BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy10295
         (115 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2QQP|A Chain A, Crystal Structure Of Authentic Providence Virus
 pdb|2QQP|C Chain C, Crystal Structure Of Authentic Providence Virus
 pdb|2QQP|E Chain E, Crystal Structure Of Authentic Providence Virus
 pdb|2QQP|G Chain G, Crystal Structure Of Authentic Providence Virus
          Length = 556

 Score = 25.8 bits (55), Expect = 5.8,   Method: Composition-based stats.
 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 4/40 (10%)

Query: 22  GMKPNGDRDRSAIQSEEVWTGVTYLLSAAMLYEGNVDEAW 61
            M   GDR  S  Q  +V+ G+T+  +A  L    +D+ W
Sbjct: 213 AMAEIGDRTDSVTQFRKVYKGITFEFNAPTL----IDQGW 248


>pdb|1YPR|A Chain A, Saccharomyces Cerevisiae (Yeast) Profilin
 pdb|1YPR|B Chain B, Saccharomyces Cerevisiae (Yeast) Profilin
 pdb|1K0K|A Chain A, Yeast Profilin, Cubic Crystal Form
          Length = 125

 Score = 25.4 bits (54), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 29/69 (42%), Gaps = 7/69 (10%)

Query: 47  LSAAMLYEGNVDEAWTTAGGLYRTVYERTGL--GFETPEGLTGDKTYRSGGYMRAL---- 100
           +  A++Y    D  W T+GGL     E   +  GF+ P GL  +  +  G     L    
Sbjct: 15  VDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNGLHIQGQKFMLLRADD 74

Query: 101 -AVYAMQDA 108
            ++Y   DA
Sbjct: 75  RSIYGRHDA 83


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.313    0.130    0.379 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,614,561
Number of Sequences: 62578
Number of extensions: 144033
Number of successful extensions: 174
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 173
Number of HSP's gapped (non-prelim): 4
length of query: 115
length of database: 14,973,337
effective HSP length: 78
effective length of query: 37
effective length of database: 10,092,253
effective search space: 373413361
effective search space used: 373413361
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 45 (21.9 bits)