Diaphorina citri psyllid: psy10295

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MKKKSRASARGFEAGSMGAVNGMKPNGDRDRSAIQSEEVWTGVTYLLSAAMLYEGNVDEAWTTAGGLYRTVYERTGLGFETPEGLTGDKTYRSGGYMRALAVYAMQDAYLKGKVK
ccHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccccCCcccccHHHHHHHHHHHHHHccccc
MKKKSRASARGFEAGSMGAVNGMKPNGDRDRSAIQSEEVWTGVTYLLSAAMLYEGNVDEAWTTAGGLYRTVYERTGLGFETPEGLTGDKTYRSGGYMRALAVYAMQDAYLKG***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKKSRASARGFEAGSMGAVNGMKPNGDRDRSAIQSEEVWTGVTYLLSAAMLYEGNVDEAWTTAGGLYRTVYERTGLGFETPEGLTGDKTYRSGGYMRALAVYAMQDAYLKGKVK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Non-lysosomal glucosylceramidase Non-lysosomal glucosylceramidase that catalyzes the conversion of glucosylceramide to free glucose and ceramide. Involved in sphingomyelin generation and prevention of glycolipid accumulation. May also catalyze the hydrolysis of bile acid 3-O-glucosides, however, the relevance of such activity is unclear in vivo.confidentQ69ZF3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008422 [MF]beta-glucosidase activityprobableGO:0015926, GO:0016787, GO:0016798, GO:0003824, GO:0003674, GO:0004553

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted