Query         psy1033
Match_columns 67
No_of_seqs    102 out of 1007
Neff          7.3 
Searched_HMMs 46136
Date          Fri Aug 16 15:13:48 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy1033.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/1033hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd02872 GH18_chitolectin_chito  99.7 9.3E-17   2E-21  108.8   6.0   66    1-66    200-265 (362)
  2 smart00636 Glyco_18 Glycosyl h  99.6   5E-16 1.1E-20  104.0   5.6   63    1-66    196-258 (334)
  3 cd02878 GH18_zymocin_alpha Zym  99.6 5.5E-15 1.2E-19  100.5   5.9   49   18-66    215-263 (345)
  4 cd02873 GH18_IDGF The IDGF's (  99.5 9.8E-15 2.1E-19  101.4   6.0   63    1-66    234-299 (413)
  5 KOG2806|consensus               99.5 1.3E-13 2.8E-18   96.5   5.7   62    1-65    256-317 (432)
  6 cd06548 GH18_chitinase The GH1  99.4 1.2E-13 2.7E-18   92.9   4.1   48    1-50    221-268 (322)
  7 cd02879 GH18_plant_chitinase_c  99.4 1.7E-13 3.7E-18   91.7   3.7   46    1-52    202-247 (299)
  8 cd02875 GH18_chitobiase Chitob  99.2 3.2E-11   7E-16   82.7   4.9   37   17-53    206-242 (358)
  9 PF00704 Glyco_hydro_18:  Glyco  99.2 4.6E-11   1E-15   79.4   5.2   57    1-60    204-260 (343)
 10 cd02876 GH18_SI-CLP Stabilin-1  99.1 5.9E-11 1.3E-15   79.7   2.6   35   18-52    202-237 (318)
 11 COG3325 ChiA Chitinase [Carboh  99.1 1.8E-10   4E-15   80.9   4.9   55    1-55    263-324 (441)
 12 cd06545 GH18_3CO4_chitinase Th  98.7 8.7E-09 1.9E-13   67.4   2.6   33   18-50    181-214 (253)
 13 cd02874 GH18_CFLE_spore_hydrol  98.4 1.2E-07 2.5E-12   63.5   2.0   33   19-52    194-226 (313)
 14 cd06549 GH18_trifunctional GH1  98.2 9.7E-07 2.1E-11   59.1   2.4   32   20-52    187-218 (298)
 15 COG3858 Predicted glycosyl hyd  96.7  0.0007 1.5E-08   48.0   1.0   33   20-53    299-331 (423)
 16 cd06544 GH18_narbonin Narbonin  92.5    0.15 3.3E-06   33.8   3.0   31   19-49    190-222 (253)
 17 PF08869 XisI:  XisI protein;    90.9    0.11 2.3E-06   31.0   0.8   28   22-49     78-106 (111)
 18 cd06546 GH18_CTS3_chitinase GH  82.9     1.5 3.2E-05   29.0   2.8   21   23-43    197-217 (256)
 19 cd02871 GH18_chitinase_D-like   82.8     1.3 2.8E-05   29.9   2.6   13   32-44    236-248 (312)
 20 KOG2091|consensus               81.1     1.2 2.7E-05   31.3   2.0   32   20-51    278-309 (392)
 21 cd08345 Fosfomycin_RP Fosfomyc  64.5      10 0.00022   20.6   2.8   39   19-57     67-105 (113)
 22 PRK00040 rpsP 30S ribosomal pr  55.1     6.2 0.00014   21.8   0.8   21   17-38     51-71  (75)
 23 TIGR00002 S16 ribosomal protei  52.8     6.9 0.00015   21.8   0.7   21   17-38     48-68  (78)
 24 PF02126 PTE:  Phosphotriestera  51.9     9.7 0.00021   26.1   1.5   24   19-42    168-191 (308)
 25 KOG3419|consensus               51.5      24 0.00052   21.0   2.9   22   17-39     53-74  (112)
 26 PRK14522 rpsP 30S ribosomal pr  51.1      15 0.00032   22.1   2.0   21   17-38     49-69  (116)
 27 cd06542 GH18_EndoS-like Endo-b  50.4     7.3 0.00016   25.2   0.7   20   29-48    191-210 (255)
 28 CHL00005 rps16 ribosomal prote  49.5       8 0.00017   21.8   0.7   21   17-38     47-67  (82)
 29 PRK14520 rpsP 30S ribosomal pr  49.1      15 0.00032   23.2   1.8   22   17-39     50-71  (155)
 30 PRK14525 rpsP 30S ribosomal pr  47.9     8.7 0.00019   21.9   0.7   21   17-38     50-70  (88)
 31 PF06940 DUF1287:  Domain of un  47.9      13 0.00029   23.6   1.5   39   15-53     32-75  (164)
 32 PF13606 Ank_3:  Ankyrin repeat  47.9      25 0.00053   15.5   2.1   14   22-35     16-29  (30)
 33 PF03688 Nepo_coat_C:  Nepoviru  45.4     6.6 0.00014   24.7  -0.1    8   40-47    156-163 (163)
 34 PRK14524 rpsP 30S ribosomal pr  44.0      11 0.00023   21.8   0.6   22   17-39     49-70  (94)
 35 PRK14521 rpsP 30S ribosomal pr  43.8      21 0.00045   23.1   2.0   31   17-48     50-80  (186)
 36 TIGR00250 RNAse_H_YqgF RNAse H  42.9      29 0.00063   20.7   2.4   22   22-44     38-59  (130)
 37 KOG4465|consensus               42.4      41 0.00089   24.6   3.4   40   17-58    535-576 (598)
 38 cd07240 ED_TypeI_classII_N N-t  42.1      27 0.00059   18.9   2.1   39   19-57     70-108 (117)
 39 PF07519 Tannase:  Tannase and   37.9      46 0.00099   24.1   3.2   24   17-40    413-436 (474)
 40 PRK09875 putative hydrolase; P  37.8      32  0.0007   23.4   2.3   22   22-43    167-188 (292)
 41 PF02230 Abhydrolase_2:  Phosph  37.3      38 0.00083   21.1   2.5   21   20-40     90-110 (216)
 42 cd07263 Glo_EDI_BRP_like_16 Th  36.3      41 0.00089   17.9   2.3   39   18-57     76-114 (119)
 43 cd02877 GH18_hevamine_XipI_cla  36.0      44 0.00095   22.5   2.7   25   20-45    203-230 (280)
 44 cd08354 Glo_EDI_BRP_like_13 Th  35.3      58  0.0012   17.7   2.8   37   19-56     79-115 (122)
 45 KOG1411|consensus               34.9      29 0.00063   25.0   1.8   23   24-46     42-64  (427)
 46 PRK00109 Holliday junction res  34.8      45 0.00097   20.1   2.4   22   22-44     44-65  (138)
 47 cd07247 SgaA_N_like N-terminal  34.4      47   0.001   17.9   2.3   40   17-56     69-108 (114)
 48 COG0228 RpsP Ribosomal protein  33.3      45 0.00098   19.1   2.1   19   17-36     50-68  (87)
 49 PF00886 Ribosomal_S16:  Riboso  33.0      16 0.00034   19.3   0.1   17   17-34     45-61  (62)
 50 cd06587 Glo_EDI_BRP_like This   32.4      76  0.0016   16.1   3.0   38   18-55     70-107 (112)
 51 COG0180 TrpS Tryptophanyl-tRNA  31.9      49  0.0011   23.0   2.4   23   17-39     62-84  (314)
 52 PF14681 UPRTase:  Uracil phosp  31.3      31 0.00068   22.0   1.4   27   15-41    132-158 (207)
 53 PF00691 OmpA:  OmpA family;  I  30.7      64  0.0014   17.3   2.4   19   21-39     57-75  (97)
 54 PF06925 MGDG_synth:  Monogalac  30.6      54  0.0012   19.8   2.3   24   19-42    144-168 (169)
 55 cd07238 Glo_EDI_BRP_like_5 Thi  30.2      61  0.0013   17.5   2.3   40   17-57     65-105 (112)
 56 COG2103 Predicted sugar phosph  30.0      88  0.0019   21.7   3.4   31   18-48    113-143 (298)
 57 cd02430 PTH2 Peptidyl-tRNA hyd  28.9      70  0.0015   18.8   2.5   21   22-44     39-59  (115)
 58 TIGR00233 trpS tryptophanyl-tR  28.7      45 0.00098   23.0   1.9   24   17-40     58-81  (328)
 59 PRK14523 rpsP 30S ribosomal pr  27.3      29 0.00062   21.5   0.6   21   17-38     51-71  (137)
 60 PF11054 Surface_antigen:  Spor  27.3      66  0.0014   21.8   2.4   26   16-41    115-145 (254)
 61 PF12681 Glyoxalase_2:  Glyoxal  25.5      83  0.0018   16.6   2.3   40   17-56     64-103 (108)
 62 PF09288 UBA_3:  Fungal ubiquit  25.5      15 0.00032   19.3  -0.8   19   22-40     11-29  (55)
 63 KOG1017|consensus               25.2 1.1E+02  0.0024   20.5   3.1   26   16-41    201-226 (267)
 64 PF00688 TGFb_propeptide:  TGF-  24.7      72  0.0016   19.8   2.2   26   17-42    177-202 (238)
 65 PF07397 DUF1502:  Repeat of un  24.6      51  0.0011   15.4   1.1   11   57-67      4-14  (34)
 66 PLN02886 aminoacyl-tRNA ligase  22.9      92   0.002   22.3   2.6   24   18-41    101-124 (389)
 67 cd07249 MMCE Methylmalonyl-CoA  22.9      96  0.0021   16.8   2.3   37   17-53     80-116 (128)
 68 PF06035 Peptidase_C93:  Bacter  22.9      79  0.0017   20.1   2.0   24   19-42     80-106 (170)
 69 COG4002 Predicted phosphotrans  22.7      51  0.0011   22.2   1.2   32   25-56     65-102 (256)
 70 smart00775 LNS2 LNS2 domain. T  22.7      76  0.0016   19.3   1.9   21   19-39    127-147 (157)
 71 COG0816 Predicted endonuclease  22.5   1E+02  0.0022   18.9   2.4   11   33-43     53-63  (141)
 72 PF00023 Ank:  Ankyrin repeat H  22.1      88  0.0019   13.5   2.2   17   20-36     14-30  (33)
 73 COG1735 Php Predicted metal-de  20.9      93   0.002   21.8   2.2   22   20-41    178-199 (316)
 74 COG1182 AcpD Acyl carrier prot  20.6      84  0.0018   20.6   1.8   25   22-46     76-100 (202)
 75 PF03846 SulA:  Cell division i  20.6   1E+02  0.0022   18.6   2.1   14   27-40     77-90  (119)
 76 COG1871 CheD Chemotaxis protei  20.0   1E+02  0.0022   19.6   2.1   33   17-49     72-104 (164)

No 1  
>cd02872 GH18_chitolectin_chitotriosidase This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases.  The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases.  The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel.  The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding.  Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense.  Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the la
Probab=99.67  E-value=9.3e-17  Score=108.82  Aligned_cols=66  Identities=48%  Similarity=0.898  Sum_probs=58.5

Q ss_pred             CCCCCCCCCCCCCcCccccHHHHHHHHHHcCCCCCceEEEeccceeeeeecCCCCCCCCCCcCCCC
Q psy1033           1 PNAPLYPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDSTDYGMPASEKG   66 (67)
Q Consensus         1 ~~apL~~~~~~~~~~~~~n~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~l~~~~~~~~g~p~~g~g   66 (67)
                      |+|||+..+.++.....++++.+|++|+++|+|++||+||||||||.|++++..++++|+|+.|+|
T Consensus       200 ~~spl~~~~~~~~~~~~~~v~~~v~~~~~~gvp~~KlvlGlp~YG~~~~~~~~~~~~~g~~~~g~~  265 (362)
T cd02872         200 HNSPLYAGSADTGDQKYLNVDYAIKYWLSKGAPPEKLVLGIPTYGRSFTLASPSNTGVGAPASGPG  265 (362)
T ss_pred             CCCCCCCCCCCccccccccHHHHHHHHHHcCCCHHHeEeccccccceeeecCCccCCCCCccCCCC
Confidence            689999887765434578999999999999999999999999999999999888889999998765


No 2  
>smart00636 Glyco_18 Glycosyl hydrolase family 18.
Probab=99.63  E-value=5e-16  Score=104.00  Aligned_cols=63  Identities=41%  Similarity=0.809  Sum_probs=56.3

Q ss_pred             CCCCCCCCCCCCCcCccccHHHHHHHHHHcCCCCCceEEEeccceeeeeecCCCCCCCCCCcCCCC
Q psy1033           1 PNAPLYPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDSTDYGMPASEKG   66 (67)
Q Consensus         1 ~~apL~~~~~~~~~~~~~n~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~l~~~~~~~~g~p~~g~g   66 (67)
                      |||||+..+.++   ..+|++.+|++|++.|+|++||+||||||||.|++.++.++++++|+.|++
T Consensus       196 ~~spl~~~~~~~---~~~~v~~~v~~~~~~gvp~~KlvlGip~YG~~~~~~~~~~~~~~~~~~g~~  258 (334)
T smart00636      196 HNAPLYAGPGDP---EKYNVDYAVKYYLCKGVPPSKLVLGIPFYGRGWTLVDGSNNGPGAPFTGPA  258 (334)
T ss_pred             CCCcCCCCCCCC---CCccHHHHHHHHHHcCCCHHHeEEeeccccCccccCCCCcCCCCCcccCCC
Confidence            689998877654   368999999999999999999999999999999999988889999998764


No 3  
>cd02878 GH18_zymocin_alpha Zymocin, alpha subunit.  Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest.  The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation.  The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
Probab=99.57  E-value=5.5e-15  Score=100.48  Aligned_cols=49  Identities=24%  Similarity=0.525  Sum_probs=46.2

Q ss_pred             ccHHHHHHHHHHcCCCCCceEEEeccceeeeeecCCCCCCCCCCcCCCC
Q psy1033          18 LNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDSTDYGMPASEKG   66 (67)
Q Consensus        18 ~n~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~l~~~~~~~~g~p~~g~g   66 (67)
                      .+++.+|++|+++|+|++|||||||||||+|+++++.++++++|+.|+|
T Consensus       215 ~~~~~~v~~~~~~Gvp~~KlvlGip~YGr~~~l~~~~~~~~~~p~~g~~  263 (345)
T cd02878         215 TETLDALSMITKAGVPSNKVVVGVASYGRSFKMADPGCTGPGCTFTGPG  263 (345)
T ss_pred             hhHHHHHHHHHHcCCCHHHeEEeeccccceeeccCCCCCCCCCcccCCC
Confidence            4689999999999999999999999999999999999999999999875


No 4  
>cd02873 GH18_IDGF The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster. The IDGF's have an eight-stranded alpha/beta barrel fold and are related to the glycosyl hydrolase family 18 (GH18) chitinases, but they have an amino acid substitution known to abolish chitinase catalytic activity. IDGFs may have evolved from chitinases to gain new functions as growth factors, interacting with cell surface glycoproteins involved in growth-promoting processes.
Probab=99.55  E-value=9.8e-15  Score=101.44  Aligned_cols=63  Identities=32%  Similarity=0.566  Sum_probs=49.0

Q ss_pred             CCCCCCCCCCCCCcCccccHHHHHHHHHHcCCCCCceEEEeccceeeeeecCCC-CCCC--CCCcCCCC
Q psy1033           1 PNAPLYPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPD-STDY--GMPASEKG   66 (67)
Q Consensus         1 ~~apL~~~~~~~~~~~~~n~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~l~~~~-~~~~--g~p~~g~g   66 (67)
                      |+||||.....   ...+|++.+|++|+++|+|++|||||||||||.|++++++ .++.  .+++.|+|
T Consensus       234 ~~apL~~~~~~---~~~~~v~~~v~~~~~~gvp~~KlvlGip~YGr~w~l~~~~~~~g~~~~~~~~g~~  299 (413)
T cd02873         234 YTAPIYELYER---NPHHNVDYQVKYWLNQGTPASKLNLGIATYGRAWKLTKDSGITGVPPVLETDGPG  299 (413)
T ss_pred             cCCccCCCccc---cccccHHHHHHHHHHcCCCHHHeEEEEecceeeeEccCCCCCcCCCCCccCCCCC
Confidence            68999976432   2468999999999999999999999999999999998753 2332  24555543


No 5  
>KOG2806|consensus
Probab=99.45  E-value=1.3e-13  Score=96.51  Aligned_cols=62  Identities=31%  Similarity=0.589  Sum_probs=49.9

Q ss_pred             CCCCCCCCCCCCCcCccccHHHHHHHHHHcCCCCCceEEEeccceeeeeecCCCCCCCCCCcCCC
Q psy1033           1 PNAPLYPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDSTDYGMPASEK   65 (67)
Q Consensus         1 ~~apL~~~~~~~~~~~~~n~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~l~~~~~~~~g~p~~g~   65 (67)
                      |+||||....+  ....+|+|.+|++|++.|.+++|||||||||||.|++++.+.+ ++.+..+.
T Consensus       256 p~aPl~~~~~~--~~~~~Nvd~~~ky~~~~~~~~~Kl~~gip~yg~~w~~~~~~~~-~~~~~~~~  317 (432)
T KOG2806|consen  256 PPSPLYKGPSM--TNPKMNVDSLLKYWTEKGLPPSKLVLALPFYGRSWQLLEDSRS-SAAPPFGQ  317 (432)
T ss_pred             CCcccCCCCcc--cccCcchhhhHHHHhhcCCCchheEEEEecceehhhhcCCcCC-CCCccCCC
Confidence            68999987541  1246899999999999999999999999999999999986555 55444443


No 6  
>cd06548 GH18_chitinase The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites.  The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
Probab=99.43  E-value=1.2e-13  Score=92.85  Aligned_cols=48  Identities=38%  Similarity=0.713  Sum_probs=43.1

Q ss_pred             CCCCCCCCCCCCCcCccccHHHHHHHHHHcCCCCCceEEEeccceeeeee
Q psy1033           1 PNAPLYPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTL   50 (67)
Q Consensus         1 ~~apL~~~~~~~~~~~~~n~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~l   50 (67)
                      ||||||..+.++.  ..+|++.+|++|+++|+|++|||||||||||+|++
T Consensus       221 ~~spL~~~~~~~~--~~~~v~~~v~~~~~~gvp~~KlvlGip~YGr~~~~  268 (322)
T cd06548         221 HHSNLYASPADPP--GGYSVDAAVNYYLSAGVPPEKLVLGVPFYGRGWTG  268 (322)
T ss_pred             CCCCCCCCCCCCC--CCccHHHHHHHHHHcCCCHHHeEEEecccccccCC
Confidence            7899998876542  46899999999999999999999999999999987


No 7  
>cd02879 GH18_plant_chitinase_class_V The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes.  The GH18 domain of the class V chitinases has endochitinase activity in some cases and no catalytic activity in others.  Included in this family is a lectin found in black locust (Robinia pseudoacacia) bark, which binds chitin but lacks chitinase activity.  Also included is a chitinase-related receptor-like kinase (CHRK1) from tobacco (Nicotiana tabacum), with an N-terminal GH18 domain and a C-terminal kinase domain, which is thought to be part of a plant signaling pathway.  The GH18 domain of CHRK1 is expressed extracellularly where it binds chitin but lacks chitinase activity.
Probab=99.41  E-value=1.7e-13  Score=91.73  Aligned_cols=46  Identities=37%  Similarity=0.842  Sum_probs=40.1

Q ss_pred             CCCCCCCCCCCCCcCccccHHHHHHHHHHcCCCCCceEEEeccceeeeeecC
Q psy1033           1 PNAPLYPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVN   52 (67)
Q Consensus         1 ~~apL~~~~~~~~~~~~~n~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~l~~   52 (67)
                      |+||||..+.      .+|++.+|++|+++|+|++|||||||||||+|++-+
T Consensus       202 ~~a~l~~~~~------~~~~~~~v~~~~~~g~p~~KlvlGvp~YGr~~~~~D  247 (299)
T cd02879         202 PAAALYDPNS------NVSTDYGIKSWIKAGVPAKKLVLGLPLYGRAWTLYD  247 (299)
T ss_pred             CCCcCCCCCC------CCCHHHHHHHHHHcCCCHHHEEEEeccccccccccC
Confidence            5688886532      479999999999999999999999999999998744


No 8  
>cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes. Chitobiase can only do so if the asparagine that joins the oligosaccharide to protein is previously removed by a glycosylasparaginase. Chitobiase is therefore the final step in the lysosomal degradation of the protein/carbohydrate linkage component of asparagine-linked glycoproteins. The catalytic domain of chitobiase is an eight-stranded alpha/beta barrel fold similar to that of other family 18 glycosyl hydrolases such as hevamine and chitotriosidase.
Probab=99.18  E-value=3.2e-11  Score=82.66  Aligned_cols=37  Identities=32%  Similarity=0.477  Sum_probs=33.8

Q ss_pred             cccHHHHHHHHHHcCCCCCceEEEeccceeeeeecCC
Q psy1033          17 SLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNP   53 (67)
Q Consensus        17 ~~n~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~l~~~   53 (67)
                      ..+++.+|++|+++|+|++|||||||||||.|++.+.
T Consensus       206 ~~~v~~~v~~~~~~gvp~~KLvLGip~YGr~w~~~~~  242 (358)
T cd02875         206 YSQTLSGYNNFTKLGIDPKKLVMGLPWYGYDYPCLNG  242 (358)
T ss_pred             chhHHHHHHHHHHcCCCHHHeEEEeCCCCCceeCCCC
Confidence            4579999999999999999999999999999997654


No 9  
>PF00704 Glyco_hydro_18:  Glycosyl hydrolases family 18;  InterPro: IPR001223 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Some members of this family, GH18 from CAZY, belong to the chitinase class II group which includes chitinase, chitodextrinase and the killer toxin of Kluyveromyces lactis. The chitinases hydrolyse chitin oligosaccharides. The family also includes various glycoproteins from mammals; cartilage glycoprotein and the oviduct-specific glycoproteins are two examples.; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 1ITX_A 3ALG_A 3ALF_A 1NAR_A 3QOK_A 3G6L_A 3G6M_A 2DT1_A 2B31_A 2O92_A ....
Probab=99.17  E-value=4.6e-11  Score=79.44  Aligned_cols=57  Identities=42%  Similarity=0.696  Sum_probs=46.8

Q ss_pred             CCCCCCCCCCCCCcCccccHHHHHHHHHHcCCCCCceEEEeccceeeeeecCCCCCCCCC
Q psy1033           1 PNAPLYPAVTDQGYFKSLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDSTDYGM   60 (67)
Q Consensus         1 ~~apL~~~~~~~~~~~~~n~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~l~~~~~~~~g~   60 (67)
                      |++||+....+   ...++++.+|++|++.|+|++||+||+|+|||.|++.....+...+
T Consensus       204 ~~~~l~~~~~~---~~~~~~~~~v~~~~~~g~p~~Kl~lglp~yg~~~~~~~~~~~~~~~  260 (343)
T PF00704_consen  204 PNAPLYDSSWD---SNYYSVDSAVQYWIKAGVPPSKLVLGLPFYGRSWTLVNGSPNGPWG  260 (343)
T ss_dssp             TSSSSSHTTTS---GTSSSHHHHHHHHHHTTSTGGGEEEEEESEEEEEESSSSTTSTTTB
T ss_pred             cccccccCCcc---CCCceeeeehhhhccccCChhheeecCCcccccceecCCcCCCCCC
Confidence            46777766543   1368999999999999999999999999999999999876655444


No 10 
>cd02876 GH18_SI-CLP Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome.  SI-CLP has a glycosyl hydrolase family 18 (GH18) domain but lacks a chitin-binding domain. The catalytic amino acids of the GH18 domain are not conserved in SI-CLP, similar to the chitolectins YKL-39, YKL-40, and YM1/2.  Human SI-CLP is sorted to late endosomes and secretory lysosomes in alternatively activated macrophages.
Probab=99.08  E-value=5.9e-11  Score=79.70  Aligned_cols=35  Identities=31%  Similarity=0.416  Sum_probs=32.1

Q ss_pred             ccHHHHHHHHHHcC-CCCCceEEEeccceeeeeecC
Q psy1033          18 LNANWSVNYYLYKG-IPANKLLLGLPTYGHSYTLVN   52 (67)
Q Consensus        18 ~n~~~~v~~~~~~G-~~~~KlvlGv~~yGr~~~l~~   52 (67)
                      ..++.+|++|++.| +|++|||||||||||.|++.+
T Consensus       202 ~~v~~~v~~~~~~~~vp~~KlvlGip~YG~~w~~~~  237 (318)
T cd02876         202 SWVRSCLELLLPESGKKRAKILLGLNFYGNDYTLPG  237 (318)
T ss_pred             HHHHHHHHHHHhcCCCCHHHeEEeccccccccccCC
Confidence            36999999999997 999999999999999998864


No 11 
>COG3325 ChiA Chitinase [Carbohydrate transport and metabolism]
Probab=99.08  E-value=1.8e-10  Score=80.87  Aligned_cols=55  Identities=25%  Similarity=0.385  Sum_probs=41.2

Q ss_pred             CCCCCCCCCCCCCc-CccccHHH------HHHHHHHcCCCCCceEEEeccceeeeeecCCCC
Q psy1033           1 PNAPLYPAVTDQGY-FKSLNANW------SVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDS   55 (67)
Q Consensus         1 ~~apL~~~~~~~~~-~~~~n~~~------~v~~~~~~G~~~~KlvlGv~~yGr~~~l~~~~~   55 (67)
                      ||||||..+.|+.. +..+.++.      .++.....++|++|||||+|||||+|..++...
T Consensus       263 h~a~Ly~~~~d~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~klvlG~p~YgRgw~~v~~~~  324 (441)
T COG3325         263 HHAALYGTPKDPPLANGGFYVDAEVDGIDWLEEGFAGDVPPSKLVLGMPFYGRGWNGVDGGS  324 (441)
T ss_pred             cccccccCCCCCccccCCeeEEEEechhHHHHhhhccCCCCceEEeeccccccccccccCcc
Confidence            89999998887654 22233332      455566678888999999999999999988644


No 12 
>cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas.
Probab=98.71  E-value=8.7e-09  Score=67.36  Aligned_cols=33  Identities=36%  Similarity=0.669  Sum_probs=30.0

Q ss_pred             ccHHHHHHHHHHcCC-CCCceEEEeccceeeeee
Q psy1033          18 LNANWSVNYYLYKGI-PANKLLLGLPTYGHSYTL   50 (67)
Q Consensus        18 ~n~~~~v~~~~~~G~-~~~KlvlGv~~yGr~~~l   50 (67)
                      ..++.+|++|++.|+ |++||+||+|+|||.|+.
T Consensus       181 ~~~~~~v~~~~~~g~ip~~KlvlGlp~YG~~w~~  214 (253)
T cd06545         181 DDAVNDLNYWNERGLASKDKLVLGLPFYGYGFYY  214 (253)
T ss_pred             HhHHHHHHHHHHcCCCCHHHEEEEeCCccccccC
Confidence            358889999999998 999999999999999953


No 13 
>cd02874 GH18_CFLE_spore_hydrolase Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in  bacterial endospore germination.  CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells.  SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore.  As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex.  CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains.  In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
Probab=98.42  E-value=1.2e-07  Score=63.46  Aligned_cols=33  Identities=36%  Similarity=0.662  Sum_probs=28.1

Q ss_pred             cHHHHHHHHHHcCCCCCceEEEeccceeeeeecC
Q psy1033          19 NANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVN   52 (67)
Q Consensus        19 n~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~l~~   52 (67)
                      .++..+++++ .|+|++||+||||+|||.|++..
T Consensus       194 ~~~~~~~~~~-~gvp~~KlvlGip~YG~~w~~~~  226 (313)
T cd02874         194 WVERVLQYAV-TQIPREKILLGIPLYGYDWTLPY  226 (313)
T ss_pred             HHHHHHHHHH-hcCCHHHEEEeecccccccccCC
Confidence            4667777665 89999999999999999999864


No 14 
>cd06549 GH18_trifunctional GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
Probab=98.19  E-value=9.7e-07  Score=59.15  Aligned_cols=32  Identities=25%  Similarity=0.385  Sum_probs=25.2

Q ss_pred             HHHHHHHHHHcCCCCCceEEEeccceeeeeecC
Q psy1033          20 ANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVN   52 (67)
Q Consensus        20 ~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~l~~   52 (67)
                      ++..+++. ..|+|++||+||||+|||.|++..
T Consensus       187 ~~~~~~~~-~~~vp~~KlvlGip~YG~~w~~~~  218 (298)
T cd06549         187 FESNLAQA-VKKLPPEKLIVALGSYGYDWTKGG  218 (298)
T ss_pred             HHHHHHHH-HhCCCHHHEEEEecccCccccCCC
Confidence            33445543 478999999999999999998754


No 15 
>COG3858 Predicted glycosyl hydrolase [General function prediction only]
Probab=96.67  E-value=0.0007  Score=48.03  Aligned_cols=33  Identities=36%  Similarity=0.656  Sum_probs=26.4

Q ss_pred             HHHHHHHHHHcCCCCCceEEEeccceeeeeecCC
Q psy1033          20 ANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNP   53 (67)
Q Consensus        20 ~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~l~~~   53 (67)
                      |...+++-+. -+|++||+||||+||+.|.+...
T Consensus       299 vr~~ieya~T-~iP~~Kv~mGip~YGYDW~~~y~  331 (423)
T COG3858         299 VRKVIEYALT-VIPAEKVMMGIPLYGYDWTLPYD  331 (423)
T ss_pred             Hhhhhhhhhe-ecchHHeEEccccccccccCCCC
Confidence            4555665555 49999999999999999998654


No 16 
>cd06544 GH18_narbonin Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L.) cotyledons with unknown function.  Narbonin has a glycosyl hydrolase family 18 (GH18) domain without the conserved catalytic residues and with no known enzymatic activity.  Narbonin amounts to up to 3% of the total seed globulins of mature seeds and was thought to be a storage protein but was found to degrade too slowly during germination.  This family also includes the VfNOD32 nodulin from Vicia faba.
Probab=92.54  E-value=0.15  Score=33.82  Aligned_cols=31  Identities=23%  Similarity=0.315  Sum_probs=23.4

Q ss_pred             cHHHHHHHHHH--cCCCCCceEEEeccceeeee
Q psy1033          19 NANWSVNYYLY--KGIPANKLLLGLPTYGHSYT   49 (67)
Q Consensus        19 n~~~~v~~~~~--~G~~~~KlvlGv~~yGr~~~   49 (67)
                      +++.-++.|.+  +++|++||++|+|++++.|.
T Consensus       190 ~~~~~~~~~~~~~~~~p~~Kv~lGl~a~~~~~~  222 (253)
T cd06544         190 TVAKYVEFYDEVANNYPGKKVLASFSTDGEDGA  222 (253)
T ss_pred             CHHHHHHHHHHHHhCCCcccEEEEEecCCCccC
Confidence            44444455433  47999999999999999986


No 17 
>PF08869 XisI:  XisI protein;  InterPro: IPR014968 The fdxN element, along with two other DNA elements, is excised from the chromosome during heterocyst differentiation in cyanobacteria. The xisH as well as the xisF and xisI genes are required []. ; PDB: 3D7Q_A 2NWV_A 2NVM_A 2NLV_B.
Probab=90.89  E-value=0.11  Score=30.98  Aligned_cols=28  Identities=21%  Similarity=0.368  Sum_probs=19.2

Q ss_pred             HHHHHHHHcCCCCCceEEEecc-ceeeee
Q psy1033          22 WSVNYYLYKGIPANKLLLGLPT-YGHSYT   49 (67)
Q Consensus        22 ~~v~~~~~~G~~~~KlvlGv~~-yGr~~~   49 (67)
                      ...+.++++|+|++.||||+-- +-|-|+
T Consensus        78 gIa~eLve~GVpk~dIVLgF~~P~~R~~T  106 (111)
T PF08869_consen   78 GIAEELVEAGVPKEDIVLGFHPPEVRQYT  106 (111)
T ss_dssp             HHHHHHHHTT--GGGEEETTS-GGGGCCS
T ss_pred             HHHHHHHHcCCCHHHEEEccCCccccccc
Confidence            4456789999999999999743 556554


No 18 
>cd06546 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii.  CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.
Probab=82.90  E-value=1.5  Score=29.05  Aligned_cols=21  Identities=19%  Similarity=0.414  Sum_probs=17.6

Q ss_pred             HHHHHHHcCCCCCceEEEecc
Q psy1033          23 SVNYYLYKGIPANKLLLGLPT   43 (67)
Q Consensus        23 ~v~~~~~~G~~~~KlvlGv~~   43 (67)
                      ....|++.+++++||++|+|+
T Consensus       197 ~~~~~~~~~~~~~Kv~iGlpa  217 (256)
T cd06546         197 DYDAIVAQGWDPERIVIGLLT  217 (256)
T ss_pred             HHHHHHHcCCCcccEEEEEec
Confidence            345577789999999999997


No 19 
>cd02871 GH18_chitinase_D-like GH18 domain of Chitinase D (ChiD).  ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins.  The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain.  This family includes exochitinase Chi36 from Bacillus cereus.
Probab=82.76  E-value=1.3  Score=29.92  Aligned_cols=13  Identities=46%  Similarity=1.063  Sum_probs=12.3

Q ss_pred             CCCCceEEEeccc
Q psy1033          32 IPANKLLLGLPTY   44 (67)
Q Consensus        32 ~~~~KlvlGv~~y   44 (67)
                      +|++||+||+|+.
T Consensus       236 ~p~~Kv~iG~pa~  248 (312)
T cd02871         236 LPADKVVIGLPAS  248 (312)
T ss_pred             CChhhEEEeccCC
Confidence            8999999999997


No 20 
>KOG2091|consensus
Probab=81.14  E-value=1.2  Score=31.32  Aligned_cols=32  Identities=25%  Similarity=0.342  Sum_probs=24.0

Q ss_pred             HHHHHHHHHHcCCCCCceEEEeccceeeeeec
Q psy1033          20 ANWSVNYYLYKGIPANKLLLGLPTYGHSYTLV   51 (67)
Q Consensus        20 ~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~l~   51 (67)
                      ++.+++...-....+.||.+|+.|||.-|.+.
T Consensus       278 i~~~l~~l~~~s~~r~KiLlGlNFYG~d~~~g  309 (392)
T KOG2091|consen  278 IRHCLHHLGGSSAKRPKILLGLNFYGNDFNLG  309 (392)
T ss_pred             HHHHHHHhCCccccccceeEeeeccccccccC
Confidence            45555555444556799999999999999873


No 21 
>cd08345 Fosfomycin_RP Fosfomycin resistant protein; inhibits the biological function of fosfomycin. This family contains three types of fosfomycin resistant protein. Fosfomycin inhibits the enzyme UDP-N-acetylglucosamine-3-enolpyruvyltransferase (MurA), which catalyzes the first committed step in bacterial cell wall biosynthesis. The three types of fosfomycin resistance proteins, employ different mechanisms to render fosfomycin [(1R,2S)-epoxypropylphosphonic acid] inactive. FosB catalyzes the addition of L-cysteine to the epoxide ring of fosfomycin. FosX catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1. FosA catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive. Catalytic activities of both FosX and FosA are Mn(II)-dependent, but FosB is activated by Mg(II). Fosfomycin resistant proteins are evolutionarily related to glyoxalase I and type I extradiol dioxygenases.
Probab=64.49  E-value=10  Score=20.61  Aligned_cols=39  Identities=13%  Similarity=0.035  Sum_probs=27.9

Q ss_pred             cHHHHHHHHHHcCCCCCceEEEeccceeeeeecCCCCCC
Q psy1033          19 NANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDSTD   57 (67)
Q Consensus        19 n~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~l~~~~~~~   57 (67)
                      +++..++.+.++|++..........++|.+...+++.+.
T Consensus        67 d~~~~~~~l~~~G~~~~~~~~~~~~~~~~~~~~DPdG~~  105 (113)
T cd08345          67 EFDEYTERLKALGVEMKPERPRVQGEGRSIYFYDPDGHL  105 (113)
T ss_pred             HHHHHHHHHHHcCCccCCCccccCCCceEEEEECCCCCE
Confidence            567788888999998665444455678888887775443


No 22 
>PRK00040 rpsP 30S ribosomal protein S16; Reviewed
Probab=55.07  E-value=6.2  Score=21.83  Aligned_cols=21  Identities=24%  Similarity=0.427  Sum_probs=15.9

Q ss_pred             cccHHHHHHHHHHcCCCCCceE
Q psy1033          17 SLNANWSVNYYLYKGIPANKLL   38 (67)
Q Consensus        17 ~~n~~~~v~~~~~~G~~~~Klv   38 (67)
                      .+|.+. +++|++.|+.+.+-|
T Consensus        51 ~ln~er-i~~Wl~~GAqpt~~V   71 (75)
T PRK00040         51 KLDEER-VLYWLGQGAQPTDTV   71 (75)
T ss_pred             EEcHHH-HHHHHHCCCccCHHH
Confidence            456655 899999999886543


No 23 
>TIGR00002 S16 ribosomal protein S16. This model describes ribosomal S16 of bacteria and organelles.
Probab=52.84  E-value=6.9  Score=21.81  Aligned_cols=21  Identities=29%  Similarity=0.569  Sum_probs=16.2

Q ss_pred             cccHHHHHHHHHHcCCCCCceE
Q psy1033          17 SLNANWSVNYYLYKGIPANKLL   38 (67)
Q Consensus        17 ~~n~~~~v~~~~~~G~~~~Klv   38 (67)
                      .++.+. +++|++.|+.+.+-|
T Consensus        48 ~l~~~r-i~~Wl~~GAqps~tV   68 (78)
T TIGR00002        48 KLNVER-IKYWLSKGAQPTDTV   68 (78)
T ss_pred             EEcHHH-HHHHHHCCCccCHHH
Confidence            456655 899999999887644


No 24 
>PF02126 PTE:  Phosphotriesterase family;  InterPro: IPR001559 Synonym(s): Paraoxonase, A-esterase, Aryltriphosphatase, Phosphotriesterase, Paraoxon hydrolase  Bacteria such as Brevundimonas diminuta (Pseudomonas diminuta) harbour a plasmid that carries the gene for Aryldialkylphosphatase (3.1.8.1 from EC) (PTE) (also known as parathion hydrolase). This enzyme has attracted interest because of its potential use in the detoxification of chemical waste and warfare agents and its ability to degrade agricultural pesticides such as parathion. It acts specifically on synthetic organophosphate triesters and phosphorofluoridates. It does not seem to have a natural occuring substrate and may thus have optimally evolved for utilizing paraoxon. Aryldialkylphosphatase belongs to a family [, ] of enzymes that possess a binuclear zinc metal centre at their active site. The two zinc ions are coordinated by six different residues, six of which being histidines. This family so far includes, in addition to the parathion hydrolase, the following proteins:    Escherichia coli protein Php, the substrate of which is not yet known.  Mycobacterium tuberculosis phosphotriesterase homology protein Rv0230C. Mammalian phosphotriesterase related protein (PTER) (RPR-1).  ; GO: 0008270 zinc ion binding, 0016788 hydrolase activity, acting on ester bonds, 0009056 catabolic process; PDB: 3MSR_A 3OVG_D 3K2G_C 1BF6_B 3OQE_A 3C86_A 3SO7_A 2D2G_A 2R1P_A 2D2H_A ....
Probab=51.89  E-value=9.7  Score=26.08  Aligned_cols=24  Identities=8%  Similarity=0.166  Sum_probs=18.3

Q ss_pred             cHHHHHHHHHHcCCCCCceEEEec
Q psy1033          19 NANWSVNYYLYKGIPANKLLLGLP   42 (67)
Q Consensus        19 n~~~~v~~~~~~G~~~~KlvlGv~   42 (67)
                      .....++.+.+.|++++|+++|--
T Consensus       168 ~~~e~~~il~e~Gv~~~rvvigH~  191 (308)
T PF02126_consen  168 MGLEQLDILEEEGVDPSRVVIGHM  191 (308)
T ss_dssp             CHHHHHHHHHHTT--GGGEEETSG
T ss_pred             CHHHHHHHHHHcCCChhHeEEeCC
Confidence            356778999999999999999853


No 25 
>KOG3419|consensus
Probab=51.46  E-value=24  Score=21.04  Aligned_cols=22  Identities=23%  Similarity=0.400  Sum_probs=17.5

Q ss_pred             cccHHHHHHHHHHcCCCCCceEE
Q psy1033          17 SLNANWSVNYYLYKGIPANKLLL   39 (67)
Q Consensus        17 ~~n~~~~v~~~~~~G~~~~Klvl   39 (67)
                      .+|.|. ++||+..|+.+++-+.
T Consensus        53 ~Ln~dR-ikyWl~~GAqpS~tv~   74 (112)
T KOG3419|consen   53 ALNFDR-IKYWLGVGAQPSDTVE   74 (112)
T ss_pred             eecHHH-HHHHHhcCCccChHHH
Confidence            567765 9999999998877654


No 26 
>PRK14522 rpsP 30S ribosomal protein S16; Provisional
Probab=51.14  E-value=15  Score=22.11  Aligned_cols=21  Identities=19%  Similarity=0.381  Sum_probs=16.2

Q ss_pred             cccHHHHHHHHHHcCCCCCceE
Q psy1033          17 SLNANWSVNYYLYKGIPANKLL   38 (67)
Q Consensus        17 ~~n~~~~v~~~~~~G~~~~Klv   38 (67)
                      .+|.+. |++|++.|+.+..-|
T Consensus        49 ~Ln~eR-i~yWL~~GAqPS~tV   69 (116)
T PRK14522         49 QLKSER-IFYWLNQGAELTEKA   69 (116)
T ss_pred             EECHHH-HHHHHHCCCccCHHH
Confidence            456665 999999999887544


No 27 
>cd06542 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain.  Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522).  Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and  EndoH from Flavobacterium meningosepticum, and  EndoE from Enterococcus faecalis.  EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues.  EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.
Probab=50.43  E-value=7.3  Score=25.19  Aligned_cols=20  Identities=15%  Similarity=0.087  Sum_probs=17.0

Q ss_pred             HcCCCCCceEEEeccceeee
Q psy1033          29 YKGIPANKLLLGLPTYGHSY   48 (67)
Q Consensus        29 ~~G~~~~KlvlGv~~yGr~~   48 (67)
                      ..|+|++|+++|++|++...
T Consensus       191 ~~g~~~~k~i~~~~~~~~~~  210 (255)
T cd06542         191 SPKIPPEKMVYTESFEEENG  210 (255)
T ss_pred             cCCCCHHHceeeeeeecccC
Confidence            45899999999999997654


No 28 
>CHL00005 rps16 ribosomal protein S16
Probab=49.53  E-value=8  Score=21.79  Aligned_cols=21  Identities=29%  Similarity=0.431  Sum_probs=16.4

Q ss_pred             cccHHHHHHHHHHcCCCCCceE
Q psy1033          17 SLNANWSVNYYLYKGIPANKLL   38 (67)
Q Consensus        17 ~~n~~~~v~~~~~~G~~~~Klv   38 (67)
                      .+|.+. +++|++.|+.+..-|
T Consensus        47 ~ln~er-i~~Wl~~GAqpt~tV   67 (82)
T CHL00005         47 YLNVPA-ILYFLEKGAQPTETV   67 (82)
T ss_pred             EEeHHH-HHHHHHCcCccCHHH
Confidence            567665 999999999887644


No 29 
>PRK14520 rpsP 30S ribosomal protein S16; Provisional
Probab=49.14  E-value=15  Score=23.18  Aligned_cols=22  Identities=18%  Similarity=0.453  Sum_probs=16.8

Q ss_pred             cccHHHHHHHHHHcCCCCCceEE
Q psy1033          17 SLNANWSVNYYLYKGIPANKLLL   39 (67)
Q Consensus        17 ~~n~~~~v~~~~~~G~~~~Klvl   39 (67)
                      .+|.+. ++|||..|+.+..-|.
T Consensus        50 ~ln~eR-i~yWL~~GAQPT~~V~   71 (155)
T PRK14520         50 EIDSER-AQYWLSVGAQPTEPVL   71 (155)
T ss_pred             EEcHHH-HHHHHHCCCccCHHHH
Confidence            456665 8999999998876554


No 30 
>PRK14525 rpsP 30S ribosomal protein S16; Provisional
Probab=47.94  E-value=8.7  Score=21.94  Aligned_cols=21  Identities=14%  Similarity=0.322  Sum_probs=16.3

Q ss_pred             cccHHHHHHHHHHcCCCCCceE
Q psy1033          17 SLNANWSVNYYLYKGIPANKLL   38 (67)
Q Consensus        17 ~~n~~~~v~~~~~~G~~~~Klv   38 (67)
                      .+|.+. +++|+++|+.+..-|
T Consensus        50 ~ln~er-i~~WL~~GAqpT~tV   70 (88)
T PRK14525         50 ELKVER-IEHWLKAGAKPSQTV   70 (88)
T ss_pred             EEcHHH-HHHHHHCCCccCHHH
Confidence            456665 999999999887654


No 31 
>PF06940 DUF1287:  Domain of unknown function (DUF1287);  InterPro: IPR009706 This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown.
Probab=47.90  E-value=13  Score=23.55  Aligned_cols=39  Identities=18%  Similarity=0.295  Sum_probs=33.4

Q ss_pred             CccccHHHHHHHHHHcCCCCCceE-----EEeccceeeeeecCC
Q psy1033          15 FKSLNANWSVNYYLYKGIPANKLL-----LGLPTYGHSYTLVNP   53 (67)
Q Consensus        15 ~~~~n~~~~v~~~~~~G~~~~Klv-----lGv~~yGr~~~l~~~   53 (67)
                      .....+|=.++.+.++|++.+|+|     --+..|-|.|.|..+
T Consensus        32 ~~GVCTDVViRA~R~~g~DLq~lVheDm~~nf~~Yp~~wgl~~p   75 (164)
T PF06940_consen   32 NTGVCTDVVIRAYRDAGYDLQKLVHEDMKANFSAYPRIWGLKRP   75 (164)
T ss_pred             CCCccHHHHHHHHHHcCCCHHHHHHHHHHHCHHhCCcccCCCCC
Confidence            457899999999999999999987     467889999987764


No 32 
>PF13606 Ank_3:  Ankyrin repeat
Probab=47.89  E-value=25  Score=15.48  Aligned_cols=14  Identities=36%  Similarity=0.401  Sum_probs=11.7

Q ss_pred             HHHHHHHHcCCCCC
Q psy1033          22 WSVNYYLYKGIPAN   35 (67)
Q Consensus        22 ~~v~~~~~~G~~~~   35 (67)
                      +.|+++++.|++.+
T Consensus        16 e~v~~Ll~~gadvn   29 (30)
T PF13606_consen   16 EIVKYLLEHGADVN   29 (30)
T ss_pred             HHHHHHHHcCCCCC
Confidence            56999999998865


No 33 
>PF03688 Nepo_coat_C:  Nepovirus coat protein, C-terminal domain;  InterPro: IPR005305 This domain oocurs within nepoviruses. Together with comoviruses and picornaviruses, nepoviruses are classified in the picornavirus superfamily of plus strand single-stranded RNA viruses. This domain aligns several nepovirus coat protein sequences. In several cases, this is found at the C terminus of the RNA2-encoded viral polyprotein. The coat protein consists of three trapezoid-shaped beta-barrel domains, and forms a pseudo T = 3 icosahedral capsid structure [].; GO: 0019028 viral capsid; PDB: 2YI3_L 2Y7U_L 2Y7V_T 2Y7T_D 2YI4_P 2YI2_Q 2Y26_H 1A6C_A.
Probab=45.40  E-value=6.6  Score=24.67  Aligned_cols=8  Identities=50%  Similarity=0.962  Sum_probs=5.8

Q ss_pred             Eeccceee
Q psy1033          40 GLPTYGHS   47 (67)
Q Consensus        40 Gv~~yGr~   47 (67)
                      |+.||||+
T Consensus       156 GF~FYGRS  163 (163)
T PF03688_consen  156 GFEFYGRS  163 (163)
T ss_dssp             TEEEEEE-
T ss_pred             CceEeCCC
Confidence            58889986


No 34 
>PRK14524 rpsP 30S ribosomal protein S16; Provisional
Probab=43.96  E-value=11  Score=21.82  Aligned_cols=22  Identities=9%  Similarity=0.220  Sum_probs=16.7

Q ss_pred             cccHHHHHHHHHHcCCCCCceEE
Q psy1033          17 SLNANWSVNYYLYKGIPANKLLL   39 (67)
Q Consensus        17 ~~n~~~~v~~~~~~G~~~~Klvl   39 (67)
                      .+|.+. +++|++.|+.+.+-|.
T Consensus        49 ~l~~er-i~~Wl~~GAqpT~tV~   70 (94)
T PRK14524         49 KVDVER-AVEWILKGAQPSDTVR   70 (94)
T ss_pred             EEcHHH-HHHHHHcCCccCHHHH
Confidence            456654 8999999998876553


No 35 
>PRK14521 rpsP 30S ribosomal protein S16; Provisional
Probab=43.79  E-value=21  Score=23.14  Aligned_cols=31  Identities=19%  Similarity=0.326  Sum_probs=21.3

Q ss_pred             cccHHHHHHHHHHcCCCCCceEEEeccceeee
Q psy1033          17 SLNANWSVNYYLYKGIPANKLLLGLPTYGHSY   48 (67)
Q Consensus        17 ~~n~~~~v~~~~~~G~~~~KlvlGv~~yGr~~   48 (67)
                      .+|.+. |++||..|+.+..-|.-|=-....|
T Consensus        50 ~Ln~eR-i~~WL~~GAqPTdtV~~lL~~~g~~   80 (186)
T PRK14521         50 DLNFDR-AVYWLMNGAQPTDTARNILSYEGVL   80 (186)
T ss_pred             EEcHHH-HHHHHHCCCcCCHHHHHHHHHcccc
Confidence            567765 8999999999887665444333333


No 36 
>TIGR00250 RNAse_H_YqgF RNAse H-fold protein YqgF. This protein family, which exhibits an RNAse H fold in crystal structure, has been proposed as a putative Holliday junction resolvase, an alternate to RuvC.
Probab=42.88  E-value=29  Score=20.70  Aligned_cols=22  Identities=23%  Similarity=0.407  Sum_probs=16.6

Q ss_pred             HHHHHHHHcCCCCCceEEEeccc
Q psy1033          22 WSVNYYLYKGIPANKLLLGLPTY   44 (67)
Q Consensus        22 ~~v~~~~~~G~~~~KlvlGv~~y   44 (67)
                      ..+..+++. ..+++||+|+|.-
T Consensus        38 ~~l~~~i~~-~~~~~iVvGlP~~   59 (130)
T TIGR00250        38 SRIEELLKE-WTPDKIVVGLPLN   59 (130)
T ss_pred             HHHHHHHHH-cCCCEEEEeccCC
Confidence            456666666 5679999999974


No 37 
>KOG4465|consensus
Probab=42.38  E-value=41  Score=24.56  Aligned_cols=40  Identities=13%  Similarity=0.329  Sum_probs=29.3

Q ss_pred             cccHHHHHHHHHHc-CCC-CCceEEEeccceeeeeecCCCCCCC
Q psy1033          17 SLNANWSVNYYLYK-GIP-ANKLLLGLPTYGHSYTLVNPDSTDY   58 (67)
Q Consensus        17 ~~n~~~~v~~~~~~-G~~-~~KlvlGv~~yGr~~~l~~~~~~~~   58 (67)
                      ...-..+++.|.++ +++ ++-||+++..|+  |+.+++++.|+
T Consensus       535 eihp~~aik~yrea~~i~dakliv~amqa~d--~siadp~dagm  576 (598)
T KOG4465|consen  535 EIHPAEAIKEYREAMDIHDAKLIVCAMQAND--FSIADPDDAGM  576 (598)
T ss_pred             ccCHHHHHHHHHHhcCCCcceEEEEEeecCC--ceecCcccccc
Confidence            34556788888775 777 556778888887  77888777765


No 38 
>cd07240 ED_TypeI_classII_N N-terminal domain of type I, class II extradiol dioxygenases; non-catalytic domain. This family contains the N-terminal, non-catalytic, domain of type I, class II extradiol dioxygenases. Dioxygenases catalyze the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms, resulting in the cleavage of aromatic rings. Two major groups of dioxygenases have been identified according to the cleavage site; extradiol enzymes cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon, whereas intradiol enzymes cleave the aromatic ring between two hydroxyl groups. Extradiol dioxygenases are classified into type I and type II enzymes. Type I extradiol dioxygenases include class I and class II enzymes. These two classes of enzymes show sequence similarity; the two-domain class II enzymes evolved from a class I enzyme through gene duplication. The extradiol dioxygenases represented in this fa
Probab=42.11  E-value=27  Score=18.88  Aligned_cols=39  Identities=13%  Similarity=0.113  Sum_probs=27.6

Q ss_pred             cHHHHHHHHHHcCCCCCceEEEeccceeeeeecCCCCCC
Q psy1033          19 NANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDSTD   57 (67)
Q Consensus        19 n~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~l~~~~~~~   57 (67)
                      .++...+.+.+.|+........-+.+++.+...++..+.
T Consensus        70 ~v~~~~~~l~~~g~~~~~~~~~~~~~~~~~~~~DP~G~~  108 (117)
T cd07240          70 DLEALAAHLEAAGVAPEEASDPEPGVGRGLRFQDPDGHL  108 (117)
T ss_pred             HHHHHHHHHHHcCCceEEcCccCCCCceEEEEECCCCCE
Confidence            567778888888987655444456678888888876543


No 39 
>PF07519 Tannase:  Tannase and feruloyl esterase;  InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ]. It also includes several bacterial homologues of unknown function.
Probab=37.86  E-value=46  Score=24.12  Aligned_cols=24  Identities=13%  Similarity=0.169  Sum_probs=21.0

Q ss_pred             cccHHHHHHHHHHcCCCCCceEEE
Q psy1033          17 SLNANWSVNYYLYKGIPANKLLLG   40 (67)
Q Consensus        17 ~~n~~~~v~~~~~~G~~~~KlvlG   40 (67)
                      .++.-.++..|+|.|..|+.|+.-
T Consensus       413 ~~d~l~aL~~WVE~G~AP~~l~at  436 (474)
T PF07519_consen  413 PFDALTALVDWVENGKAPETLVAT  436 (474)
T ss_pred             CCCHHHHHHHHHhCCCCCCeeEEE
Confidence            568889999999999999998754


No 40 
>PRK09875 putative hydrolase; Provisional
Probab=37.77  E-value=32  Score=23.38  Aligned_cols=22  Identities=9%  Similarity=0.146  Sum_probs=18.6

Q ss_pred             HHHHHHHHcCCCCCceEEEecc
Q psy1033          22 WSVNYYLYKGIPANKLLLGLPT   43 (67)
Q Consensus        22 ~~v~~~~~~G~~~~KlvlGv~~   43 (67)
                      ..++...+.|++++|+++|-.-
T Consensus       167 e~l~il~e~Gvd~~rvvi~H~d  188 (292)
T PRK09875        167 EQLALLQAHGVDLSRVTVGHCD  188 (292)
T ss_pred             HHHHHHHHcCcCcceEEEeCCC
Confidence            3477888999999999999874


No 41 
>PF02230 Abhydrolase_2:  Phospholipase/Carboxylesterase;  InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases.; GO: 0016787 hydrolase activity; PDB: 3U0V_A 1AUR_A 1AUO_B 1FJ2_B 3CN9_A 3CN7_A.
Probab=37.33  E-value=38  Score=21.12  Aligned_cols=21  Identities=19%  Similarity=0.338  Sum_probs=13.7

Q ss_pred             HHHHHHHHHHcCCCCCceEEE
Q psy1033          20 ANWSVNYYLYKGIPANKLLLG   40 (67)
Q Consensus        20 ~~~~v~~~~~~G~~~~KlvlG   40 (67)
                      ++..|+.+++.+++++||+|+
T Consensus        90 l~~li~~~~~~~i~~~ri~l~  110 (216)
T PF02230_consen   90 LDELIDEEVAYGIDPSRIFLG  110 (216)
T ss_dssp             HHHHHHHHHHTT--GGGEEEE
T ss_pred             HHHHHHHHHHcCCChhheehh
Confidence            455566677789999998864


No 42 
>cd07263 Glo_EDI_BRP_like_16 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=36.31  E-value=41  Score=17.92  Aligned_cols=39  Identities=13%  Similarity=0.121  Sum_probs=27.1

Q ss_pred             ccHHHHHHHHHHcCCCCCceEEEeccceeeeeecCCCCCC
Q psy1033          18 LNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDSTD   57 (67)
Q Consensus        18 ~n~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~l~~~~~~~   57 (67)
                      -+++..++..+++|++..+.... ..+++.+.+.++..+.
T Consensus        76 ~di~~~~~~l~~~g~~~~~~~~~-~~~~~~~~~~DP~G~~  114 (119)
T cd07263          76 DDIDATYEELKARGVEFSEEPRE-MPYGTVAVFRDPDGNL  114 (119)
T ss_pred             hHHHHHHHHHHhCCCEEeecccc-CCCceEEEEECCCCCE
Confidence            46888888899999866554422 3467888888876443


No 43 
>cd02877 GH18_hevamine_XipI_class_III This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi.  PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
Probab=36.05  E-value=44  Score=22.53  Aligned_cols=25  Identities=28%  Similarity=0.376  Sum_probs=18.1

Q ss_pred             HHHHHHHHHHcCCCC---CceEEEeccce
Q psy1033          20 ANWSVNYYLYKGIPA---NKLLLGLPTYG   45 (67)
Q Consensus        20 ~~~~v~~~~~~G~~~---~KlvlGv~~yG   45 (67)
                      .....+.|.+. ++.   .||+||+|..-
T Consensus       203 ~~~~~~~w~~~-~~~~~~~kv~lGlpas~  230 (280)
T cd02877         203 FNFNWDTWTSW-AKATSNAKVFLGLPASP  230 (280)
T ss_pred             hhhHHHHHHHh-cccCCCceEEEecccCC
Confidence            34556677765 555   89999999873


No 44 
>cd08354 Glo_EDI_BRP_like_13 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=35.33  E-value=58  Score=17.66  Aligned_cols=37  Identities=19%  Similarity=0.171  Sum_probs=25.6

Q ss_pred             cHHHHHHHHHHcCCCCCceEEEeccceeeeeecCCCCC
Q psy1033          19 NANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDST   56 (67)
Q Consensus        19 n~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~l~~~~~~   56 (67)
                      +++..++.+.++|+......- ....++.+.+.++..+
T Consensus        79 dl~~~~~~l~~~g~~~~~~~~-~~~~~~~~~~~DP~G~  115 (122)
T cd08354          79 ELAEWEAHLEAKGVAIESEVQ-WPRGGRSLYFRDPDGN  115 (122)
T ss_pred             HHHHHHHHHHhcCCceecccc-CCCCeeEEEEECCCCC
Confidence            577888888889986554332 3556788888776544


No 45 
>KOG1411|consensus
Probab=34.95  E-value=29  Score=25.01  Aligned_cols=23  Identities=26%  Similarity=0.312  Sum_probs=17.3

Q ss_pred             HHHHHHcCCCCCceEEEecccee
Q psy1033          24 VNYYLYKGIPANKLLLGLPTYGH   46 (67)
Q Consensus        24 v~~~~~~G~~~~KlvlGv~~yGr   46 (67)
                      |..-.+.--++.||+|||.+|--
T Consensus        42 VTeAfk~D~n~~KiNLgvGaYRd   64 (427)
T KOG1411|consen   42 VTEAFKKDPNPKKINLGVGAYRD   64 (427)
T ss_pred             HHHHHhcCCCcceeeecccceec
Confidence            33345566889999999999953


No 46 
>PRK00109 Holliday junction resolvase-like protein; Reviewed
Probab=34.77  E-value=45  Score=20.09  Aligned_cols=22  Identities=18%  Similarity=0.299  Sum_probs=15.4

Q ss_pred             HHHHHHHHcCCCCCceEEEeccc
Q psy1033          22 WSVNYYLYKGIPANKLLLGLPTY   44 (67)
Q Consensus        22 ~~v~~~~~~G~~~~KlvlGv~~y   44 (67)
                      ..+..+++. ...++||+|+|.-
T Consensus        44 ~~l~~~i~~-~~i~~iVvGlP~~   65 (138)
T PRK00109         44 DRLEKLIKE-WQPDGLVVGLPLN   65 (138)
T ss_pred             HHHHHHHHH-hCCCEEEEeccCC
Confidence            335555554 4679999999985


No 47 
>cd07247 SgaA_N_like N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains. SgaA suppresses the growth disturbances caused by high osmolarity and a high concentration of A-factor, a microbial hormone, during the early growth phase in Streptomyces griseus. A-factor (2-isocapryloyl-3R-hydroxymethyl-gamma-butyrolactone) controls morphological differentiation and secondary metabolism in Streptomyces griseus. It is a chemical signaling molecule that at a very low concentration acts as a switch for yellow pigment production, aerial mycelium formation, streptomycin production, and streptomycin resistance. The structure and amino acid sequence of SgaA are closely related to a group of antibiotics resistance proteins, including bleomycin resistance protein, mitomycin resistance protein, and fosfomycin resistance proteins. SgaA might also function as a strep
Probab=34.39  E-value=47  Score=17.94  Aligned_cols=40  Identities=10%  Similarity=0.049  Sum_probs=26.3

Q ss_pred             cccHHHHHHHHHHcCCCCCceEEEeccceeeeeecCCCCC
Q psy1033          17 SLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDST   56 (67)
Q Consensus        17 ~~n~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~l~~~~~~   56 (67)
                      .-+++...+.++++|+...+=..-.+.+++.+.+.++..+
T Consensus        69 v~di~~~~~~l~~~g~~~~~~~~~~~~~~~~~~~~DPdG~  108 (114)
T cd07247          69 VDDVDAAAARVEAAGGKVLVPPTDIPGVGRFAVFADPEGA  108 (114)
T ss_pred             eCCHHHHHHHHHHCCCEEEeCCcccCCcEEEEEEECCCCC
Confidence            3468888999999997432211223567788888777554


No 48 
>COG0228 RpsP Ribosomal protein S16 [Translation, ribosomal structure and biogenesis]
Probab=33.29  E-value=45  Score=19.06  Aligned_cols=19  Identities=21%  Similarity=0.434  Sum_probs=13.9

Q ss_pred             cccHHHHHHHHHHcCCCCCc
Q psy1033          17 SLNANWSVNYYLYKGIPANK   36 (67)
Q Consensus        17 ~~n~~~~v~~~~~~G~~~~K   36 (67)
                      .++. .-+.+|+++|+.+.-
T Consensus        50 ~l~~-eri~~Wl~~GAqpSd   68 (87)
T COG0228          50 KLDE-ERILYWLSQGAQPSD   68 (87)
T ss_pred             EEcH-HHHHHHHHcCCcccH
Confidence            3444 458999999998754


No 49 
>PF00886 Ribosomal_S16:  Ribosomal protein S16;  InterPro: IPR000307 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein S16 is one of the proteins from the small ribosomal subunit. It belongs to a family of ribosomal proteins which, on the basis of sequence similarities [], groups:   Eubacterial S16. Algal and plant chloroplast S16. Cyanelle S16.  Neurospora crassa mitochondrial S24 (cyt-21).  S16 proteins have about 100 amino-acid residues.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2Y14_P 3UZ6_S 2J02_P 1HNZ_P 3V26_P 3KNL_P 1N34_P 2J00_P 1HNW_P 3OHC_P ....
Probab=33.00  E-value=16  Score=19.34  Aligned_cols=17  Identities=35%  Similarity=0.626  Sum_probs=13.1

Q ss_pred             cccHHHHHHHHHHcCCCC
Q psy1033          17 SLNANWSVNYYLYKGIPA   34 (67)
Q Consensus        17 ~~n~~~~v~~~~~~G~~~   34 (67)
                      .++++. +++|++.|+.+
T Consensus        45 ~l~~er-i~~Wl~~GAqp   61 (62)
T PF00886_consen   45 KLNFER-IKYWLSKGAQP   61 (62)
T ss_dssp             EETHHH-HHHHHHTTEEE
T ss_pred             EeCHHH-HHHHHHcCcCC
Confidence            566665 89999999754


No 50 
>cd06587 Glo_EDI_BRP_like This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins. This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). Type I extradiol dioxygenases catalyze the incorporation of both atoms of molecular oxygen into aromatic substrates, which results in the cleavage of aromatic rings. They are key enzymes in the degradation of aromatic compounds. Type I extradiol dioxygenases include class I and class II enzymes. Class I and II enzymes show sequence similarity; the two-domain clas
Probab=32.39  E-value=76  Score=16.15  Aligned_cols=38  Identities=13%  Similarity=0.026  Sum_probs=27.0

Q ss_pred             ccHHHHHHHHHHcCCCCCceEEEeccceeeeeecCCCC
Q psy1033          18 LNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDS   55 (67)
Q Consensus        18 ~n~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~l~~~~~   55 (67)
                      -+++..++.+.+.|+........-...++.+.+.++..
T Consensus        70 ~~~~~~~~~l~~~g~~~~~~~~~~~~~~~~~~~~Dp~G  107 (112)
T cd06587          70 DDVDAAYERLKAAGVEVLGEPREEPWGGRVAYFRDPDG  107 (112)
T ss_pred             CCHHHHHHHHHHcCCcccCCCcCCCCCcEEEEEECCCC
Confidence            46688888889988877655444556677888777653


No 51 
>COG0180 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=31.90  E-value=49  Score=23.02  Aligned_cols=23  Identities=17%  Similarity=0.160  Sum_probs=19.1

Q ss_pred             cccHHHHHHHHHHcCCCCCceEE
Q psy1033          17 SLNANWSVNYYLYKGIPANKLLL   39 (67)
Q Consensus        17 ~~n~~~~v~~~~~~G~~~~Klvl   39 (67)
                      ..++...+..|+..|++++|.++
T Consensus        62 ~~~~~e~~a~~LA~GiDP~k~~i   84 (314)
T COG0180          62 RQATREVAADYLAVGLDPEKSTI   84 (314)
T ss_pred             HHHHHHHHHHHHHhccCccccEE
Confidence            45677888899999999999665


No 52 
>PF14681 UPRTase:  Uracil phosphoribosyltransferase; PDB: 1V9S_B 1UPF_A 1UPU_D 1JLR_B 1BD4_A 1BD3_C 1JLS_D 1XTV_C 1XTU_H 3G6W_C ....
Probab=31.28  E-value=31  Score=22.01  Aligned_cols=27  Identities=11%  Similarity=0.161  Sum_probs=21.6

Q ss_pred             CccccHHHHHHHHHHcCCCCCceEEEe
Q psy1033          15 FKSLNANWSVNYYLYKGIPANKLLLGL   41 (67)
Q Consensus        15 ~~~~n~~~~v~~~~~~G~~~~KlvlGv   41 (67)
                      .+.-++-.+|+.+++.|++.++|++--
T Consensus       132 aTG~s~~~ai~~L~~~G~~~~~I~~v~  158 (207)
T PF14681_consen  132 ATGGSAIAAIEILKEHGVPEENIIIVS  158 (207)
T ss_dssp             SSSHHHHHHHHHHHHTTG-GGEEEEEE
T ss_pred             cchhhHHHHHHHHHHcCCCcceEEEEE
Confidence            346788899999999999999988753


No 53 
>PF00691 OmpA:  OmpA family;  InterPro: IPR006665 This entry represents domain with a beta/alpha/beta/alpha-beta(2) structure found in the C-terminal region of many Gram-negative bacterial outer membrane proteins [], such as porin-like integral membrane proteins (such as ompA) [], small lipid-anchored proteins (such as pal) [], and MotB proton channels []. The N-terminal half is variable although some of the proteins in this group have the OmpA-like transmembrane domain IPR000498 from INTERPRO at the N terminus. OmpA from Escherichia coli is required for pathogenesis, and can interact with host receptor molecules []. MotB (and MotA) serves two functions in E. coli, the MotA(4)-MotB(2) complex attaches to the cell wall via MotB to form the stator of the flagellar motor, and the MotA-MotB complex couples the flow of ions across the cell membrane to movement of the rotor [].; GO: 0009279 cell outer membrane; PDB: 1OAP_A 2W8B_G 2HQS_C 4ERH_A 2ZF8_A 2ZOV_A 2ZVZ_B 2ZVY_A 3TD4_B 3TD5_D ....
Probab=30.73  E-value=64  Score=17.33  Aligned_cols=19  Identities=21%  Similarity=0.485  Sum_probs=13.9

Q ss_pred             HHHHHHHHHcCCCCCceEE
Q psy1033          21 NWSVNYYLYKGIPANKLLL   39 (67)
Q Consensus        21 ~~~v~~~~~~G~~~~Klvl   39 (67)
                      +...+++++.|+++++|.+
T Consensus        57 ~~V~~~L~~~gi~~~ri~~   75 (97)
T PF00691_consen   57 EAVKQYLVENGIPPERISV   75 (97)
T ss_dssp             HHHHHHHHHTTSSGGGEEE
T ss_pred             HHHHHHHHHcCCChHhEEE
Confidence            3445666778999999954


No 54 
>PF06925 MGDG_synth:  Monogalactosyldiacylglycerol (MGDG) synthase;  InterPro: IPR009695 This entry represents a conserved region of approximately 180 residues found towirds the N terminus of a number of plant and bacterial diacylglycerol glucosyltransferases, such as monogalactosyldiacylglycerol synthase [].; GO: 0016758 transferase activity, transferring hexosyl groups, 0009247 glycolipid biosynthetic process
Probab=30.58  E-value=54  Score=19.84  Aligned_cols=24  Identities=21%  Similarity=0.522  Sum_probs=18.7

Q ss_pred             cHHHHHHHHHHcCCCCCceEE-Eec
Q psy1033          19 NANWSVNYYLYKGIPANKLLL-GLP   42 (67)
Q Consensus        19 n~~~~v~~~~~~G~~~~Klvl-Gv~   42 (67)
                      -.+.+-+.+++.|++++||.+ |||
T Consensus       144 ase~~~~~l~~~Gi~~~~I~vtGiP  168 (169)
T PF06925_consen  144 ASEEVKEELIERGIPPERIHVTGIP  168 (169)
T ss_pred             CCHHHHHHHHHcCCChhHEEEeCcc
Confidence            456778888999999999854 554


No 55 
>cd07238 Glo_EDI_BRP_like_5 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The structure of this family is a that of a strand-swapped dimer.
Probab=30.24  E-value=61  Score=17.49  Aligned_cols=40  Identities=10%  Similarity=0.077  Sum_probs=26.2

Q ss_pred             cccHHHHHHHHHHcCCCCCceEEEeccce-eeeeecCCCCCC
Q psy1033          17 SLNANWSVNYYLYKGIPANKLLLGLPTYG-HSYTLVNPDSTD   57 (67)
Q Consensus        17 ~~n~~~~v~~~~~~G~~~~KlvlGv~~yG-r~~~l~~~~~~~   57 (67)
                      ..+++..++.+.++|+...+-..-.+ +| |.+...+++.+.
T Consensus        65 v~d~~~~~~~l~~~G~~~~~~~~~~~-~g~~~~~~~DP~Gn~  105 (112)
T cd07238          65 VDDVDAALARAVAAGFAIVYGPTDEP-WGVRRFFVRDPFGKL  105 (112)
T ss_pred             eCCHHHHHHHHHhcCCeEecCCccCC-CceEEEEEECCCCCE
Confidence            45788999999999987433222223 45 777777776543


No 56 
>COG2103 Predicted sugar phosphate isomerase [General function prediction only]
Probab=29.95  E-value=88  Score=21.70  Aligned_cols=31  Identities=13%  Similarity=0.225  Sum_probs=26.7

Q ss_pred             ccHHHHHHHHHHcCCCCCceEEEeccceeee
Q psy1033          18 LNANWSVNYYLYKGIPANKLLLGLPTYGHSY   48 (67)
Q Consensus        18 ~n~~~~v~~~~~~G~~~~KlvlGv~~yGr~~   48 (67)
                      -+.+.+.+...+.++..+.+|+||+.-||+=
T Consensus       113 D~~~~g~~dl~~~~lt~~DvvvgIaASGrTP  143 (298)
T COG2103         113 DDEELGEADLKNIGLTAKDVVVGIAASGRTP  143 (298)
T ss_pred             ccHHHHHHHHHHcCCCcCCEEEEEecCCCCc
Confidence            3566777788899999999999999999984


No 57 
>cd02430 PTH2 Peptidyl-tRNA hydrolase, type 2 (PTH2). Peptidyl-tRNA hydrolase (PTH) activity releases tRNA from the premature translation termination product peptidyl-tRNA, therefore allowing the tRNA and peptide to be reused in protein synthesis. PTH2 is present in archaea and eukaryotes.
Probab=28.87  E-value=70  Score=18.84  Aligned_cols=21  Identities=14%  Similarity=0.189  Sum_probs=17.0

Q ss_pred             HHHHHHHHcCCCCCceEEEeccc
Q psy1033          22 WSVNYYLYKGIPANKLLLGLPTY   44 (67)
Q Consensus        22 ~~v~~~~~~G~~~~KlvlGv~~y   44 (67)
                      ..+++|.+.|  ..|+||.++--
T Consensus        39 ~~~~~W~~~G--~~KiVl~~~~~   59 (115)
T cd02430          39 ELLRAWEREG--QKKIVLKVNSE   59 (115)
T ss_pred             HHHHHHHhcC--CcEEEEecCCH
Confidence            4678999999  68999988753


No 58 
>TIGR00233 trpS tryptophanyl-tRNA synthetase. This model represents tryptophanyl-tRNA synthetase. Some members of the family have a pfam00458 domain amino-terminal to the region described by this model.
Probab=28.73  E-value=45  Score=22.96  Aligned_cols=24  Identities=13%  Similarity=-0.011  Sum_probs=19.8

Q ss_pred             cccHHHHHHHHHHcCCCCCceEEE
Q psy1033          17 SLNANWSVNYYLYKGIPANKLLLG   40 (67)
Q Consensus        17 ~~n~~~~v~~~~~~G~~~~KlvlG   40 (67)
                      ..++...+..|+..|++++|..+=
T Consensus        58 ~~~~~~~~~~~lA~GlDp~k~~if   81 (328)
T TIGR00233        58 RKAREELAADILAVGLDPKKTFIF   81 (328)
T ss_pred             HHHHHHHHHHHHHhCcChhheEEE
Confidence            456777788999999999998764


No 59 
>PRK14523 rpsP 30S ribosomal protein S16; Provisional
Probab=27.32  E-value=29  Score=21.48  Aligned_cols=21  Identities=14%  Similarity=0.297  Sum_probs=16.1

Q ss_pred             cccHHHHHHHHHHcCCCCCceE
Q psy1033          17 SLNANWSVNYYLYKGIPANKLL   38 (67)
Q Consensus        17 ~~n~~~~v~~~~~~G~~~~Klv   38 (67)
                      .+|++. |++|+..|+.+..-|
T Consensus        51 ~Ln~eR-i~yWL~~GAQPS~tV   71 (137)
T PRK14523         51 QLEKER-ISHWLNQGAQTSLRV   71 (137)
T ss_pred             EECHHH-HHHHHHCCCccCHHH
Confidence            456665 999999999887554


No 60 
>PF11054 Surface_antigen:  Sporozoite TA4 surface antigen;  InterPro: IPR021288  This family of proteins is a Eukaryotic family of surface antigens. One of the better characterised members of the family is the sporulated TA4 antigen. The TA4 gene encodes a single polypeptide of 25 kDa which contains a 17 and a 8kDa polypeptide []. 
Probab=27.28  E-value=66  Score=21.85  Aligned_cols=26  Identities=19%  Similarity=0.362  Sum_probs=21.5

Q ss_pred             ccccHHHHHHHHHHc-----CCCCCceEEEe
Q psy1033          16 KSLNANWSVNYYLYK-----GIPANKLLLGL   41 (67)
Q Consensus        16 ~~~n~~~~v~~~~~~-----G~~~~KlvlGv   41 (67)
                      .+-+.+.+|+||...     |+||.|-..+-
T Consensus       115 ~~~dCk~aVdYWKaafknF~glPPs~~~~~~  145 (254)
T PF11054_consen  115 EKPDCKEAVDYWKAAFKNFTGLPPSKTAANK  145 (254)
T ss_pred             CCCChHHHHHHHHHHHhhcCCCCCChhhccc
Confidence            467899999999885     89998877765


No 61 
>PF12681 Glyoxalase_2:  Glyoxalase-like domain; PDB: 3G12_B 1JIF_B 1JIE_B 1QTO_A 3OXH_A 2PJS_A 2RBB_A 3SK1_B 3SK2_B 3RRI_A ....
Probab=25.53  E-value=83  Score=16.62  Aligned_cols=40  Identities=13%  Similarity=0.027  Sum_probs=25.0

Q ss_pred             cccHHHHHHHHHHcCCCCCceEEEeccceeeeeecCCCCC
Q psy1033          17 SLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNPDST   56 (67)
Q Consensus        17 ~~n~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~l~~~~~~   56 (67)
                      ..+++...+.+.++|+....-..--+.-.|.+.+.++..+
T Consensus        64 v~dv~~~~~~l~~~G~~~~~~~~~~~~g~~~~~~~DPdG~  103 (108)
T PF12681_consen   64 VEDVDALYERLKELGAEIVTEPRDDPWGQRSFYFIDPDGN  103 (108)
T ss_dssp             ESHHHHHHHHHHHTTSEEEEEEEEETTSEEEEEEE-TTS-
T ss_pred             EcCHHHHHHHHHHCCCeEeeCCEEcCCCeEEEEEECCCCC
Confidence            3578999999999997643322223333388888776543


No 62 
>PF09288 UBA_3:  Fungal ubiquitin-associated domain ;  InterPro: IPR015368 This C-terminal domain is found in ubiquitin binding proteins, it adopts a structure consisting of a three alpha-helix bundle. This domain is predominantly found in fungi []. ; PDB: 1TTE_A.
Probab=25.47  E-value=15  Score=19.30  Aligned_cols=19  Identities=16%  Similarity=0.099  Sum_probs=11.6

Q ss_pred             HHHHHHHHcCCCCCceEEE
Q psy1033          22 WSVNYYLYKGIPANKLLLG   40 (67)
Q Consensus        22 ~~v~~~~~~G~~~~KlvlG   40 (67)
                      ..|+.+...|++.+|+|=.
T Consensus        11 ~lVd~F~~mGF~~dkVvev   29 (55)
T PF09288_consen   11 DLVDQFENMGFERDKVVEV   29 (55)
T ss_dssp             HHHHHHHHHT--HHHHHHH
T ss_pred             HHHHHHHHcCCcHHHHHHH
Confidence            3477777888887777633


No 63 
>KOG1017|consensus
Probab=25.18  E-value=1.1e+02  Score=20.52  Aligned_cols=26  Identities=15%  Similarity=0.205  Sum_probs=22.4

Q ss_pred             ccccHHHHHHHHHHcCCCCCceEEEe
Q psy1033          16 KSLNANWSVNYYLYKGIPANKLLLGL   41 (67)
Q Consensus        16 ~~~n~~~~v~~~~~~G~~~~KlvlGv   41 (67)
                      +...+-.+|+.+++.|+|.+-|+|--
T Consensus       201 tGnTV~~Av~VL~EhgVp~s~IiL~s  226 (267)
T KOG1017|consen  201 TGNTVCKAVEVLKEHGVPDSNIILVS  226 (267)
T ss_pred             CCccHHHHHHHHHHcCCCcccEEEEE
Confidence            45678899999999999999998853


No 64 
>PF00688 TGFb_propeptide:  TGF-beta propeptide;  InterPro: IPR001111 The transforming growth factor beta, N terminus (TGFb) domain is present in a variety of proteins which include the transforming growth factor beta, decapentaplegic proteins and bone morphogenetic proteins. Transforming growth factor beta is a multifunctional peptide that controls proliferation, differentiation and other functions in many cell types. The decapentaplegic protein acts as an extracellular morphogen responsible for the proper development of the embryonic dorsal hypoderm, for viability of larvae and for cell viability of the epithelial cells in the imaginal disks. Bone morphogenetic protein induces cartilage and bone formation and may be responsible for epithelial osteogenesis in some organisms.; GO: 0008083 growth factor activity, 0040007 growth; PDB: 3RJR_A.
Probab=24.72  E-value=72  Score=19.83  Aligned_cols=26  Identities=19%  Similarity=0.133  Sum_probs=18.0

Q ss_pred             cccHHHHHHHHHHcCCCCCceEEEec
Q psy1033          17 SLNANWSVNYYLYKGIPANKLLLGLP   42 (67)
Q Consensus        17 ~~n~~~~v~~~~~~G~~~~KlvlGv~   42 (67)
                      .+++..+|+.|++.+.....|.|.+.
T Consensus       177 ~~dvt~~v~~W~~~~~~n~gl~l~~~  202 (238)
T PF00688_consen  177 SFDVTSAVRRWLRNPEKNLGLELEVE  202 (238)
T ss_dssp             EEE-HHHHHHHHH---S-EEEEEEEE
T ss_pred             eEhHHHHHHHHHhCCCCCccEEEEEE
Confidence            57899999999999888778888884


No 65 
>PF07397 DUF1502:  Repeat of unknown function (DUF1502);  InterPro: IPR010871 This family consists of a number of repeats of around 34 residues in length. Members of this family seem to be found in Talaromyces stipitatus and in Murid herpesvirus 4 (MuHV-4) proteins. The function of these repeats and the proetins in which they are found is unknown.
Probab=24.60  E-value=51  Score=15.41  Aligned_cols=11  Identities=45%  Similarity=0.800  Sum_probs=6.0

Q ss_pred             CCCCCcCCCCC
Q psy1033          57 DYGMPASEKGP   67 (67)
Q Consensus        57 ~~g~p~~g~g~   67 (67)
                      +.|||+-|.|+
T Consensus         4 gagcp~RGAGp   14 (34)
T PF07397_consen    4 GAGCPARGAGP   14 (34)
T ss_pred             ccCCcccCcCC
Confidence            45666665553


No 66 
>PLN02886 aminoacyl-tRNA ligase
Probab=22.93  E-value=92  Score=22.29  Aligned_cols=24  Identities=21%  Similarity=0.168  Sum_probs=19.1

Q ss_pred             ccHHHHHHHHHHcCCCCCceEEEe
Q psy1033          18 LNANWSVNYYLYKGIPANKLLLGL   41 (67)
Q Consensus        18 ~n~~~~v~~~~~~G~~~~KlvlGv   41 (67)
                      .++.+.+..|+..|++++|..+=+
T Consensus       101 ~~~~~~~a~~lA~GlDP~ks~if~  124 (389)
T PLN02886        101 KATRSTAAIYLACGIDPSKASVFV  124 (389)
T ss_pred             HHHHHHHHHHHHcCcCccceEEEE
Confidence            456677889999999999987643


No 67 
>cd07249 MMCE Methylmalonyl-CoA epimerase (MMCE). MMCE, also called methylmalonyl-CoA racemase (EC 5.1.99.1) interconverts (2R)-methylmalonyl-CoA and (2S)-methylmalonyl-CoA. MMCE has been found in bacteria, archaea, and in animals. In eukaryotes, MMCE is an essential enzyme in a pathway that converts propionyl-CoA to succinyl-CoA, and is important in the breakdown of odd-chain length fatty acids, branched-chain amino acids, and other metabolites. In bacteria, MMCE participates in the reverse pathway for propionate fermentation, glyoxylate regeneration, and the biosynthesis of polyketide antibiotics. MMCE is closely related to glyoxalase I and type I extradiol dioxygenases.
Probab=22.91  E-value=96  Score=16.78  Aligned_cols=37  Identities=8%  Similarity=0.052  Sum_probs=24.9

Q ss_pred             cccHHHHHHHHHHcCCCCCceEEEeccceeeeeecCC
Q psy1033          17 SLNANWSVNYYLYKGIPANKLLLGLPTYGHSYTLVNP   53 (67)
Q Consensus        17 ~~n~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~l~~~   53 (67)
                      .-+++..++.+.+.|+...+-.--....|+.+...++
T Consensus        80 v~d~~~~~~~l~~~G~~~~~~~~~~~~~g~~~~~~d~  116 (128)
T cd07249          80 VDDIDAALARLKAQGVRLLQEGPRIGAGGKRVAFLHP  116 (128)
T ss_pred             eCCHHHHHHHHHHCCCeeeccCCCccCCCCEEEEEec
Confidence            3468899999999999754433224566776666554


No 68 
>PF06035 Peptidase_C93:  Bacterial transglutaminase-like cysteine proteinase BTLCP;  InterPro: IPR010319 Structural analysis predicts that this family of proteins are bacterial transglutaminase-like cysteine peptidases (BTLCPs) with an invariant Cys-His-Asp catalytic triad and an N-terminal signal sequence. They are predicted to possess the papain-like cysteine proteinase fold and catalyse post-translational protein modification through transamidase, acetylase or hydrolase activity. Inspection of neighbouring genes suggests a link between this predicted activity and a type-I secretion system resembling ATP-binding cassette exporters of toxins and proteases involved in bacterial pathogenicity [].; PDB: 4FGQ_B 4FGP_B 4FGO_A.
Probab=22.90  E-value=79  Score=20.11  Aligned_cols=24  Identities=21%  Similarity=0.382  Sum_probs=15.1

Q ss_pred             cHHHHHHHH---HHcCCCCCceEEEec
Q psy1033          19 NANWSVNYY---LYKGIPANKLLLGLP   42 (67)
Q Consensus        19 n~~~~v~~~---~~~G~~~~KlvlGv~   42 (67)
                      .=|++|..+   +++|+|.++|.|-+-
T Consensus        80 CEDyai~K~~~L~~~G~p~~~L~ltvV  106 (170)
T PF06035_consen   80 CEDYAIAKRFALIELGVPAEALRLTVV  106 (170)
T ss_dssp             HHHHHHHHHHHHHHHT--GGGEEEEEE
T ss_pred             cHhHHHHHHHHHHHcCCCHHHeEEEEE
Confidence            345666554   678999999998543


No 69 
>COG4002 Predicted phosphotransacetylase [General function prediction only]
Probab=22.72  E-value=51  Score=22.16  Aligned_cols=32  Identities=25%  Similarity=0.397  Sum_probs=21.9

Q ss_pred             HHHHHcCCCCCceE------EEeccceeeeeecCCCCC
Q psy1033          25 NYYLYKGIPANKLL------LGLPTYGHSYTLVNPDST   56 (67)
Q Consensus        25 ~~~~~~G~~~~Klv------lGv~~yGr~~~l~~~~~~   56 (67)
                      ...++--++..|+.      +|++||+|.=-|..+.++
T Consensus        65 daaVRGslsas~v~~eLkealgm~~~~Ras~le~~~~~  102 (256)
T COG4002          65 DAAVRGSLSASKVILELKEALGMKFYCRASILENPFTN  102 (256)
T ss_pred             hHHHhcccchhhHHHHHHHhcCCCceeeeeeeecCCcC
Confidence            33444456666666      899999998777665555


No 70 
>smart00775 LNS2 LNS2 domain. This domain is found in Saccharomyces cerevisiae protein SMP2, proteins with an N-terminal lipin domain and phosphatidylinositol transfer proteins. SMP2 is involved in plasmid maintenance and respiration. Lipin proteins are involved in adipose tissue development and insulin resistance.
Probab=22.66  E-value=76  Score=19.29  Aligned_cols=21  Identities=29%  Similarity=0.374  Sum_probs=16.1

Q ss_pred             cHHHHHHHHHHcCCCCCceEE
Q psy1033          19 NANWSVNYYLYKGIPANKLLL   39 (67)
Q Consensus        19 n~~~~v~~~~~~G~~~~Klvl   39 (67)
                      |...=+..|.+.|++++||.+
T Consensus       127 n~~~D~~~y~~~gi~~~~i~~  147 (157)
T smart00775      127 NRITDVISYSAVGIPPSRIFT  147 (157)
T ss_pred             CCchhHHHHHHcCCChhhEEE
Confidence            444558889999999988754


No 71 
>COG0816 Predicted endonuclease involved in recombination (possible Holliday junction resolvase in Mycoplasmas and B. subtilis) [DNA replication, recombination, and repair]
Probab=22.53  E-value=1e+02  Score=18.90  Aligned_cols=11  Identities=27%  Similarity=0.742  Sum_probs=10.4

Q ss_pred             CCCceEEEecc
Q psy1033          33 PANKLLLGLPT   43 (67)
Q Consensus        33 ~~~KlvlGv~~   43 (67)
                      .++.||+|+|.
T Consensus        53 ~~~~vVVGlP~   63 (141)
T COG0816          53 QVDTVVVGLPL   63 (141)
T ss_pred             CCCEEEEecCc
Confidence            89999999998


No 72 
>PF00023 Ank:  Ankyrin repeat Hereditary spherocytosis;  InterPro: IPR002110  The ankyrin repeat is one of the most common protein-protein interaction motifs in nature. Ankyrin repeats are tandemly repeated modules of about 33 amino acids. They occur in a large number of functionally diverse proteins mainly from eukaryotes. The few known examples from prokaryotes and viruses may be the result of horizontal gene transfers []. The repeat has been found in proteins of diverse function such as transcriptional initiators, cell-cycle regulators, cytoskeletal, ion transporters and signal transducers. The ankyrin fold appears to be defined by its structure rather than its function since there is no specific sequence or structure which is universally recognised by it.  The conserved fold of the ankyrin repeat unit is known from several crystal and solution structures [, , , ]. Each repeat folds into a helix-loop-helix structure with a beta-hairpin/loop region projecting out from the helices at a 90o angle. The repeats stack together to form an L-shaped structure [, ].; GO: 0005515 protein binding; PDB: 1D9S_A 1NFI_F 1IKN_D 1WDY_A 1OT8_C 1QYM_A 1TR4_A 1UOH_A 1N11_A 1K1A_A ....
Probab=22.12  E-value=88  Score=13.45  Aligned_cols=17  Identities=24%  Similarity=0.114  Sum_probs=13.2

Q ss_pred             HHHHHHHHHHcCCCCCc
Q psy1033          20 ANWSVNYYLYKGIPANK   36 (67)
Q Consensus        20 ~~~~v~~~~~~G~~~~K   36 (67)
                      -...|+.+++.|++.+.
T Consensus        14 ~~~~v~~Ll~~ga~~~~   30 (33)
T PF00023_consen   14 HPDIVKLLLKHGADINA   30 (33)
T ss_dssp             CHHHHHHHHHTTSCTTC
T ss_pred             HHHHHHHHHHCcCCCCC
Confidence            34678999999998764


No 73 
>COG1735 Php Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only]
Probab=20.88  E-value=93  Score=21.83  Aligned_cols=22  Identities=14%  Similarity=0.163  Sum_probs=18.3

Q ss_pred             HHHHHHHHHHcCCCCCceEEEe
Q psy1033          20 ANWSVNYYLYKGIPANKLLLGL   41 (67)
Q Consensus        20 ~~~~v~~~~~~G~~~~KlvlGv   41 (67)
                      ....++-+.+.|++++|+++|-
T Consensus       178 g~eq~~il~~egvdl~~v~igH  199 (316)
T COG1735         178 GLEQLRILAEEGVDLRKVSIGH  199 (316)
T ss_pred             hHHHHHHHHHcCCChhHeeEec
Confidence            4456777889999999999985


No 74 
>COG1182 AcpD Acyl carrier protein phosphodiesterase [Lipid metabolism]
Probab=20.58  E-value=84  Score=20.61  Aligned_cols=25  Identities=20%  Similarity=0.325  Sum_probs=18.5

Q ss_pred             HHHHHHHHcCCCCCceEEEecccee
Q psy1033          22 WSVNYYLYKGIPANKLLLGLPTYGH   46 (67)
Q Consensus        22 ~~v~~~~~~G~~~~KlvlGv~~yGr   46 (67)
                      .-.+.++++=..++|+|++.|+|--
T Consensus        76 ~~sd~l~~ef~aAD~vVi~~PM~Nf  100 (202)
T COG1182          76 ARSDKLLEEFLAADKVVIAAPMYNF  100 (202)
T ss_pred             HHHHHHHHHHHhcCeEEEEeccccc
Confidence            3345566666788999999999843


No 75 
>PF03846 SulA:  Cell division inhibitor SulA;  InterPro: IPR004596 All proteins in this family for which the functions are known are cell division inhibitors. In Escherichia coli, SulA is one of the SOS regulated genes. Accumulation of SulA causes rapid cessation of cell division and the appearance of long, non-septate filaments. In the presence of GTP, SulA binds a polymerisation-competent form of ftsZ in a 1:1 ratio, thus inhibiting ftsZ polymerisation and therefore preventing it from participating in the assembly of the Z ring. This mechanism prevents the premature segregation of damaged DNA to daughter cells during cell division. The expression of SulA is repressed by LexA. The N terminus of SulA may be involved in recognising the cell division apparatus.; GO: 0009432 SOS response, 0051782 negative regulation of cell division, 0009276 Gram-negative-bacterium-type cell wall; PDB: 1OFU_X 1OFT_A.
Probab=20.55  E-value=1e+02  Score=18.59  Aligned_cols=14  Identities=29%  Similarity=0.382  Sum_probs=9.1

Q ss_pred             HHHcCCCCCceEEE
Q psy1033          27 YLYKGIPANKLLLG   40 (67)
Q Consensus        27 ~~~~G~~~~KlvlG   40 (67)
                      ..++|++.+||++-
T Consensus        77 L~~aGl~~~kvl~l   90 (119)
T PF03846_consen   77 LQQAGLPLEKVLQL   90 (119)
T ss_dssp             HHHTT--CCCEEEE
T ss_pred             HHHcCCChhHeEEe
Confidence            45679999999874


No 76 
>COG1871 CheD Chemotaxis protein; stimulates methylation of MCP proteins [Cell motility and secretion / Signal transduction mechanisms]
Probab=20.03  E-value=1e+02  Score=19.59  Aligned_cols=33  Identities=15%  Similarity=0.098  Sum_probs=21.5

Q ss_pred             cccHHHHHHHHHHcCCCCCceEEEeccceeeee
Q psy1033          17 SLNANWSVNYYLYKGIPANKLLLGLPTYGHSYT   49 (67)
Q Consensus        17 ~~n~~~~v~~~~~~G~~~~KlvlGv~~yGr~~~   49 (67)
                      ..-++.-|+.+++.|+.+++|-.=+.--+..|.
T Consensus        72 d~ame~Lin~ll~~GA~r~rL~AKlfGGa~mf~  104 (164)
T COG1871          72 DTAMELLINELLKLGASRERLEAKLFGGAQMFA  104 (164)
T ss_pred             HHHHHHHHHHHHHcCCChhhheeeecccHHHHh
Confidence            344555666678889999888765554444443


Done!