Diaphorina citri psyllid: psy10320

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260--
MVGTKVYIGGLPYGVRERDLEKFVKGYGRIRDVILKNGFGFVEFEDYRDADDAVYELNGKSLLGERVTVEIAKGIDRSQERGRRGYGSYRAPPPRRGWGHDRDDRYGPPTRSDHRLIVENLSSRVSWQDLKDFMRQVGEVCYADAHKRHRNEGVVEFESSSDMKKALDKLDNAELNGRRIRLIEDKPRGGGRGRSRSSSSRSRSKSRSRSRSSKSRSPRSRSKSGSPRKSKSKAKSVSRSPSPSKTRKRSRSRSDSRARKVS
ccccEEEEccccccccHHHHHHHHHcccccEEEEECccEEEEEEcccHHHHHHHHHHccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHcccEEEEEccccccccEEEEEccHHHHHHHHHHHccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
*VGTKVYIGGLPYGVRERDLEKFVKGYGRIRDVILKNGFGFVEFEDYRDADDAVYELNGKSLLGERVTVEIAK********************PRRGWGHDRDDRYGPPTRSDHRLIVENLSSRVSWQDLKDFMRQVGEVCYADAHKRHRNEGVVEFESSSDMKKALDKLDNAELNG*************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGTKVYIGGLPYGVRERDLEKFVKGYGRIRDVILKNGFGFVEFEDYRDADDAVYELNGKSLLGERVTVEIAKGIDRSQERGRRGYGSYRAPPPRRGWGHDRDDRYGPPTRSDHRLIVENLSSRVSWQDLKDFMRQVGEVCYADAHKRHRNEGVVEFESSSDMKKALDKLDNAELNGRRIRLIEDKPRGGGRGRSRSSSSRSRSKSRSRSRSSKSRSPRSRSKSGSPRKSKSKAKSVSRSPSPSKTRKRSRSRSDSRARKVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/arginine-rich splicing factor 4 Plays a role in alternative splice site selection during pre-mRNA splicing. Represses the splicing of MAPT/Tau exon 10.confidentQ8VE97
Serine/arginine-rich splicing factor 4 Plays a role in alternative splice site selection during pre-mRNA splicing. Represses the splicing of MAPT/Tau exon 10.confidentQ08170
Probable splicing factor, arginine/serine-rich 2 Plays a functionally redundant role in spermatogenesis and growth rate control. Required for the development of somatic gonad structures and for progression from larval stage to adulthood.confidentQ23120

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0009611 [BP]response to woundingprobableGO:0006950, GO:0008150, GO:0050896
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0000166 [MF]nucleotide bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:1901363, GO:1901265
GO:0006376 [BP]mRNA splice site selectionprobableGO:0022607, GO:0000245, GO:0043933, GO:0090304, GO:0034641, GO:0006807, GO:0044237, GO:0034622, GO:0071840, GO:0006139, GO:0071826, GO:0044260, GO:0016043, GO:0065003, GO:0071704, GO:0010467, GO:0022618, GO:1901360, GO:0022613, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0000398, GO:0043170, GO:0044085, GO:0006396, GO:0006397
GO:0010557 [BP]positive regulation of macromolecule biosynthetic processprobableGO:0009893, GO:0019222, GO:0009891, GO:0060255, GO:0009889, GO:0010556, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0010604
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0006417 [BP]regulation of translationprobableGO:0032268, GO:0009889, GO:0080090, GO:0019222, GO:0051246, GO:0060255, GO:0010608, GO:0031323, GO:2000112, GO:0050794, GO:0050789, GO:0010556, GO:0065007, GO:0031326, GO:0008150, GO:0010468
GO:0010033 [BP]response to organic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050733 [MF]RS domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0006369 [BP]termination of RNA polymerase II transcriptionprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006353, GO:0019438
GO:0007548 [BP]sex differentiationprobableGO:0032502, GO:0003006, GO:0008150, GO:0000003, GO:0022414
GO:0048608 [BP]reproductive structure developmentprobableGO:0032502, GO:0032501, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0003006, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0051726 [BP]regulation of cell cycleprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0031124 [BP]mRNA 3'-end processingprobableGO:0016070, GO:0016071, GO:0044238, GO:0044260, GO:0006139, GO:1901360, GO:0009987, GO:0006725, GO:0034641, GO:0031123, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:0044237, GO:0008152, GO:0046483, GO:0006396, GO:0006397
GO:0009628 [BP]response to abiotic stimulusprobableGO:0050896, GO:0008150
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0031328 [BP]positive regulation of cellular biosynthetic processprobableGO:0009893, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0009889, GO:0050794, GO:0031323, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0035327 [CC]transcriptionally active chromatinprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0000785, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0035062 [CC]omega speckleprobableGO:0016607, GO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0005700 [CC]polytene chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0048025 [BP]negative regulation of mRNA splicing, via spliceosomeprobableGO:0033119, GO:0009892, GO:0080090, GO:0019222, GO:0050684, GO:0050686, GO:0031323, GO:0048024, GO:0050789, GO:0010605, GO:0043484, GO:0019219, GO:0065007, GO:0048519, GO:0010468, GO:0031324, GO:0045934, GO:0060255, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:0051253, GO:0051252, GO:0048523
GO:0003729 [MF]mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0006406 [BP]mRNA export from nucleusprobableGO:0015931, GO:0051169, GO:0051168, GO:0016482, GO:0051028, GO:0044699, GO:0071705, GO:0071702, GO:0033036, GO:0006405, GO:0009987, GO:0006810, GO:0006913, GO:0044763, GO:0051649, GO:0051236, GO:0051234, GO:0051179, GO:0051641, GO:0050658, GO:0006403, GO:0046907, GO:0050657, GO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QFJ, chain A
Confidence level:very confident
Coverage over the Query: 3-83,105-189
View the alignment between query and template
View the model in PyMOL
Template: 1QM9, chain A
Confidence level:very confident
Coverage over the Query: 1-188
View the alignment between query and template
View the model in PyMOL