BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy10314
         (233 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1XR8|A Chain A, Crystal Structures Of Hla-B1501 In Complex With Peptides
           From Human Ubch6 And Epstein-Barr Virus Ebna-3
 pdb|1XR9|A Chain A, Crystal Structures Of Hla-B1501 In Complex With Peptides
           From Human Ubch6 And Epstein-Barr Virus Ebna-3
 pdb|3C9N|A Chain A, Crystal Structure Of A Sars Corona Virus Derived Peptide
           Bound To The Human Major Histocompatibility Complex
           Class I Molecule Hla-B1501
          Length = 276

 Score = 26.9 bits (58), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 19/30 (63%)

Query: 128 WDKGTRVSVTLSPKWKNKVKGLCGNYNDNE 157
           WD+ T++S T +  ++  ++ L G YN +E
Sbjct: 60  WDRETQISKTNTQTYRESLRNLRGYYNQSE 89


>pdb|3LN5|A Chain A, Crystal Structure Of Hla-B4104 In Complex With A 11mer
           Self-Peptide Derived From S-Methyl-5-Thioadenosine
           Phosphorylase
          Length = 274

 Score = 26.9 bits (58), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 19/30 (63%)

Query: 128 WDKGTRVSVTLSPKWKNKVKGLCGNYNDNE 157
           WD+ T++S T +  ++  ++ L G YN +E
Sbjct: 60  WDRETQISKTNTQTYRESLRNLRGYYNQSE 89


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.133    0.435 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,138,622
Number of Sequences: 62578
Number of extensions: 276004
Number of successful extensions: 506
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 502
Number of HSP's gapped (non-prelim): 6
length of query: 233
length of database: 14,973,337
effective HSP length: 96
effective length of query: 137
effective length of database: 8,965,849
effective search space: 1228321313
effective search space used: 1228321313
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)