Query         psy10312
Match_columns 73
No_of_seqs    19 out of 21
Neff          1.7 
Searched_HMMs 46136
Date          Fri Aug 16 23:17:10 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10312.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10312hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF14737 DUF4470:  Domain of un  68.6     1.6 3.4E-05   27.1  -0.0   13   45-57      1-13  (100)
  2 PF03991 Prion_octapep:  Copper  60.8     3.9 8.4E-05   17.5   0.4    7   54-60      2-8   (8)
  3 PF08736 FA:  FERM adjacent (FA  43.9     9.3  0.0002   22.3   0.4    8    1-8       6-13  (47)
  4 PHA02673 ORF109 EEV glycoprote  34.7      14 0.00031   27.0   0.2   48   13-64     83-135 (161)
  5 KOG0570|consensus               33.4      25 0.00053   27.1   1.3   29   29-62     25-53  (223)
  6 PRK07772 single-stranded DNA-b  31.5      60  0.0013   23.3   3.0   23   39-64    161-183 (186)
  7 PF10185 Mesd:  Chaperone for w  25.9      34 0.00074   24.4   0.9   16   19-34     80-95  (158)
  8 COG4750 LicC CTP:phosphocholin  23.3      38 0.00083   26.2   0.8   30    1-31     10-39  (231)
  9 cd06588 PhnB_like Escherichia   22.9      53  0.0012   20.0   1.3   23   23-47     89-111 (128)
 10 TIGR03074 PQQ_membr_DH membran  21.9      28 0.00061   29.6  -0.2   23   17-39    707-729 (764)
 11 COG0491 GloB Zn-dependent hydr  21.6      46 0.00099   20.9   0.8   12   40-52    141-152 (252)
 12 PF11946 DUF3463:  Domain of un  20.4      54  0.0012   23.3   1.0   19   39-59     56-74  (138)
 13 PRK12404 stage V sporulation p  20.4      41  0.0009   26.8   0.5    8    4-11    145-152 (334)

No 1  
>PF14737 DUF4470:  Domain of unknown function (DUF4470)
Probab=68.59  E-value=1.6  Score=27.15  Aligned_cols=13  Identities=54%  Similarity=1.135  Sum_probs=10.1

Q ss_pred             CCcCCCCCCCCCc
Q psy10312         45 PWGHTPATNIGGT   57 (73)
Q Consensus        45 PWGhtP~~N~GGT   57 (73)
                      ||||+|+.++=-.
T Consensus         1 ~wG~tpA~dl~~~   13 (100)
T PF14737_consen    1 PWGNTPATDLLNL   13 (100)
T ss_pred             CcCCcccHHHHHh
Confidence            7999999876433


No 2  
>PF03991 Prion_octapep:  Copper binding octapeptide repeat;  InterPro: IPR020949 Prion protein (PrP-c) [, , ] is a small glycoprotein found in high quantity in the brain of animals infected with certain degenerative neurological diseases, such as sheep scrapie and bovine spongiform encephalopathy (BSE), and the human dementias Creutzfeldt-Jacob disease (CJD) and Gerstmann-Straussler syndrome (GSS). PrP-c is encoded in the host genome and is expressed both in normal and infected cells. During infection, however, the PrP-c molecule become altered (conformationally rather than at the amino acid level) to an abnormal isoform, PrP-sc. In detergent-treated brain extracts from infected individuals, fibrils composed of polymers of PrP-sc, namely scrapie-associated fibrils or prion rods, can be evidenced by electron microscopy. The precise function of the normal PrP isoform in healthy individuals remains unknown. Several results, mainly obtained in transgenic animals, indicate that PrP-c might play a role in long-term potentiation, in sleep physiology, in oxidative burst compensation (PrP can fix four Cu2+ through its octarepeat domain), in interactions with the extracellular matrix (PrP-c can bind to the precursor of the laminin receptor, LRP), in apoptosis and in signal transduction (costimulation of PrP-c induces a modulation of Fyn kinase phosphorylation) [].  The normal isoform, PrP-c, is anchored at the cell membrane, in rafts, through a glycosyl phosphatidyl inositol (GPI); its half-life at the cell surface is 5 h, after which the protein is internalised through a caveolae-dependent mechanism and degraded in the endolysosome compartment. Conversion between PrP-c and PrP-sc occurs likely during the internalisation process.  This repeat is found at the amino terminus of mammalian prion proteins. It has been shown to bind to copper [].
Probab=60.77  E-value=3.9  Score=17.45  Aligned_cols=7  Identities=57%  Similarity=1.541  Sum_probs=5.4

Q ss_pred             CCCcccc
Q psy10312         54 IGGTWGE   60 (73)
Q Consensus        54 ~GGTWGe   60 (73)
                      +||+||.
T Consensus         2 hgG~Wgq    8 (8)
T PF03991_consen    2 HGGGWGQ    8 (8)
T ss_pred             CCCcCCC
Confidence            6899983


No 3  
>PF08736 FA:  FERM adjacent (FA);  InterPro: IPR014847 This region is found adjacent to Band 4.1 / FERM domains (IPR000299 from INTERPRO) in a subset of FERM containing protein. The region has been hypothesised to play a role in regulatory adaptation, based on similarity to other protein kinase substrates []. 
Probab=43.94  E-value=9.3  Score=22.29  Aligned_cols=8  Identities=50%  Similarity=1.310  Sum_probs=6.3

Q ss_pred             CCccccce
Q psy10312          1 MGSRFRFP    8 (73)
Q Consensus         1 ~~~~~~~~    8 (73)
                      +||+|||-
T Consensus         6 ~GSkFRYS   13 (47)
T PF08736_consen    6 LGSKFRYS   13 (47)
T ss_pred             CcCcceec
Confidence            68899874


No 4  
>PHA02673 ORF109 EEV glycoprotein; Provisional
Probab=34.70  E-value=14  Score=27.00  Aligned_cols=48  Identities=31%  Similarity=0.626  Sum_probs=30.6

Q ss_pred             CCceeccccchhhh-Hhhh---hcCCCCCCCCc-cCCCCcCCCCCCCCCccccCCCC
Q psy10312         13 GANCCFIFTGTELW-EANL---RNGGQPPPQVA-QKTPWGHTPATNIGGTWGEDDEG   64 (73)
Q Consensus        13 g~~~~~~nnGTelW-EaNL---RNGGQpp~q~~-~ktPWGhtP~~N~GGTWGeDDd~   64 (73)
                      |-.|...+.. ..| |||.   +.|+..|.+-. .|.||   =..-+=||||+|-.+
T Consensus        83 ~~~Cltl~~p-~tf~eAn~~C~~~g~~LPs~~l~~~~pW---L~dYL~gTWg~~g~~  135 (161)
T PHA02673         83 GNKCLTLKYP-DTWTNANERCKELGQRLPSPSINKKYPW---LTDYLVGTWGNIKER  135 (161)
T ss_pred             CCeeEEeCCC-CcHHHHHHHHHhcCCcCCCCcccccCcH---HHHHhhcccccCCCC
Confidence            4444444533 345 5665   35667776654 56799   577888999997655


No 5  
>KOG0570|consensus
Probab=33.42  E-value=25  Score=27.13  Aligned_cols=29  Identities=31%  Similarity=0.637  Sum_probs=18.9

Q ss_pred             hhhcCCCCCCCCccCCCCcCCCCCCCCCccccCC
Q psy10312         29 NLRNGGQPPPQVAQKTPWGHTPATNIGGTWGEDD   62 (73)
Q Consensus        29 NLRNGGQpp~q~~~ktPWGhtP~~N~GGTWGeDD   62 (73)
                      |+-+|-+|||+++-+.-+     --.|++|-+||
T Consensus        25 ni~~~sAP~pP~p~~~tY-----~~FG~~~~~dd   53 (223)
T KOG0570|consen   25 NINKGSAPPPPPPILGTY-----KMFGEEYREDD   53 (223)
T ss_pred             cccCCCCCcccCCCccch-----hhhccccchhc
Confidence            444577777766545444     36799999655


No 6  
>PRK07772 single-stranded DNA-binding protein; Provisional
Probab=31.47  E-value=60  Score=23.31  Aligned_cols=23  Identities=26%  Similarity=0.758  Sum_probs=13.6

Q ss_pred             CCccCCCCcCCCCCCCCCccccCCCC
Q psy10312         39 QVAQKTPWGHTPATNIGGTWGEDDEG   64 (73)
Q Consensus        39 q~~~ktPWGhtP~~N~GGTWGeDDd~   64 (73)
                      +.+..-||.-.|   -.|-+|-+||.
T Consensus       161 ~~~~~~~w~~~~---~~~~~~~~~~~  183 (186)
T PRK07772        161 SAPADDPWSSAP---ASGGFGGGDDE  183 (186)
T ss_pred             CCCCCCccccCC---CCCCcCCCCCC
Confidence            346788998666   33445554443


No 7  
>PF10185 Mesd:  Chaperone for wingless signalling and trafficking of LDL receptor;  InterPro: IPR019330  Mesoderm development candidate 2 (also known as LDLR chaperone MESD)represents a set of highly conserved proteins found from nematodes to humans. It is a chaperone that specifically assists with the folding of beta-propeller/EGF modules within the family of low-density lipoprotein receptors (LDLRs). It also acts as a modulator of the Wnt pathway, since some LDLRs are coreceptors for the canonical Wnt pathway and is essential for specification of embryonic polarity and mesoderm induction []. The final C-terminal residues, KEDL, are the endoplasmic reticulum retention sequence as it is an ER protein specifically required for the intracellular trafficking of members of the low-density lipoprotein family of receptors (LDLRs) []. The N- and C-terminal sequences are predicted to adopt a random coil conformation, with the exception of an isolated predicted helix within the N-terminal region, The central folded domain flanked by natively unstructured regions is the necessary structure for facilitating maturation of LRP6 (Low-Density Lipoprotein Receptor-Related Protein 6 Maturation) []. ; PDB: 2RQM_A 2I9S_A 3OFH_A 2KGL_A 2RQK_A 2KMI_A 3OFG_A 3OFE_B 3OFF_A.
Probab=25.93  E-value=34  Score=24.44  Aligned_cols=16  Identities=38%  Similarity=0.574  Sum_probs=12.4

Q ss_pred             cccchhhhHhhhhcCC
Q psy10312         19 IFTGTELWEANLRNGG   34 (73)
Q Consensus        19 ~nnGTelWEaNLRNGG   34 (73)
                      +..=|.+|.++|||+.
T Consensus        80 ~e~i~~~Wq~~L~N~h   95 (158)
T PF10185_consen   80 TEEITKLWQTSLRNNH   95 (158)
T ss_dssp             HHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHhhCC
Confidence            3344679999999995


No 8  
>COG4750 LicC CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane]
Probab=23.28  E-value=38  Score=26.23  Aligned_cols=30  Identities=30%  Similarity=0.471  Sum_probs=24.0

Q ss_pred             CCccccceeeccCCceeccccchhhhHhhhh
Q psy10312          1 MGSRFRFPLEFLGANCCFIFTGTELWEANLR   31 (73)
Q Consensus         1 ~~~~~~~~~~~~g~~~~~~nnGTelWEaNLR   31 (73)
                      |||||+ ||.+--++.----+|+++=|-+++
T Consensus        10 ~gsR~~-plT~~tpK~LlkV~g~plIErqI~   39 (231)
T COG4750          10 LGSRFV-PLTQSTPKSLLKVNGEPLIERQIE   39 (231)
T ss_pred             cccccc-cccccCChHHHHhcCcccHHHHHH
Confidence            689997 887777777777789999888765


No 9  
>cd06588 PhnB_like Escherichia coli PhnB and similar proteins; the E. coli phnB gene is found next to an operon involved in the cleavage of carbon-phosphorus bonds in unactivated alkylphosphonates. The Escherichia coli phnB gene is found next to an operon of fourteen genes (phnC-to-phnP) related to the cleavage of carbon-phosphorus (C-P) bonds in unactivated alkylphosphonates, supporting bacterial growth on alkylphosphonates as the sole phosphorus source. It was originally considered part of that operon. PhnB appears to play no direct catalytic role in the usage of alkylphosphonate. Although many of the proteins in this family have been annotated as 3-demethylubiquinone-9 3-methyltransferase enzymes by automatic annotation programs, the experimental evidence for this assignment is lacking. In Escherichia coli, the gene coding 3-demethylubiquinone-9 3-methyltransferase enzyme is ubiG, which belongs to the AdoMet-MTase protein family. PhnB-like proteins adopt a structural fold similar to 
Probab=22.93  E-value=53  Score=19.99  Aligned_cols=23  Identities=43%  Similarity=0.624  Sum_probs=15.6

Q ss_pred             hhhhHhhhhcCCCCCCCCccCCCCc
Q psy10312         23 TELWEANLRNGGQPPPQVAQKTPWG   47 (73)
Q Consensus        23 TelWEaNLRNGGQpp~q~~~ktPWG   47 (73)
                      .++|+. |..||+. -++.+++|||
T Consensus        89 ~~~~~~-l~~~g~~-~~~~~~~~~g  111 (128)
T cd06588          89 DRLFEA-LSEGGTV-LMPLQKTFWS  111 (128)
T ss_pred             HHHHHH-HhcCCeE-eccchhcCcc
Confidence            367775 9999843 3455677998


No 10 
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family. This protein family has a phylogenetic distribution very similar to that coenzyme PQQ biosynthesis enzymes, as shown by partial phylogenetic profiling. Members of this family have several predicted transmembrane helices in the N-terminal region, and include the quinoprotein glucose dehydrogenase (EC 1.1.5.2) of Escherichia coli and the quinate/shikimate dehydrogenase of Acinetobacter sp. ADP1 (EC 1.1.99.25). Sequences closely related except for the absense of the N-terminal hydrophobic region, scoring in the gray zone between the trusted and noise cutoffs, include PQQ-dependent glycerol (EC 1.1.99.22) and and other polyol (sugar alcohol) dehydrogenases.
Probab=21.90  E-value=28  Score=29.63  Aligned_cols=23  Identities=48%  Similarity=0.806  Sum_probs=19.5

Q ss_pred             eccccchhhhHhhhhcCCCCCCC
Q psy10312         17 CFIFTGTELWEANLRNGGQPPPQ   39 (73)
Q Consensus        17 ~~~nnGTelWEaNLRNGGQpp~q   39 (73)
                      ....||.+||++.|-.+++..|.
T Consensus       707 ~D~~tGk~lW~~~l~~~~~a~P~  729 (764)
T TIGR03074       707 YDLSTGKELWKARLPAGGQATPM  729 (764)
T ss_pred             EECCCCceeeEeeCCCCcccCCE
Confidence            34678999999999999988874


No 11 
>COG0491 GloB Zn-dependent hydrolases, including glyoxylases [General function prediction only]
Probab=21.63  E-value=46  Score=20.87  Aligned_cols=12  Identities=50%  Similarity=0.839  Sum_probs=9.0

Q ss_pred             CccCCCCcCCCCC
Q psy10312         40 VAQKTPWGHTPAT   52 (73)
Q Consensus        40 ~~~ktPWGhtP~~   52 (73)
                      .+-.+| ||||..
T Consensus       141 ~~i~tp-GHT~g~  152 (252)
T COG0491         141 EVLHTP-GHTPGH  152 (252)
T ss_pred             EEEECC-CCCCCe
Confidence            356788 999964


No 12 
>PF11946 DUF3463:  Domain of unknown function (DUF3463);  InterPro: IPR022563  This functionally uncharacterised domain is found in bacteria and archaea, which is about 140 amino acids in length and is found C-terminal to PF04055 from PFAM. It contains two conserved sequence motifs: CTPWG and PCYL. This domain is associated with hopanoid biosynthesis associated radical SAM proteins. 
Probab=20.41  E-value=54  Score=23.26  Aligned_cols=19  Identities=42%  Similarity=0.886  Sum_probs=15.6

Q ss_pred             CCccCCCCcCCCCCCCCCccc
Q psy10312         39 QVAQKTPWGHTPATNIGGTWG   59 (73)
Q Consensus        39 q~~~ktPWGhtP~~N~GGTWG   59 (73)
                      +.-.-|||| +|+-|+=| |-
T Consensus        56 ~~~~CtPWg-~pt~n~~G-wq   74 (138)
T PF11946_consen   56 RDYECTPWG-NPTRNPFG-WQ   74 (138)
T ss_pred             CCCcccCCC-CCccCccc-cc
Confidence            466889999 89999877 74


No 13 
>PRK12404 stage V sporulation protein AD; Provisional
Probab=20.37  E-value=41  Score=26.78  Aligned_cols=8  Identities=50%  Similarity=1.385  Sum_probs=7.0

Q ss_pred             cccceeec
Q psy10312          4 RFRFPLEF   11 (73)
Q Consensus         4 ~~~~~~~~   11 (73)
                      .||||+|.
T Consensus       145 qfR~P~ey  152 (334)
T PRK12404        145 QFRYPTEY  152 (334)
T ss_pred             hccCcccc
Confidence            59999996


Done!