Number of successful extensions: 623
Number of sequences better than 10.0: 1
Number of HSP's gapped: 623
Number of HSP's successfully gapped: 204
Length of query: 103
Length of database: 10,937,602
Length adjustment: 69
Effective length of query: 34
Effective length of database: 7,877,176
Effective search space: 267823984
Effective search space used: 267823984
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (24.1 bits)