Query         psy10340
Match_columns 98
No_of_seqs    103 out of 134
Neff          4.0 
Searched_HMMs 46136
Date          Fri Aug 16 15:28:40 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10340.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10340hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3866|consensus              100.0 5.7E-46 1.2E-50  303.3   8.8   96    2-97    212-307 (442)
  2 PF13405 EF-hand_6:  EF-hand do  97.2 0.00034 7.4E-09   37.9   2.2   26   37-62      3-28  (31)
  3 PF13499 EF-hand_7:  EF-hand do  97.2 0.00078 1.7E-08   40.6   4.1   26   37-62      3-28  (66)
  4 PF00036 EF-hand_1:  EF hand;    96.9  0.0007 1.5E-08   37.2   2.1   25   37-61      3-27  (29)
  5 PF13202 EF-hand_5:  EF hand; P  96.7  0.0012 2.6E-08   35.0   2.0   22   38-59      3-24  (25)
  6 KOG4065|consensus               96.7  0.0019 4.2E-08   47.6   3.5   57   38-96     71-127 (144)
  7 cd05027 S-100B S-100B: S-100B   95.6    0.03 6.5E-07   37.1   4.6   42   38-79     12-55  (88)
  8 KOG0027|consensus               94.8   0.049 1.1E-06   38.2   4.1   32   37-68     88-119 (151)
  9 KOG0034|consensus               94.7   0.089 1.9E-06   39.8   5.4   50   39-97    109-158 (187)
 10 cd05026 S-100Z S-100Z: S-100Z   94.5   0.091   2E-06   34.7   4.6   29   38-66     14-44  (93)
 11 cd05025 S-100A1 S-100A1: S-100  94.5    0.11 2.4E-06   33.7   4.8   30   37-66     12-43  (92)
 12 cd00052 EH Eps15 homology doma  93.9   0.083 1.8E-06   31.1   3.1   26   37-62      2-27  (67)
 13 PF13833 EF-hand_8:  EF-hand do  93.8   0.074 1.6E-06   31.0   2.8   44   15-61      6-52  (54)
 14 smart00054 EFh EF-hand, calciu  93.8   0.096 2.1E-06   24.8   2.8   25   37-61      3-27  (29)
 15 cd00213 S-100 S-100: S-100 dom  93.7    0.18 3.9E-06   32.1   4.7   27   38-64     12-40  (88)
 16 PF08414 NADPH_Ox:  Respiratory  93.6  0.0072 1.6E-07   42.6  -2.2   22   12-36     79-100 (100)
 17 cd00252 SPARC_EC SPARC_EC; ext  93.0    0.13 2.9E-06   36.0   3.4   24   38-61     84-107 (116)
 18 PF14788 EF-hand_10:  EF hand;   92.4    0.11 2.4E-06   32.6   2.1   26   36-61     23-48  (51)
 19 cd00252 SPARC_EC SPARC_EC; ext  92.3    0.13 2.9E-06   36.1   2.6   22   39-60     53-74  (116)
 20 cd05031 S-100A10_like S-100A10  92.0    0.37 7.9E-06   31.4   4.4   27   38-64     12-40  (94)
 21 smart00027 EH Eps15 homology d  91.8    0.26 5.7E-06   32.1   3.5   25   38-62     14-38  (96)
 22 cd05022 S-100A13 S-100A13: S-1  91.5     0.2 4.3E-06   33.5   2.7   29   37-65     11-40  (89)
 23 PF13499 EF-hand_7:  EF-hand do  91.4    0.18 3.9E-06   30.1   2.2   23   38-60     44-66  (66)
 24 KOG0044|consensus               90.6    0.53 1.1E-05   36.0   4.6   29   40-68    106-134 (193)
 25 KOG0039|consensus               89.2    0.44 9.4E-06   41.8   3.6   60   29-97     11-72  (646)
 26 KOG0031|consensus               89.1    0.57 1.2E-05   35.8   3.7   28   39-67     37-64  (171)
 27 cd00051 EFh EF-hand, calcium b  88.0    0.77 1.7E-05   25.0   2.9   24   38-61      4-27  (63)
 28 cd05029 S-100A6 S-100A6: S-100  87.8     1.3 2.7E-05   29.3   4.3   27   38-64     14-42  (88)
 29 KOG0027|consensus               84.9       1 2.2E-05   31.5   2.8   25   37-61     11-35  (151)
 30 cd05023 S-100A11 S-100A11: S-1  84.6     2.2 4.7E-05   28.3   4.2   32   38-69     13-46  (89)
 31 PTZ00184 calmodulin; Provision  82.5     1.2 2.7E-05   29.2   2.3   25   37-61     87-111 (149)
 32 PF12763 EF-hand_4:  Cytoskelet  81.9     1.2 2.7E-05   30.7   2.2   19   38-56     47-65  (104)
 33 PTZ00183 centrin; Provisional   81.0     1.8 3.9E-05   29.0   2.8   24   38-61     21-44  (158)
 34 PTZ00184 calmodulin; Provision  80.7     2.1 4.5E-05   28.1   3.0   24   38-61     15-38  (149)
 35 COG5126 FRQ1 Ca2+-binding prot  80.3     3.3 7.1E-05   31.0   4.2   39    8-60      8-46  (160)
 36 smart00027 EH Eps15 homology d  79.8     3.2 6.9E-05   26.9   3.6   45   15-62     28-72  (96)
 37 PTZ00183 centrin; Provisional   79.8     2.2 4.7E-05   28.6   2.9   24   38-61     94-117 (158)
 38 KOG4223|consensus               79.7     1.1 2.4E-05   37.2   1.6   24   38-61    245-268 (325)
 39 PF10591 SPARC_Ca_bdg:  Secrete  78.9     1.1 2.5E-05   31.0   1.3   21   37-57     91-111 (113)
 40 KOG2562|consensus               78.6     3.7   8E-05   35.9   4.5   38   37-74    354-391 (493)
 41 PF00404 Dockerin_1:  Dockerin   75.4     3.4 7.3E-05   21.5   2.2   16   44-59      1-16  (21)
 42 COG5126 FRQ1 Ca2+-binding prot  74.0     5.5 0.00012   29.8   3.9   24   38-61     96-119 (160)
 43 cd05031 S-100A10_like S-100A10  73.8       7 0.00015   25.3   3.9   49   14-62     27-79  (94)
 44 cd05026 S-100Z S-100Z: S-100Z   73.0       5 0.00011   26.4   3.1   49   14-62     29-81  (93)
 45 cd05024 S-100A10 S-100A10: A s  70.4      13 0.00028   25.4   4.8   48   14-62     24-76  (91)
 46 KOG0028|consensus               69.4     7.7 0.00017   29.8   3.8   45   37-86    109-153 (172)
 47 KOG4251|consensus               69.3     2.5 5.3E-05   35.1   1.2   34   28-61    134-167 (362)
 48 PF10591 SPARC_Ca_bdg:  Secrete  69.0    0.64 1.4E-05   32.2  -2.0   23   39-61     59-81  (113)
 49 KOG2643|consensus               68.2     3.1 6.8E-05   36.2   1.6   24   38-61    237-260 (489)
 50 PRK12309 transaldolase/EF-hand  67.1     5.7 0.00012   33.2   2.9   20   38-57    338-357 (391)
 51 cd05023 S-100A11 S-100A11: S-1  66.3     8.1 0.00017   25.5   3.0   48   14-62     28-80  (89)
 52 cd05029 S-100A6 S-100A6: S-100  65.6      15 0.00033   24.1   4.2   53   14-68     29-84  (88)
 53 cd05022 S-100A13 S-100A13: S-1  64.3     9.3  0.0002   25.4   3.0   48   14-62     26-75  (89)
 54 cd05024 S-100A10 S-100A10: A s  62.8      17 0.00036   24.9   4.1   27   46-72     19-45  (91)
 55 PLN02964 phosphatidylserine de  62.0      20 0.00043   32.1   5.5   24   38-61    183-206 (644)
 56 PLN02964 phosphatidylserine de  61.8     8.1 0.00018   34.5   3.0   26   37-62    218-243 (644)
 57 PF10197 Cir_N:  N-terminal dom  61.6     6.5 0.00014   22.8   1.7   14   11-24      2-15  (37)
 58 KOG1029|consensus               60.5       7 0.00015   36.7   2.5   29   38-66    233-262 (1118)
 59 cd05030 calgranulins Calgranul  59.9      13 0.00027   24.2   3.0   53   14-68     27-84  (88)
 60 cd05025 S-100A1 S-100A1: S-100  58.6      14 0.00031   23.6   3.1   49   14-62     28-80  (92)
 61 KOG0031|consensus               57.7      17 0.00036   27.9   3.7   25   38-62    105-129 (171)
 62 KOG0044|consensus               57.4     9.6 0.00021   29.2   2.4   25   38-62    151-175 (193)
 63 KOG4223|consensus               57.2      13 0.00027   31.1   3.2   45   23-67     64-110 (325)
 64 KOG0030|consensus               54.6      44 0.00096   25.2   5.5   58   37-94     14-81  (152)
 65 KOG2643|consensus               52.6      25 0.00055   30.8   4.4   36   38-73    429-465 (489)
 66 PRK12309 transaldolase/EF-hand  52.6      13 0.00028   31.1   2.7   25   37-61    360-384 (391)
 67 KOG0041|consensus               51.7      14 0.00029   29.8   2.5   25   38-62    103-127 (244)
 68 cd05027 S-100B S-100B: S-100B   49.9      22 0.00047   23.3   2.9   26   37-62     54-79  (88)
 69 KOG1707|consensus               48.6      14 0.00031   33.2   2.4   24   38-61    319-342 (625)
 70 cd05030 calgranulins Calgranul  47.6      55  0.0012   21.1   4.6   27   39-65     13-41  (88)
 71 COG5533 UBP5 Ubiquitin C-termi  47.3      22 0.00047   30.4   3.1   57   33-89    140-201 (415)
 72 PF01234 NNMT_PNMT_TEMT:  NNMT/  45.6      22 0.00048   28.1   2.8   41   33-73     15-55  (256)
 73 KOG0034|consensus               44.1      23 0.00049   26.9   2.6   25   38-62    151-175 (187)
 74 PF15178 TOM_sub5:  Mitochondri  42.2      21 0.00045   22.5   1.8   16   81-96     14-29  (51)
 75 PF06226 DUF1007:  Protein of u  42.2      32  0.0007   25.9   3.2   29   36-64     52-80  (212)
 76 PF09912 DUF2141:  Uncharacteri  40.8      12 0.00025   25.8   0.5   18   38-55     56-73  (112)
 77 smart00426 TEA TEA domain.      39.7      42 0.00092   22.2   3.0   27   46-74      1-27  (68)
 78 PF14658 EF-hand_9:  EF-hand do  39.0      61  0.0013   21.0   3.7   24   38-61      2-25  (66)
 79 KOG1707|consensus               37.9      21 0.00044   32.3   1.7   23   38-60    199-221 (625)
 80 KOG0038|consensus               36.8      22 0.00048   27.4   1.6   25   38-62    112-136 (189)
 81 PF15080 DUF4547:  Domain of un  32.3      57  0.0012   25.4   3.2   49   18-68     99-151 (196)
 82 KOG3555|consensus               31.0      34 0.00073   29.5   1.8   24   38-61    254-277 (434)
 83 PF05820 DUF845:  Baculovirus p  28.8      24 0.00051   25.7   0.5    8   36-43     68-75  (119)
 84 TIGR01748 rhaA L-rhamnose isom  28.5      60  0.0013   28.0   3.0   64   23-89    117-202 (414)
 85 PF01023 S_100:  S-100/ICaBP ty  27.5      52  0.0011   19.3   1.8   21   47-67     21-41  (44)
 86 PF00249 Myb_DNA-binding:  Myb-  25.2      91   0.002   17.7   2.5   21   49-71      2-22  (48)
 87 KOG3478|consensus               25.0 1.5E+02  0.0032   21.6   4.0   30   58-93     79-108 (120)
 88 KOG0038|consensus               24.2      67  0.0015   24.8   2.3   20   43-62    158-177 (189)
 89 PF15005 IZUMO:  Izumo sperm-eg  23.6 2.1E+02  0.0045   21.5   4.8   55   39-96     49-107 (160)
 90 PF15304 AKAP2_C:  A-kinase anc  23.4 1.2E+02  0.0027   25.2   3.8   27   56-92    211-237 (344)
 91 PRK11546 zraP zinc resistance   23.2 1.4E+02  0.0031   22.0   3.8   32   63-94     76-108 (143)
 92 COG0501 HtpX Zn-dependent prot  22.9      81  0.0018   23.7   2.5   21   50-70    151-171 (302)
 93 smart00271 DnaJ DnaJ molecular  22.9 1.6E+02  0.0035   16.7   6.0   34   38-74      2-35  (60)
 94 PRK14290 chaperone protein Dna  22.8 2.9E+02  0.0063   22.4   5.8   37   37-76      3-39  (365)
 95 PF00550 PP-binding:  Phosphopa  22.5      51  0.0011   19.2   1.1   24   17-40      1-25  (67)
 96 COG1448 TyrB Aspartate/tyrosin  21.8 1.1E+02  0.0023   26.4   3.2   35   50-97    297-331 (396)
 97 PLN02736 long-chain acyl-CoA s  21.7      65  0.0014   27.1   1.9   25   45-69    624-648 (651)
 98 cd09236 V_AnPalA_UmRIM20_like   21.2      76  0.0017   25.6   2.2   23   47-70    243-265 (353)
 99 PF01839 FG-GAP:  FG-GAP repeat  21.2      41  0.0009   18.7   0.5   10   43-52      8-17  (34)

No 1  
>KOG3866|consensus
Probab=100.00  E-value=5.7e-46  Score=303.29  Aligned_cols=96  Identities=39%  Similarity=0.670  Sum_probs=94.6

Q ss_pred             CccccCCccCCCCChHHHHHHHHhhcCCCCCCCCchhhhhhhcCCCCCCCCHHHHHHHHHHHhhhhhCCCCCcchHHHHH
Q psy10340          2 RFSTLTFQVHHPGSKKQLEEVWQEQDHMGNTEFNPKAFFAMHDLDGNHVWDEEEVKMLFLKELDKMYKEGMPQNDLMERA   81 (98)
Q Consensus         2 ~~~~~h~ki~hPGSk~ql~evWeeed~i~~~~FDp~tFF~lHD~n~DG~~d~~El~ai~~kEl~K~y~~~~~edd~~e~~   81 (98)
                      |+|++||||+||||++||++||++.||++++.|||+|||.|||+||||+|++.||+|||+|||+|||+|.|++|||+||+
T Consensus       212 krH~~HpKvnhPGSkdQLkEVWEE~DgLdpn~fdPKTFF~LHD~NsDGfldeqELEaLFtkELEKvYdpkNeeDDM~Eme  291 (442)
T KOG3866|consen  212 KRHNDHPKVNHPGSKDQLKEVWEESDGLDPNQFDPKTFFALHDLNSDGFLDEQELEALFTKELEKVYDPKNEEDDMKEME  291 (442)
T ss_pred             HhhccCccCCCCCcHHHHHHHHHHhcCCCcccCCcchheeeeccCCcccccHHHHHHHHHHHHHHhcCCCCcchHHHHHH
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhhccc
Q psy10340         82 EERQTVFTGLFCSLRA   97 (98)
Q Consensus        82 eE~~rMRehv~~e~~~   97 (98)
                      |||.|||||||++||.
T Consensus       292 EErlRMREHVMk~vDt  307 (442)
T KOG3866|consen  292 EERLRMREHVMKQVDT  307 (442)
T ss_pred             HHHHHHHHHHHHhccc
Confidence            9999999999999984


No 2  
>PF13405 EF-hand_6:  EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B ....
Probab=97.17  E-value=0.00034  Score=37.86  Aligned_cols=26  Identities=35%  Similarity=0.537  Sum_probs=22.7

Q ss_pred             hhhhhhhcCCCCCCCCHHHHHHHHHH
Q psy10340         37 KAFFAMHDLDGNHVWDEEEVKMLFLK   62 (98)
Q Consensus        37 ~tFF~lHD~n~DG~~d~~El~ai~~k   62 (98)
                      +.+|.++|.|+||+|+.+|+.+++.+
T Consensus         3 ~~~F~~~D~d~dG~I~~~el~~~l~~   28 (31)
T PF13405_consen    3 REAFKMFDKDGDGFIDFEELRAILRK   28 (31)
T ss_dssp             HHHHHHH-TTSSSEEEHHHHHHHHHH
T ss_pred             HHHHHHHCCCCCCcCcHHHHHHHHHH
Confidence            46899999999999999999999874


No 3  
>PF13499 EF-hand_7:  EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E ....
Probab=97.16  E-value=0.00078  Score=40.61  Aligned_cols=26  Identities=27%  Similarity=0.370  Sum_probs=23.8

Q ss_pred             hhhhhhhcCCCCCCCCHHHHHHHHHH
Q psy10340         37 KAFFAMHDLDGNHVWDEEEVKMLFLK   62 (98)
Q Consensus        37 ~tFF~lHD~n~DG~~d~~El~ai~~k   62 (98)
                      +..|.+.|.|+||+++.+||..++..
T Consensus         3 ~~~F~~~D~d~~G~i~~~el~~~~~~   28 (66)
T PF13499_consen    3 KEAFKKFDKDGDGYISKEELRRALKH   28 (66)
T ss_dssp             HHHHHHHSTTSSSEEEHHHHHHHHHH
T ss_pred             HHHHHHHcCCccCCCCHHHHHHHHHH
Confidence            46799999999999999999999985


No 4  
>PF00036 EF-hand_1:  EF hand;  InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand. This type of domain consists of a twelve residue loop flanked on both sides by a twelve residue alpha-helical domain. In an EF-hand loop the calcium ion is coordinated in a pentagonal bipyramidal configuration. The six residues involved in the binding are in positions 1, 3, 5, 7, 9 and 12; these residues are denoted by X, Y, Z, -Y, -X and -Z. The invariant Glu or Asp at position 12 provides two oxygens for liganding Ca (bidentate ligand).; PDB: 1BJF_A 1XFW_R 1XFV_O 2K0J_A 2F3Z_A 3BYA_A 1XFU_Q 2R28_B 1ZOT_B 3G43_D ....
Probab=96.93  E-value=0.0007  Score=37.15  Aligned_cols=25  Identities=36%  Similarity=0.375  Sum_probs=22.6

Q ss_pred             hhhhhhhcCCCCCCCCHHHHHHHHH
Q psy10340         37 KAFFAMHDLDGNHVWDEEEVKMLFL   61 (98)
Q Consensus        37 ~tFF~lHD~n~DG~~d~~El~ai~~   61 (98)
                      +..|...|.|+||+++.+|+.+++.
T Consensus         3 ~~~F~~~D~d~dG~I~~~Ef~~~~~   27 (29)
T PF00036_consen    3 KEAFREFDKDGDGKIDFEEFKEMMK   27 (29)
T ss_dssp             HHHHHHHSTTSSSEEEHHHHHHHHH
T ss_pred             HHHHHHHCCCCCCcCCHHHHHHHHH
Confidence            3579999999999999999999876


No 5  
>PF13202 EF-hand_5:  EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A ....
Probab=96.74  E-value=0.0012  Score=35.04  Aligned_cols=22  Identities=32%  Similarity=0.347  Sum_probs=20.3

Q ss_pred             hhhhhhcCCCCCCCCHHHHHHH
Q psy10340         38 AFFAMHDLDGNHVWDEEEVKML   59 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~ai   59 (98)
                      .+|...|.|+||.++.+|+.++
T Consensus         3 ~~F~~~D~d~DG~is~~E~~~~   24 (25)
T PF13202_consen    3 DAFQQFDTDGDGKISFEEFQRL   24 (25)
T ss_dssp             HHHHHHTTTSSSEEEHHHHHHH
T ss_pred             HHHHHHcCCCCCcCCHHHHHHH
Confidence            5899999999999999999885


No 6  
>KOG4065|consensus
Probab=96.69  E-value=0.0019  Score=47.60  Aligned_cols=57  Identities=19%  Similarity=0.269  Sum_probs=43.5

Q ss_pred             hhhhhhcCCCCCCCCHHHHHHHHHHHhhhhhCCCCCcchHHHHHHHHHHHHHHHhhhcc
Q psy10340         38 AFFAMHDLDGNHVWDEEEVKMLFLKELDKMYKEGMPQNDLMERAEERQTVFTGLFCSLR   96 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~ai~~kEl~K~y~~~~~edd~~e~~eE~~rMRehv~~e~~   96 (98)
                      -+|.|||+|++|.||.-||...++. .++-.+.+- +--+.--+-|+.||-..|++..|
T Consensus        71 HYF~MHDldknn~lDGiEl~kAiTH-~H~~h~~gh-ep~Pl~sE~Ele~~iD~vL~DdD  127 (144)
T KOG4065|consen   71 HYFSMHDLDKNNFLDGIELLKAITH-THDAHDSGH-EPVPLSSEAELERLIDAVLDDDD  127 (144)
T ss_pred             hhhhhhccCcCCcchHHHHHHHHHH-HhhhhhcCC-CCCCCCCHHHHHHHHHHHhcccc
Confidence            7899999999999999998877773 555443333 23455667899999999988765


No 7  
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B. S100B is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100B group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100B is most abundant in glial cells of the central nervous system, predominately in astrocytes. S100B is involved in signal transduction via the inhibition of protein phoshorylation, regulation of enzyme activity and by affecting the calcium homeostasis. Upon calcium binding the S100B homodimer changes conformation to expose a hydrophobic cleft, which represents the interaction site of S100B with its more than 20 known target  proteins. These target proteins include several cellular architecture proteins such as tubulin and GFAP; S100B can inhibit polymerization of these oligomeric molecules. Furthermore, S100B i
Probab=95.57  E-value=0.03  Score=37.10  Aligned_cols=42  Identities=21%  Similarity=0.252  Sum_probs=33.6

Q ss_pred             hhhhhhc-CCCCC-CCCHHHHHHHHHHHhhhhhCCCCCcchHHH
Q psy10340         38 AFFAMHD-LDGNH-VWDEEEVKMLFLKELDKMYKEGMPQNDLME   79 (98)
Q Consensus        38 tFF~lHD-~n~DG-~~d~~El~ai~~kEl~K~y~~~~~edd~~e   79 (98)
                      .-|...| .|||| +++..||..++..|+..+-....+++++.+
T Consensus        12 ~aF~~fD~~dgdG~~I~~~eL~~ll~~~~~~~lg~~~~~~~v~~   55 (88)
T cd05027          12 DVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDK   55 (88)
T ss_pred             HHHHHhcccCCCcCEECHHHHHHHHHHHhHHHhcCCCCHHHHHH
Confidence            4688997 89999 599999999999999888766655544433


No 8  
>KOG0027|consensus
Probab=94.84  E-value=0.049  Score=38.21  Aligned_cols=32  Identities=25%  Similarity=0.334  Sum_probs=26.8

Q ss_pred             hhhhhhhcCCCCCCCCHHHHHHHHHHHhhhhh
Q psy10340         37 KAFFAMHDLDGNHVWDEEEVKMLFLKELDKMY   68 (98)
Q Consensus        37 ~tFF~lHD~n~DG~~d~~El~ai~~kEl~K~y   68 (98)
                      +--|.+.|.|+||+++..||..++..--+|.-
T Consensus        88 ~eaF~~fD~d~~G~Is~~el~~~l~~lg~~~~  119 (151)
T KOG0027|consen   88 KEAFRVFDKDGDGFISASELKKVLTSLGEKLT  119 (151)
T ss_pred             HHHHHHHccCCCCcCcHHHHHHHHHHhCCcCC
Confidence            46789999999999999999999997555443


No 9  
>KOG0034|consensus
Probab=94.66  E-value=0.089  Score=39.85  Aligned_cols=50  Identities=24%  Similarity=0.306  Sum_probs=37.9

Q ss_pred             hhhhhcCCCCCCCCHHHHHHHHHHHhhhhhCCCCCcchHHHHHHHHHHHHHHHhhhccc
Q psy10340         39 FFAMHDLDGNHVWDEEEVKMLFLKELDKMYKEGMPQNDLMERAEERQTVFTGLFCSLRA   97 (98)
Q Consensus        39 FF~lHD~n~DG~~d~~El~ai~~kEl~K~y~~~~~edd~~e~~eE~~rMRehv~~e~~~   97 (98)
                      -|.+.|+|++|+++.+||..+..    ++...+...     ..+-+..|-+.+|.|.|.
T Consensus       109 aF~vYD~~~~G~I~reel~~iv~----~~~~~~~~~-----~~e~~~~i~d~t~~e~D~  158 (187)
T KOG0034|consen  109 AFRVYDLDGDGFISREELKQILR----MMVGENDDM-----SDEQLEDIVDKTFEEADT  158 (187)
T ss_pred             HHHHhcCCCCCcCcHHHHHHHHH----HHHccCCcc-----hHHHHHHHHHHHHHHhCC
Confidence            46799999999999999988866    444433322     567788888888888763


No 10 
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z. S100Z is a member of the S100 domain family within the EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100Z group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately.S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control. S100Z is normally expressed in various tissues, with its highest level of expression being in spleen and leukocytes. The function of S100Z remains unclear. Preliminary structural data suggests that S100Z is homodimer, however a heterodimer with S100P has been reported. S100Z is capable of binding calcium ions. When calcium binds to S110Z,  the protein experiences a conformational change, which exposes hydrophobic surfac
Probab=94.51  E-value=0.091  Score=34.74  Aligned_cols=29  Identities=24%  Similarity=0.381  Sum_probs=24.2

Q ss_pred             hhhhhhc-CCCCC-CCCHHHHHHHHHHHhhh
Q psy10340         38 AFFAMHD-LDGNH-VWDEEEVKMLFLKELDK   66 (98)
Q Consensus        38 tFF~lHD-~n~DG-~~d~~El~ai~~kEl~K   66 (98)
                      .-|...| .|||| .++..||.+++.+++-.
T Consensus        14 ~~F~~~dd~dgdg~~Is~~EL~~ll~~~~~~   44 (93)
T cd05026          14 RIFHNYSGKEGDRYKLSKGELKELLQRELTD   44 (93)
T ss_pred             HHHHHHHccCCCCCEECHHHHHHHHHHHhHH
Confidence            4588887 89999 59999999999887643


No 11 
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1. S100A1 is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A1 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. As is the case with many other members of S100 protein family, S100A1 is implicated in intracellular and extracellular regulatory activities, including interaction with myosin-associated twitchin kinase, actin-capping protein CapZ, sinapsin I, and tubulin. Structural data suggests that S100A1 proteins exist within cells as antiparallel homodimers, while heterodimers  with S100A4 and S100B also has been reported. Upon binding calcium S100A1 changes conformation to expose a hydrophobic cleft which is the interaction site of S100A1 with its more that 20 known target  proteins.
Probab=94.46  E-value=0.11  Score=33.70  Aligned_cols=30  Identities=27%  Similarity=0.440  Sum_probs=24.9

Q ss_pred             hhhhhhhc-CCCCCC-CCHHHHHHHHHHHhhh
Q psy10340         37 KAFFAMHD-LDGNHV-WDEEEVKMLFLKELDK   66 (98)
Q Consensus        37 ~tFF~lHD-~n~DG~-~d~~El~ai~~kEl~K   66 (98)
                      +.-|.+.| .|++|+ |+..||..++..++-.
T Consensus        12 ~~~F~~fDd~dg~G~~Is~~El~~~l~~~lg~   43 (92)
T cd05025          12 INVFHAHSGKEGDKYKLSKKELKDLLQTELSD   43 (92)
T ss_pred             HHHHHHHhcccCCCCeECHHHHHHHHHHHHHH
Confidence            35689996 999995 9999999999876643


No 12 
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction. The alignment contains a pair of EF-hand motifs, typically one of them is canonical and binds to Ca2+, while the other may not bind to Ca2+. A hydrophobic binding pocket is formed by residues from both EF-hand motifs. The EH domain binds to proteins containing NPF (class I), [WF]W or SWG (class II), or H[TS]F (class III) sequence motifs.
Probab=93.87  E-value=0.083  Score=31.12  Aligned_cols=26  Identities=23%  Similarity=0.362  Sum_probs=22.8

Q ss_pred             hhhhhhhcCCCCCCCCHHHHHHHHHH
Q psy10340         37 KAFFAMHDLDGNHVWDEEEVKMLFLK   62 (98)
Q Consensus        37 ~tFF~lHD~n~DG~~d~~El~ai~~k   62 (98)
                      +..|...|.|++|.++.+|+..++.+
T Consensus         2 ~~~F~~~D~~~~G~i~~~el~~~l~~   27 (67)
T cd00052           2 DQIFRSLDPDGDGLISGDEARPFLGK   27 (67)
T ss_pred             hHHHHHhCCCCCCcCcHHHHHHHHHH
Confidence            35788999999999999999999863


No 13 
>PF13833 EF-hand_8:  EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A ....
Probab=93.82  E-value=0.074  Score=30.98  Aligned_cols=44  Identities=11%  Similarity=0.253  Sum_probs=32.3

Q ss_pred             ChHHHHHHHHhhcCCCCCCCCc---hhhhhhhcCCCCCCCCHHHHHHHHH
Q psy10340         15 SKKQLEEVWQEQDHMGNTEFNP---KAFFAMHDLDGNHVWDEEEVKMLFL   61 (98)
Q Consensus        15 Sk~ql~evWeeed~i~~~~FDp---~tFF~lHD~n~DG~~d~~El~ai~~   61 (98)
                      |+++|+..+. .=++.  .+++   ...|...|.|+||+++-+|+.+++.
T Consensus         6 ~~~~~~~~l~-~~g~~--~~s~~e~~~l~~~~D~~~~G~I~~~EF~~~~~   52 (54)
T PF13833_consen    6 TREEFRRALS-KLGIK--DLSEEEVDRLFREFDTDGDGYISFDEFISMMQ   52 (54)
T ss_dssp             EHHHHHHHHH-HTTSS--SSCHHHHHHHHHHHTTSSSSSEEHHHHHHHHH
T ss_pred             CHHHHHHHHH-HhCCC--CCCHHHHHHHHHhcccCCCCCCCHHHHHHHHH
Confidence            5667777764 22333  1334   4899999999999999999988876


No 14 
>smart00054 EFh EF-hand, calcium binding motif. EF-hands are calcium-binding motifs that occur at least in pairs. Links between disease states and genes encoding EF-hands, particularly the S100 subclass, are emerging. Each motif consists of a 12 residue loop flanked on either side by a 12 residue alpha-helix. EF-hands undergo a conformational change unpon binding calcium ions.
Probab=93.82  E-value=0.096  Score=24.80  Aligned_cols=25  Identities=40%  Similarity=0.446  Sum_probs=22.1

Q ss_pred             hhhhhhhcCCCCCCCCHHHHHHHHH
Q psy10340         37 KAFFAMHDLDGNHVWDEEEVKMLFL   61 (98)
Q Consensus        37 ~tFF~lHD~n~DG~~d~~El~ai~~   61 (98)
                      +..|...|.|++|.++..|+..++.
T Consensus         3 ~~~f~~~d~~~~g~i~~~e~~~~~~   27 (29)
T smart00054        3 KEAFRLFDKDGDGKIDFEEFKDLLK   27 (29)
T ss_pred             HHHHHHHCCCCCCcEeHHHHHHHHH
Confidence            4578999999999999999998875


No 15 
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif. Note that this S-100 hierarchy contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are expressed exclusively in vertebrates, and are implicated in intracellular and extracellular regulatory activities. Intracellularly, S100 proteins act as Ca-signaling or Ca-buffering proteins. The most unusual characteristic of certain S100 proteins is their occurrence in extracellular space, where they act in a cytokine-like manner through RAGE, the receptor for advanced glycation products. Structural data suggest that many S100 members exist within cells as homo- or heterodimers and even oligomers; oligomerization contributes to their functional diversification. Upon binding calcium, most S100 proteins change conformation to a more open structure exposing a hydrophobic cleft. This hydrophobic surface represents th
Probab=93.72  E-value=0.18  Score=32.09  Aligned_cols=27  Identities=22%  Similarity=0.244  Sum_probs=23.1

Q ss_pred             hhhhhhcC--CCCCCCCHHHHHHHHHHHh
Q psy10340         38 AFFAMHDL--DGNHVWDEEEVKMLFLKEL   64 (98)
Q Consensus        38 tFF~lHD~--n~DG~~d~~El~ai~~kEl   64 (98)
                      .-|.+.|.  |++|.++.+||..++..++
T Consensus        12 ~~F~~~D~~~~~~G~Is~~el~~~l~~~~   40 (88)
T cd00213          12 DVFHKYSGKEGDKDTLSKKELKELLETEL   40 (88)
T ss_pred             HHHHHHhhccCCCCcCcHHHHHHHHHHHh
Confidence            45899999  8999999999999986533


No 16 
>PF08414 NADPH_Ox:  Respiratory burst NADPH oxidase;  InterPro: IPR013623 This domain is found in plant proteins such as respiratory burst NADPH oxidase proteins which produce reactive oxygen species as a defence mechanism. It tends to occur to the N terminus of an EF-hand (IPR002048 from INTERPRO), which suggests a direct regulatory effect of Ca2+ on the activity of the NADPH oxidase in plants []. ; GO: 0004601 peroxidase activity, 0050664 oxidoreductase activity, acting on NADH or NADPH, oxygen as acceptor, 0055114 oxidation-reduction process; PDB: 3A8R_A.
Probab=93.62  E-value=0.0072  Score=42.58  Aligned_cols=22  Identities=23%  Similarity=0.669  Sum_probs=16.0

Q ss_pred             CCCChHHHHHHHHhhcCCCCCCCCc
Q psy10340         12 HPGSKKQLEEVWQEQDHMGNTEFNP   36 (98)
Q Consensus        12 hPGSk~ql~evWeeed~i~~~~FDp   36 (98)
                      ..+||+||+++|+   +|+|++||+
T Consensus        79 ~~I~k~eL~efW~---qisD~sFDs  100 (100)
T PF08414_consen   79 DSITKDELKEFWE---QISDQSFDS  100 (100)
T ss_dssp             SEE-HHHHHHHHH---HHH---HHH
T ss_pred             CCcCHHHHHHHHH---HhhccCCCC
Confidence            5679999999999   999999985


No 17 
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP). SPARC (BM-40) is a multifunctional glycoprotein, a matricellular protein, that functions to regulate cell-matrix interactions; binds to such proteins as collagen and vitronectin and binds to endothelial cells thus inhibiting cellular proliferation. The EC domain interacts with a follistatin-like (FS) domain which appears to stabilize Ca2+ binding. The two EF-hands interact canonically but their conserved disulfide bonds confer a tight association between the EF-hand pair and an acid/amphiphilic N-terminal helix. Proposed active form involves a Ca2+ dependent symmetric homodimerization of EC-FS modules.
Probab=92.95  E-value=0.13  Score=36.04  Aligned_cols=24  Identities=29%  Similarity=0.398  Sum_probs=14.3

Q ss_pred             hhhhhhcCCCCCCCCHHHHHHHHH
Q psy10340         38 AFFAMHDLDGNHVWDEEEVKMLFL   61 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~ai~~   61 (98)
                      .||..+|.|+||+||-+|....|.
T Consensus        84 ~f~~~~D~n~Dg~IS~~Ef~~cl~  107 (116)
T cd00252          84 PFFESCDLDKDGSISLDEWCYCFI  107 (116)
T ss_pred             HHHHHHCCCCCCCCCHHHHHHHHh
Confidence            466666666666666666555554


No 18 
>PF14788 EF-hand_10:  EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A ....
Probab=92.44  E-value=0.11  Score=32.56  Aligned_cols=26  Identities=15%  Similarity=0.266  Sum_probs=23.0

Q ss_pred             chhhhhhhcCCCCCCCCHHHHHHHHH
Q psy10340         36 PKAFFAMHDLDGNHVWDEEEVKMLFL   61 (98)
Q Consensus        36 p~tFF~lHD~n~DG~~d~~El~ai~~   61 (98)
                      +...|..+|.+++|+|+.+||+..|.
T Consensus        23 A~~LFq~~D~s~~g~Le~~Ef~~Fy~   48 (51)
T PF14788_consen   23 ARQLFQECDKSQSGRLEGEEFEEFYK   48 (51)
T ss_dssp             HHHHHHHH-SSSSSEBEHHHHHHHHH
T ss_pred             HHHHHHHhcccCCCCccHHHHHHHHH
Confidence            66899999999999999999999875


No 19 
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP). SPARC (BM-40) is a multifunctional glycoprotein, a matricellular protein, that functions to regulate cell-matrix interactions; binds to such proteins as collagen and vitronectin and binds to endothelial cells thus inhibiting cellular proliferation. The EC domain interacts with a follistatin-like (FS) domain which appears to stabilize Ca2+ binding. The two EF-hands interact canonically but their conserved disulfide bonds confer a tight association between the EF-hand pair and an acid/amphiphilic N-terminal helix. Proposed active form involves a Ca2+ dependent symmetric homodimerization of EC-FS modules.
Probab=92.25  E-value=0.13  Score=36.06  Aligned_cols=22  Identities=14%  Similarity=0.090  Sum_probs=19.3

Q ss_pred             hhhhhcCCCCCCCCHHHHHHHH
Q psy10340         39 FFAMHDLDGNHVWDEEEVKMLF   60 (98)
Q Consensus        39 FF~lHD~n~DG~~d~~El~ai~   60 (98)
                      -|...|.|+||+|+.+||..+.
T Consensus        53 ~F~~lD~d~DG~Ls~~EL~~~~   74 (116)
T cd00252          53 MFNQLDGNYDGKLSHHELAPIR   74 (116)
T ss_pred             HHHHHCCCCCCcCCHHHHHHHH
Confidence            3677799999999999999875


No 20 
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10. S100A10 is a member of the S100 family of EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A1_like group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are expressed exclusively in vertebrates, and are implicated in intracellular and extracellular regulatory activities. A unique feature of S100A10 is that it contains mutation in both of the calcium binding sites, making it calcium insensitive. S100A10 has been detected in brain, heart, gastrointestinal tract, kidney, liver, lung, spleen, testes, epidermis, aorta, and thymus. Structural data supports the homo- and hetero-dimeric as well as hetero-tetrameric nature of the protein. S100A10 has multiple binding partners in its calcium free state and is therefore involved in many diverse biological functions.
Probab=92.03  E-value=0.37  Score=31.43  Aligned_cols=27  Identities=33%  Similarity=0.368  Sum_probs=22.1

Q ss_pred             hhhhhhcC-CC-CCCCCHHHHHHHHHHHh
Q psy10340         38 AFFAMHDL-DG-NHVWDEEEVKMLFLKEL   64 (98)
Q Consensus        38 tFF~lHD~-n~-DG~~d~~El~ai~~kEl   64 (98)
                      .-|.+.|. |+ +|+++..||..++..++
T Consensus        12 ~~F~~~D~~dg~dG~Is~~El~~~l~~~~   40 (94)
T cd05031          12 LTFHRYAGKDGDKNTLSRKELKKLMEKEL   40 (94)
T ss_pred             HHHHHHhccCCCCCeECHHHHHHHHHHHh
Confidence            46888886 97 69999999999987533


No 21 
>smart00027 EH Eps15 homology domain. Pair of EF hand motifs that recognise proteins containing Asn-Pro-Phe (NPF) sequences.
Probab=91.75  E-value=0.26  Score=32.13  Aligned_cols=25  Identities=20%  Similarity=0.264  Sum_probs=20.3

Q ss_pred             hhhhhhcCCCCCCCCHHHHHHHHHH
Q psy10340         38 AFFAMHDLDGNHVWDEEEVKMLFLK   62 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~ai~~k   62 (98)
                      ..|...|.|++|.++..||..++.+
T Consensus        14 ~~F~~~D~d~~G~Is~~el~~~l~~   38 (96)
T smart00027       14 QIFRSLDKNQDGTVTGAQAKPILLK   38 (96)
T ss_pred             HHHHHhCCCCCCeEeHHHHHHHHHH
Confidence            5688888888888888888888753


No 22 
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13. S100A13 is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A13 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100A13 is involved in the cellular export of interleukin-1 (IL-1) and of fibroblast growth factor-1 (FGF-1), which plays an important role in angiogenesis and tissue regeneration. Export is based on the CuII-dependent formation of multiprotein complexes containing the S100A13 protein. Assembly of these complexes occurs near the inner surface of the plasma membrane. Binding of two Ca(II) ions per monomer triggers key conformational changes leading to the creation of two identical and symmetrical Cu(II)-binding sites on the surface of the protein, close to the interface between the two monomers. These Cu
Probab=91.52  E-value=0.2  Score=33.53  Aligned_cols=29  Identities=17%  Similarity=0.271  Sum_probs=26.0

Q ss_pred             hhhhhhhcC-CCCCCCCHHHHHHHHHHHhh
Q psy10340         37 KAFFAMHDL-DGNHVWDEEEVKMLFLKELD   65 (98)
Q Consensus        37 ~tFF~lHD~-n~DG~~d~~El~ai~~kEl~   65 (98)
                      +.-|...|. +++|+++..||+.++.+||-
T Consensus        11 ~~~F~~fd~~~~~g~i~~~ELk~ll~~elg   40 (89)
T cd05022          11 VSNFHKASVKGGKESLTASEFQELLTQQLP   40 (89)
T ss_pred             HHHHHHHhCCCCCCeECHHHHHHHHHHHhh
Confidence            356889999 99999999999999998874


No 23 
>PF13499 EF-hand_7:  EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E ....
Probab=91.39  E-value=0.18  Score=30.12  Aligned_cols=23  Identities=22%  Similarity=0.278  Sum_probs=20.6

Q ss_pred             hhhhhhcCCCCCCCCHHHHHHHH
Q psy10340         38 AFFAMHDLDGNHVWDEEEVKMLF   60 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~ai~   60 (98)
                      ..|...|.|+||.++-+|+.++|
T Consensus        44 ~~~~~~D~d~dG~i~~~Ef~~~~   66 (66)
T PF13499_consen   44 QIFREFDTDGDGRISFDEFLNFM   66 (66)
T ss_dssp             HHHHHHTTTSSSSEEHHHHHHHH
T ss_pred             HHHHHhCCCCcCCCcHHHHhccC
Confidence            45999999999999999998875


No 24 
>KOG0044|consensus
Probab=90.65  E-value=0.53  Score=36.04  Aligned_cols=29  Identities=24%  Similarity=0.283  Sum_probs=23.4

Q ss_pred             hhhhcCCCCCCCCHHHHHHHHHHHhhhhh
Q psy10340         40 FAMHDLDGNHVWDEEEVKMLFLKELDKMY   68 (98)
Q Consensus        40 F~lHD~n~DG~~d~~El~ai~~kEl~K~y   68 (98)
                      |.|.|+|+||+++.+|+..|+..=+..+.
T Consensus       106 F~lyD~dgdG~It~~Eml~iv~~i~~m~~  134 (193)
T KOG0044|consen  106 FRLYDLDGDGYITKEEMLKIVQAIYQMTG  134 (193)
T ss_pred             heeecCCCCceEcHHHHHHHHHHHHHHcc
Confidence            99999999999999998888774334444


No 25 
>KOG0039|consensus
Probab=89.20  E-value=0.44  Score=41.80  Aligned_cols=60  Identities=22%  Similarity=0.349  Sum_probs=44.4

Q ss_pred             CCCCCCCch--hhhhhhcCCCCCCCCHHHHHHHHHHHhhhhhCCCCCcchHHHHHHHHHHHHHHHhhhccc
Q psy10340         29 MGNTEFNPK--AFFAMHDLDGNHVWDEEEVKMLFLKELDKMYKEGMPQNDLMERAEERQTVFTGLFCSLRA   97 (98)
Q Consensus        29 i~~~~FDp~--tFF~lHD~n~DG~~d~~El~ai~~kEl~K~y~~~~~edd~~e~~eE~~rMRehv~~e~~~   97 (98)
                      +.+.+|||+  |||+|.|. ++|.++++|+..+...-+.    .+.    ....++.....+.++|.++|+
T Consensus        11 ~~~~~~d~~l~~~f~~~~~-~~~~~~~~~~~~~~~~~~~----~~~----~~~~~~~~~~~~~~~~~~~~~   72 (646)
T KOG0039|consen   11 ITDCSYDDKLQTFFDMYDK-GDGKLTEEEVRELIMSSIS----ANW----LSLIKKQTEEYAALIMEELDP   72 (646)
T ss_pred             ccCCChhHHHHHHHHHHhh-hcCCccHHHHHHHHHHHHH----hhh----hhhhhhhhhHHHHHhhhhccc
Confidence            888999999  99999999 9999999999888874222    111    223445556677777777764


No 26 
>KOG0031|consensus
Probab=89.05  E-value=0.57  Score=35.83  Aligned_cols=28  Identities=21%  Similarity=0.437  Sum_probs=24.6

Q ss_pred             hhhhhcCCCCCCCCHHHHHHHHHHHhhhh
Q psy10340         39 FFAMHDLDGNHVWDEEEVKMLFLKELDKM   67 (98)
Q Consensus        39 FF~lHD~n~DG~~d~~El~ai~~kEl~K~   67 (98)
                      -|.|.|.|+||+++.++|+..|. -|-|+
T Consensus        37 AF~~mDqnrDG~IdkeDL~d~~a-SlGk~   64 (171)
T KOG0031|consen   37 AFNLMDQNRDGFIDKEDLRDMLA-SLGKI   64 (171)
T ss_pred             HHHHHhccCCCcccHHHHHHHHH-HcCCC
Confidence            58999999999999999999998 36555


No 27 
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers.
Probab=87.97  E-value=0.77  Score=25.00  Aligned_cols=24  Identities=25%  Similarity=0.411  Sum_probs=21.4

Q ss_pred             hhhhhhcCCCCCCCCHHHHHHHHH
Q psy10340         38 AFFAMHDLDGNHVWDEEEVKMLFL   61 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~ai~~   61 (98)
                      ..|...|.|++|.++..|+..++.
T Consensus         4 ~~f~~~d~~~~g~l~~~e~~~~l~   27 (63)
T cd00051           4 EAFRLFDKDGDGTISADELKAALK   27 (63)
T ss_pred             HHHHHhCCCCCCcCcHHHHHHHHH
Confidence            468899999999999999988876


No 28 
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6. S100A6 is a member of the S100 domain family within EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100A6 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control . S100A6 is normally expressed in the G1 phase of the cell cycle in neuronal cells. The function of S100A6 remains unclear, but evidence suggests that it is involved in cell cycle regulation and exocytosis. S100A6 may also be involved in tumorigenesis; the protein is overexpressed in several tumors. Ca2+ binding to S100A6 leads to a conformational change in the protein, which exposes a hydrophobic surface for interact
Probab=87.82  E-value=1.3  Score=29.27  Aligned_cols=27  Identities=33%  Similarity=0.450  Sum_probs=22.4

Q ss_pred             hhhhhhcC-CC-CCCCCHHHHHHHHHHHh
Q psy10340         38 AFFAMHDL-DG-NHVWDEEEVKMLFLKEL   64 (98)
Q Consensus        38 tFF~lHD~-n~-DG~~d~~El~ai~~kEl   64 (98)
                      .-|...|. || +|+++.+||..++.+++
T Consensus        14 ~~F~~y~~~~~~~g~Is~~EL~~~l~~~~   42 (88)
T cd05029          14 AIFHKYSGREGDKNTLSKKELKELIQKEL   42 (88)
T ss_pred             HHHHHHHccCCCCCEECHHHHHHHHHHHH
Confidence            45777887 78 99999999999998653


No 29 
>KOG0027|consensus
Probab=84.89  E-value=1  Score=31.50  Aligned_cols=25  Identities=28%  Similarity=0.388  Sum_probs=20.9

Q ss_pred             hhhhhhhcCCCCCCCCHHHHHHHHH
Q psy10340         37 KAFFAMHDLDGNHVWDEEEVKMLFL   61 (98)
Q Consensus        37 ~tFF~lHD~n~DG~~d~~El~ai~~   61 (98)
                      +..|.+.|.|++|+++..||.+++.
T Consensus        11 ~~~F~~fD~d~~G~i~~~el~~~lr   35 (151)
T KOG0027|consen   11 KEAFQLFDKDGDGKISVEELGAVLR   35 (151)
T ss_pred             HHHHHHHCCCCCCcccHHHHHHHHH
Confidence            4578888999999999999888875


No 30 
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11. S100A11 is a member of the S-100 domain family within EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100A11 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control . S100 proteins have also been associated with a variety of pathological events, including neoplastic transformation and neurodegenerative diseases such as Alzheimer's, usually via over expression of the protein. S100A11 is expressed in smooth muscle and other tissues and involves in calcium-dependent membrane aggregation, which is important for cell vesiculation . As is the case for many other S100 proteins, S
Probab=84.62  E-value=2.2  Score=28.26  Aligned_cols=32  Identities=25%  Similarity=0.304  Sum_probs=25.6

Q ss_pred             hhhhh-hcCCCCC-CCCHHHHHHHHHHHhhhhhC
Q psy10340         38 AFFAM-HDLDGNH-VWDEEEVKMLFLKELDKMYK   69 (98)
Q Consensus        38 tFF~l-HD~n~DG-~~d~~El~ai~~kEl~K~y~   69 (98)
                      ..|.- -|.+|+| +|+.+|++.++.+|+-.+-.
T Consensus        13 ~~F~~y~~~dg~~~~Ls~~Elk~ll~~e~~~~~~   46 (89)
T cd05023          13 AVFQKYAGKDGDSYQLSKTEFLSFMNTELASFTK   46 (89)
T ss_pred             HHHHHHhccCCCcCeECHHHHHHHHHHhhhHhhc
Confidence            45665 6899987 99999999999999765443


No 31 
>PTZ00184 calmodulin; Provisional
Probab=82.49  E-value=1.2  Score=29.24  Aligned_cols=25  Identities=28%  Similarity=0.440  Sum_probs=22.1

Q ss_pred             hhhhhhhcCCCCCCCCHHHHHHHHH
Q psy10340         37 KAFFAMHDLDGNHVWDEEEVKMLFL   61 (98)
Q Consensus        37 ~tFF~lHD~n~DG~~d~~El~ai~~   61 (98)
                      +..|...|.|++|+++..|+..++.
T Consensus        87 ~~~F~~~D~~~~g~i~~~e~~~~l~  111 (149)
T PTZ00184         87 KEAFKVFDRDGNGFISAAELRHVMT  111 (149)
T ss_pred             HHHHHhhCCCCCCeEeHHHHHHHHH
Confidence            4688999999999999999988775


No 32 
>PF12763 EF-hand_4:  Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A ....
Probab=81.86  E-value=1.2  Score=30.65  Aligned_cols=19  Identities=26%  Similarity=0.443  Sum_probs=15.4

Q ss_pred             hhhhhhcCCCCCCCCHHHH
Q psy10340         38 AFFAMHDLDGNHVWDEEEV   56 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El   56 (98)
                      ..+.|.|.|.||+||.+|+
T Consensus        47 ~IW~LaD~~~dG~L~~~EF   65 (104)
T PF12763_consen   47 QIWNLADIDNDGKLDFEEF   65 (104)
T ss_dssp             HHHHHH-SSSSSEEEHHHH
T ss_pred             HHHhhhcCCCCCcCCHHHH
Confidence            4556999999999999994


No 33 
>PTZ00183 centrin; Provisional
Probab=81.02  E-value=1.8  Score=29.02  Aligned_cols=24  Identities=29%  Similarity=0.463  Sum_probs=19.4

Q ss_pred             hhhhhhcCCCCCCCCHHHHHHHHH
Q psy10340         38 AFFAMHDLDGNHVWDEEEVKMLFL   61 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~ai~~   61 (98)
                      ..|.++|.|++|.++..|+..++.
T Consensus        21 ~~F~~~D~~~~G~i~~~e~~~~l~   44 (158)
T PTZ00183         21 EAFDLFDTDGSGTIDPKELKVAMR   44 (158)
T ss_pred             HHHHHhCCCCCCcccHHHHHHHHH
Confidence            457888889999999999877665


No 34 
>PTZ00184 calmodulin; Provisional
Probab=80.68  E-value=2.1  Score=28.12  Aligned_cols=24  Identities=21%  Similarity=0.382  Sum_probs=19.8

Q ss_pred             hhhhhhcCCCCCCCCHHHHHHHHH
Q psy10340         38 AFFAMHDLDGNHVWDEEEVKMLFL   61 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~ai~~   61 (98)
                      .+|...|.|++|.++..|+..++.
T Consensus        15 ~~F~~~D~~~~G~i~~~e~~~~l~   38 (149)
T PTZ00184         15 EAFSLFDKDGDGTITTKELGTVMR   38 (149)
T ss_pred             HHHHHHcCCCCCcCCHHHHHHHHH
Confidence            678888999999999999887653


No 35 
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]
Probab=80.25  E-value=3.3  Score=30.98  Aligned_cols=39  Identities=18%  Similarity=0.324  Sum_probs=29.7

Q ss_pred             CccCCCCChHHHHHHHHhhcCCCCCCCCchhhhhhhcCCCCCCCCHHHHHHHH
Q psy10340          8 FQVHHPGSKKQLEEVWQEQDHMGNTEFNPKAFFAMHDLDGNHVWDEEEVKMLF   60 (98)
Q Consensus         8 ~ki~hPGSk~ql~evWeeed~i~~~~FDp~tFF~lHD~n~DG~~d~~El~ai~   60 (98)
                      .+..++-++.|+++.-              -=|.|-|.|+||.++..||..++
T Consensus         8 ~~~~~~~t~~qi~~lk--------------eaF~l~D~d~~G~I~~~el~~il   46 (160)
T COG5126           8 LLTFTQLTEEQIQELK--------------EAFQLFDRDSDGLIDRNELGKIL   46 (160)
T ss_pred             hhhcccCCHHHHHHHH--------------HHHHHhCcCCCCCCcHHHHHHHH
Confidence            3455566666665443              35889999999999999999997


No 36 
>smart00027 EH Eps15 homology domain. Pair of EF hand motifs that recognise proteins containing Asn-Pro-Phe (NPF) sequences.
Probab=79.85  E-value=3.2  Score=26.95  Aligned_cols=45  Identities=13%  Similarity=0.223  Sum_probs=34.2

Q ss_pred             ChHHHHHHHHhhcCCCCCCCCchhhhhhhcCCCCCCCCHHHHHHHHHH
Q psy10340         15 SKKQLEEVWQEQDHMGNTEFNPKAFFAMHDLDGNHVWDEEEVKMLFLK   62 (98)
Q Consensus        15 Sk~ql~evWeeed~i~~~~FDp~tFF~lHD~n~DG~~d~~El~ai~~k   62 (98)
                      |..+++.++.. .+++.+  ....+|.+.|.|++|.++-+|+.+++..
T Consensus        28 s~~el~~~l~~-~~~~~~--ev~~i~~~~d~~~~g~I~~~eF~~~~~~   72 (96)
T smart00027       28 TGAQAKPILLK-SGLPQT--LLAKIWNLADIDNDGELDKDEFALAMHL   72 (96)
T ss_pred             eHHHHHHHHHH-cCCCHH--HHHHHHHHhcCCCCCCcCHHHHHHHHHH
Confidence            67788888875 234321  2348999999999999999999988874


No 37 
>PTZ00183 centrin; Provisional
Probab=79.79  E-value=2.2  Score=28.60  Aligned_cols=24  Identities=17%  Similarity=0.097  Sum_probs=21.5

Q ss_pred             hhhhhhcCCCCCCCCHHHHHHHHH
Q psy10340         38 AFFAMHDLDGNHVWDEEEVKMLFL   61 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~ai~~   61 (98)
                      .-|.+.|.|++|+++..|+.+++.
T Consensus        94 ~~F~~~D~~~~G~i~~~e~~~~l~  117 (158)
T PTZ00183         94 KAFRLFDDDKTGKISLKNLKRVAK  117 (158)
T ss_pred             HHHHHhCCCCCCcCcHHHHHHHHH
Confidence            568999999999999999998876


No 38 
>KOG4223|consensus
Probab=79.70  E-value=1.1  Score=37.20  Aligned_cols=24  Identities=25%  Similarity=0.408  Sum_probs=21.4

Q ss_pred             hhhhhhcCCCCCCCCHHHHHHHHH
Q psy10340         38 AFFAMHDLDGNHVWDEEEVKMLFL   61 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~ai~~   61 (98)
                      .||.-+|+|+||+|+.+||+.-+.
T Consensus       245 ~F~~~~DknkDG~L~~dEl~~WI~  268 (325)
T KOG4223|consen  245 QFFEFRDKNKDGKLDGDELLDWIL  268 (325)
T ss_pred             HHHHHhhcCCCCccCHHHHhcccC
Confidence            899999999999999999985544


No 39 
>PF10591 SPARC_Ca_bdg:  Secreted protein acidic and rich in cysteine Ca binding region;  InterPro: IPR019577  This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins. SPARC proteins are down-regulated in various tumours and may have a tumour-suppressor function [, ]. Testican-3 appears to be a novel regulator that reduces the activity of matrix metalloproteinase (MMP) in adult T-cell leukemia (ATL) []. This cysteine-rich domain is responsible for the anti-spreading activity of human urothelial cells. This extracellular calcium-binding domain is rich in alpha-helices and contains two EF-hands that each coordinates one Ca2+ ion, forming a helix-loop-helix structure that not only drives the conformation of the protein but is also necessary for biological activity. The anti-spreading activity was dependent on the coordination of Ca2+ by a Glu residue at the Z position of EF-hand 2 []. ; GO: 0005509 calcium ion binding, 0007165 signal transduction, 0005578 proteinaceous extracellular matrix; PDB: 1BMO_A 1SRA_A 2V53_A 1NUB_B.
Probab=78.91  E-value=1.1  Score=30.96  Aligned_cols=21  Identities=19%  Similarity=0.275  Sum_probs=16.5

Q ss_pred             hhhhhhhcCCCCCCCCHHHHH
Q psy10340         37 KAFFAMHDLDGNHVWDEEEVK   57 (98)
Q Consensus        37 ~tFF~lHD~n~DG~~d~~El~   57 (98)
                      +.||.-+|.|+||.|+-.|--
T Consensus        91 ~~F~~~CD~n~d~~Is~~EW~  111 (113)
T PF10591_consen   91 RPFFRSCDVNKDGKISLDEWC  111 (113)
T ss_dssp             HHHHHHH-TT-SSSEEHHHHH
T ss_pred             HHHHHHcCCCCCCCCCHHHHc
Confidence            489999999999999998853


No 40 
>KOG2562|consensus
Probab=78.56  E-value=3.7  Score=35.90  Aligned_cols=38  Identities=24%  Similarity=0.456  Sum_probs=32.2

Q ss_pred             hhhhhhhcCCCCCCCCHHHHHHHHHHHhhhhhCCCCCc
Q psy10340         37 KAFFAMHDLDGNHVWDEEEVKMLFLKELDKMYKEGMPQ   74 (98)
Q Consensus        37 ~tFF~lHD~n~DG~~d~~El~ai~~kEl~K~y~~~~~e   74 (98)
                      .-.|..-|++|||+|+..||.-+|..-++++-.-+.+.
T Consensus       354 eYwFrclDld~~G~Lt~~el~~fyeeq~~rm~~~~~e~  391 (493)
T KOG2562|consen  354 EYWFRCLDLDGDGILTLNELRYFYEEQLQRMECMGQEA  391 (493)
T ss_pred             hhheeeeeccCCCcccHHHHHHHHHHHHHHHHhcCCCc
Confidence            36899999999999999999999998788877655543


No 41 
>PF00404 Dockerin_1:  Dockerin type I repeat;  InterPro: IPR018242 Gram-positive, thermophilic anaerobes such as Clostridium thermocellum or Clostridium cellulolyticum secretes a highly active and thermostable cellulase complex (cellulosome) responsible for the degradation of crystalline cellulose [, ]. The cellulosome contains at least 30 polypeptides, the majority of the enzymes are endoglucanases (3.2.1.4 from EC), but there are also some xylanases (3.2.1.8 from EC), beta-glucosidases (3.2.1.21 from EC) and endo-beta-1,3-1,4-glucanases (3.2.1.73 from EC). Complete sequence data for many of these enzymes has been obtained. A majority of these proteins contain a highly conserved type I dockerin domain of about 65 to 70 residues, which is generally (but not always) located in the C terminus. The dockerin domain is the binding partner of the cohesin domain (see IPR002102 from INTERPRO). The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome []. The dockerin domain contains a tandem repeat of two calcium-binding loop-helix motifs (distinct from EF-hand Ca-binding motifs). These motifs are about 24 amino acids in length. This entry represents these repeated Ca-binding motifs.; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 3P0D_J 1OHZ_B 2CCL_B 1DAV_A 1DAQ_A 2VN5_B 2VN6_B.
Probab=75.43  E-value=3.4  Score=21.50  Aligned_cols=16  Identities=19%  Similarity=0.464  Sum_probs=12.3

Q ss_pred             cCCCCCCCCHHHHHHH
Q psy10340         44 DLDGNHVWDEEEVKML   59 (98)
Q Consensus        44 D~n~DG~~d~~El~ai   59 (98)
                      |.|+||.++.-++.-+
T Consensus         1 DvN~DG~vna~D~~~l   16 (21)
T PF00404_consen    1 DVNGDGKVNAIDLALL   16 (21)
T ss_dssp             -TTSSSSSSHHHHHHH
T ss_pred             CCCCCCcCCHHHHHHH
Confidence            7899999999886543


No 42 
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]
Probab=74.03  E-value=5.5  Score=29.80  Aligned_cols=24  Identities=17%  Similarity=0.223  Sum_probs=21.5

Q ss_pred             hhhhhhcCCCCCCCCHHHHHHHHH
Q psy10340         38 AFFAMHDLDGNHVWDEEEVKMLFL   61 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~ai~~   61 (98)
                      --|.+.|.|+||+++..|+..+..
T Consensus        96 ~aF~~fD~d~dG~Is~~eL~~vl~  119 (160)
T COG5126          96 EAFKLFDKDHDGYISIGELRRVLK  119 (160)
T ss_pred             HHHHHhCCCCCceecHHHHHHHHH
Confidence            458899999999999999988876


No 43 
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10. S100A10 is a member of the S100 family of EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A1_like group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are expressed exclusively in vertebrates, and are implicated in intracellular and extracellular regulatory activities. A unique feature of S100A10 is that it contains mutation in both of the calcium binding sites, making it calcium insensitive. S100A10 has been detected in brain, heart, gastrointestinal tract, kidney, liver, lung, spleen, testes, epidermis, aorta, and thymus. Structural data supports the homo- and hetero-dimeric as well as hetero-tetrameric nature of the protein. S100A10 has multiple binding partners in its calcium free state and is therefore involved in many diverse biological functions.
Probab=73.80  E-value=7  Score=25.31  Aligned_cols=49  Identities=14%  Similarity=0.090  Sum_probs=33.3

Q ss_pred             CChHHHHHHHHhhc----CCCCCCCCchhhhhhhcCCCCCCCCHHHHHHHHHH
Q psy10340         14 GSKKQLEEVWQEQD----HMGNTEFNPKAFFAMHDLDGNHVWDEEEVKMLFLK   62 (98)
Q Consensus        14 GSk~ql~evWeeed----~i~~~~FDp~tFF~lHD~n~DG~~d~~El~ai~~k   62 (98)
                      .|.++|+.++...-    +.....=.-...|...|.|++|.++-+|+.+++..
T Consensus        27 Is~~El~~~l~~~~g~~lg~~~s~~ei~~~~~~~D~~~dg~I~f~eF~~l~~~   79 (94)
T cd05031          27 LSRKELKKLMEKELSEFLKNQKDPMAVDKIMKDLDQNRDGKVNFEEFVSLVAG   79 (94)
T ss_pred             ECHHHHHHHHHHHhHHHhhccccHHHHHHHHHHhCCCCCCcCcHHHHHHHHHH
Confidence            47788888876311    11111112347888889999999999999887763


No 44 
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z. S100Z is a member of the S100 domain family within the EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100Z group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately.S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control. S100Z is normally expressed in various tissues, with its highest level of expression being in spleen and leukocytes. The function of S100Z remains unclear. Preliminary structural data suggests that S100Z is homodimer, however a heterodimer with S100P has been reported. S100Z is capable of binding calcium ions. When calcium binds to S110Z,  the protein experiences a conformational change, which exposes hydrophobic surfac
Probab=72.97  E-value=5  Score=26.36  Aligned_cols=49  Identities=20%  Similarity=0.212  Sum_probs=33.5

Q ss_pred             CChHHHHHHHHhh--cCCCCCC--CCchhhhhhhcCCCCCCCCHHHHHHHHHH
Q psy10340         14 GSKKQLEEVWQEQ--DHMGNTE--FNPKAFFAMHDLDGNHVWDEEEVKMLFLK   62 (98)
Q Consensus        14 GSk~ql~evWeee--d~i~~~~--FDp~tFF~lHD~n~DG~~d~~El~ai~~k   62 (98)
                      .|+++|+.+=..+  .-++.+.  -.-...+.-.|.|+||.++.+|+.+++.+
T Consensus        29 Is~~EL~~ll~~~~~~~~~~~~~~~~v~~i~~elD~n~dG~Idf~EF~~l~~~   81 (93)
T cd05026          29 LSKGELKELLQRELTDFLSSQKDPMLVDKIMNDLDSNKDNEVDFNEFVVLVAA   81 (93)
T ss_pred             ECHHHHHHHHHHHhHHhcccccCHHHHHHHHHHhCCCCCCCCCHHHHHHHHHH
Confidence            4889998884321  1122111  12337788889999999999999888864


No 45 
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10. S100A10 is a member of the S100 family of EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A10 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are expressed exclusively in vertebrates, and are implicated in intracellular and extracellular regulatory activities. A unique feature of S100A10 is that it contains mutation in both of the calcium binding sites, making it calcium insensitive. S100A10 has been detected in brain, heart, gastrointestinal tract, kidney, liver, lung, spleen, testes, epidermis, aorta, and thymus. Structural data supports the homo- and hetero-dimeric as well as hetero-tetrameric nature of the protein. S100A10 has multiple binding partners in its calcium free state and is therefore involved in many diverse biological functions.
Probab=70.43  E-value=13  Score=25.41  Aligned_cols=48  Identities=10%  Similarity=0.054  Sum_probs=32.8

Q ss_pred             CChHHHHHHHHhhc-C-CCCCCCCch---hhhhhhcCCCCCCCCHHHHHHHHHH
Q psy10340         14 GSKKQLEEVWQEQD-H-MGNTEFNPK---AFFAMHDLDGNHVWDEEEVKMLFLK   62 (98)
Q Consensus        14 GSk~ql~evWeeed-~-i~~~~FDp~---tFF~lHD~n~DG~~d~~El~ai~~k   62 (98)
                      -||.+|++.=..+- . +.. .=||.   ..|..-|.|+||.++-+|.-.++.+
T Consensus        24 Lsk~Elk~Ll~~Elp~~l~~-~~d~~~vd~im~~LD~n~Dg~vdF~EF~~Lv~~   76 (91)
T cd05024          24 LNRDDLQKLMEKEFSEFLKN-QNDPMAVDKIMKDLDDCRDGKVGFQSFFSLIAG   76 (91)
T ss_pred             CCHHHHHHHHHHHhHHHHcC-CCCHHHHHHHHHHhCCCCCCcCcHHHHHHHHHH
Confidence            46777776643221 1 222 22666   6788889999999999998888763


No 46 
>KOG0028|consensus
Probab=69.37  E-value=7.7  Score=29.79  Aligned_cols=45  Identities=31%  Similarity=0.407  Sum_probs=34.6

Q ss_pred             hhhhhhhcCCCCCCCCHHHHHHHHHHHhhhhhCCCCCcchHHHHHHHHHH
Q psy10340         37 KAFFAMHDLDGNHVWDEEEVKMLFLKELDKMYKEGMPQNDLMERAEERQT   86 (98)
Q Consensus        37 ~tFF~lHD~n~DG~~d~~El~ai~~kEl~K~y~~~~~edd~~e~~eE~~r   86 (98)
                      +.-|.+-|.+.+|.|+..+|..+- +||-    ++-++.+.++|-+|.-|
T Consensus       109 ~~afrl~D~D~~Gkis~~~lkrva-keLg----enltD~El~eMIeEAd~  153 (172)
T KOG0028|consen  109 KKAFRLFDDDKTGKISQRNLKRVA-KELG----ENLTDEELMEMIEEADR  153 (172)
T ss_pred             HHHHHcccccCCCCcCHHHHHHHH-HHhC----ccccHHHHHHHHHHhcc
Confidence            367889999999999999988764 3564    77777788888777543


No 47 
>KOG4251|consensus
Probab=69.32  E-value=2.5  Score=35.09  Aligned_cols=34  Identities=29%  Similarity=0.353  Sum_probs=25.2

Q ss_pred             CCCCCCCCchhhhhhhcCCCCCCCCHHHHHHHHH
Q psy10340         28 HMGNTEFNPKAFFAMHDLDGNHVWDEEEVKMLFL   61 (98)
Q Consensus        28 ~i~~~~FDp~tFF~lHD~n~DG~~d~~El~ai~~   61 (98)
                      |+....=+++|||...|.||||.++=+|.+--|.
T Consensus       134 HfqeameeSkthFraVDpdgDGhvsWdEykvkFl  167 (362)
T KOG4251|consen  134 HFQEAMEESKTHFRAVDPDGDGHVSWDEYKVKFL  167 (362)
T ss_pred             HHHHHHhhhhhheeeeCCCCCCceehhhhhhHHH
Confidence            3333344688999999999999877777665555


No 48 
>PF10591 SPARC_Ca_bdg:  Secreted protein acidic and rich in cysteine Ca binding region;  InterPro: IPR019577  This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins. SPARC proteins are down-regulated in various tumours and may have a tumour-suppressor function [, ]. Testican-3 appears to be a novel regulator that reduces the activity of matrix metalloproteinase (MMP) in adult T-cell leukemia (ATL) []. This cysteine-rich domain is responsible for the anti-spreading activity of human urothelial cells. This extracellular calcium-binding domain is rich in alpha-helices and contains two EF-hands that each coordinates one Ca2+ ion, forming a helix-loop-helix structure that not only drives the conformation of the protein but is also necessary for biological activity. The anti-spreading activity was dependent on the coordination of Ca2+ by a Glu residue at the Z position of EF-hand 2 []. ; GO: 0005509 calcium ion binding, 0007165 signal transduction, 0005578 proteinaceous extracellular matrix; PDB: 1BMO_A 1SRA_A 2V53_A 1NUB_B.
Probab=68.97  E-value=0.64  Score=32.22  Aligned_cols=23  Identities=30%  Similarity=0.270  Sum_probs=16.4

Q ss_pred             hhhhhcCCCCCCCCHHHHHHHHH
Q psy10340         39 FFAMHDLDGNHVWDEEEVKMLFL   61 (98)
Q Consensus        39 FF~lHD~n~DG~~d~~El~ai~~   61 (98)
                      -|.--|.|+||+|+..||..|..
T Consensus        59 ~F~~LD~n~d~~L~~~El~~l~~   81 (113)
T PF10591_consen   59 KFCQLDRNKDGVLDRSELKPLRR   81 (113)
T ss_dssp             HHHHH--T-SSEE-TTTTGGGGS
T ss_pred             hHhhhcCCCCCccCHHHHHHHHH
Confidence            48888999999999999988765


No 49 
>KOG2643|consensus
Probab=68.21  E-value=3.1  Score=36.25  Aligned_cols=24  Identities=42%  Similarity=0.526  Sum_probs=20.6

Q ss_pred             hhhhhhcCCCCCCCCHHHHHHHHH
Q psy10340         38 AFFAMHDLDGNHVWDEEEVKMLFL   61 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~ai~~   61 (98)
                      .=|+|.|+||||-+|.+|++.+.+
T Consensus       237 IAFKMFD~dgnG~IdkeEF~~v~~  260 (489)
T KOG2643|consen  237 IAFKMFDLDGNGEIDKEEFETVQQ  260 (489)
T ss_pred             eeeeeeecCCCCcccHHHHHHHHH
Confidence            447899999999999999887763


No 50 
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional
Probab=67.07  E-value=5.7  Score=33.24  Aligned_cols=20  Identities=35%  Similarity=0.501  Sum_probs=18.6

Q ss_pred             hhhhhhcCCCCCCCCHHHHH
Q psy10340         38 AFFAMHDLDGNHVWDEEEVK   57 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~   57 (98)
                      ..|.+.|.|+||.++.+|+.
T Consensus       338 ~aF~~~D~dgdG~Is~~E~~  357 (391)
T PRK12309        338 EIFRLYDLDGDGFITREEWL  357 (391)
T ss_pred             HHHHHhCCCCCCcCcHHHHH
Confidence            78999999999999999985


No 51 
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11. S100A11 is a member of the S-100 domain family within EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100A11 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control . S100 proteins have also been associated with a variety of pathological events, including neoplastic transformation and neurodegenerative diseases such as Alzheimer's, usually via over expression of the protein. S100A11 is expressed in smooth muscle and other tissues and involves in calcium-dependent membrane aggregation, which is important for cell vesiculation . As is the case for many other S100 proteins, S
Probab=66.29  E-value=8.1  Score=25.51  Aligned_cols=48  Identities=19%  Similarity=0.144  Sum_probs=33.0

Q ss_pred             CChHHHHHHHHhhc--CCCCCCCCc---hhhhhhhcCCCCCCCCHHHHHHHHHH
Q psy10340         14 GSKKQLEEVWQEQD--HMGNTEFNP---KAFFAMHDLDGNHVWDEEEVKMLFLK   62 (98)
Q Consensus        14 GSk~ql~evWeeed--~i~~~~FDp---~tFF~lHD~n~DG~~d~~El~ai~~k   62 (98)
                      .|+++|+.+=..+-  .+.. .=++   ...|.-.|.|+||.++-+|+-.++.+
T Consensus        28 Ls~~Elk~ll~~e~~~~~~~-~~~~~~~~~ll~~~D~d~DG~I~f~EF~~l~~~   80 (89)
T cd05023          28 LSKTEFLSFMNTELASFTKN-QKDPGVLDRMMKKLDLNSDGQLDFQEFLNLIGG   80 (89)
T ss_pred             ECHHHHHHHHHHhhhHhhcC-CCCHHHHHHHHHHcCCCCCCcCcHHHHHHHHHH
Confidence            58888888865331  1111 1122   36788889999999999999887763


No 52 
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6. S100A6 is a member of the S100 domain family within EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100A6 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control . S100A6 is normally expressed in the G1 phase of the cell cycle in neuronal cells. The function of S100A6 remains unclear, but evidence suggests that it is involved in cell cycle regulation and exocytosis. S100A6 may also be involved in tumorigenesis; the protein is overexpressed in several tumors. Ca2+ binding to S100A6 leads to a conformational change in the protein, which exposes a hydrophobic surface for interact
Probab=65.64  E-value=15  Score=24.08  Aligned_cols=53  Identities=21%  Similarity=0.263  Sum_probs=35.3

Q ss_pred             CChHHHHHHHHhhcCCCCCCCCc---hhhhhhhcCCCCCCCCHHHHHHHHHHHhhhhh
Q psy10340         14 GSKKQLEEVWQEQDHMGNTEFNP---KAFFAMHDLDGNHVWDEEEVKMLFLKELDKMY   68 (98)
Q Consensus        14 GSk~ql~evWeeed~i~~~~FDp---~tFF~lHD~n~DG~~d~~El~ai~~kEl~K~y   68 (98)
                      .|+++|+.+...+-.+. ...++   ...|.--|.|+||.++-+|+..++.+ |-+.|
T Consensus        29 Is~~EL~~~l~~~~~lg-~k~t~~ev~~m~~~~D~d~dG~Idf~EFv~lm~~-l~~~~   84 (88)
T cd05029          29 LSKKELKELIQKELTIG-SKLQDAEIAKLMEDLDRNKDQEVNFQEYVTFLGA-LALIY   84 (88)
T ss_pred             ECHHHHHHHHHHHHhcC-CCCCHHHHHHHHHHhcCCCCCCCcHHHHHHHHHH-HHHHH
Confidence            47888998885321111 12222   36677779999999999999888773 54444


No 53 
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13. S100A13 is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A13 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100A13 is involved in the cellular export of interleukin-1 (IL-1) and of fibroblast growth factor-1 (FGF-1), which plays an important role in angiogenesis and tissue regeneration. Export is based on the CuII-dependent formation of multiprotein complexes containing the S100A13 protein. Assembly of these complexes occurs near the inner surface of the plasma membrane. Binding of two Ca(II) ions per monomer triggers key conformational changes leading to the creation of two identical and symmetrical Cu(II)-binding sites on the surface of the protein, close to the interface between the two monomers. These Cu
Probab=64.34  E-value=9.3  Score=25.42  Aligned_cols=48  Identities=13%  Similarity=0.075  Sum_probs=33.5

Q ss_pred             CChHHHHHHHHhh--cCCCCCCCCchhhhhhhcCCCCCCCCHHHHHHHHHH
Q psy10340         14 GSKKQLEEVWQEQ--DHMGNTEFNPKAFFAMHDLDGNHVWDEEEVKMLFLK   62 (98)
Q Consensus        14 GSk~ql~evWeee--d~i~~~~FDp~tFF~lHD~n~DG~~d~~El~ai~~k   62 (98)
                      .|+++|+.+=..+  .-+++. =+-.-.|.-.|.|+||.++-+|...++.+
T Consensus        26 i~~~ELk~ll~~elg~~ls~~-~~v~~mi~~~D~d~DG~I~F~EF~~l~~~   75 (89)
T cd05022          26 LTASEFQELLTQQLPHLLKDV-EGLEEKMKNLDVNQDSKLSFEEFWELIGE   75 (89)
T ss_pred             ECHHHHHHHHHHHhhhhccCH-HHHHHHHHHhCCCCCCCCcHHHHHHHHHH
Confidence            3677787775532  124421 12346778889999999999999888875


No 54 
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10. S100A10 is a member of the S100 family of EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A10 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are expressed exclusively in vertebrates, and are implicated in intracellular and extracellular regulatory activities. A unique feature of S100A10 is that it contains mutation in both of the calcium binding sites, making it calcium insensitive. S100A10 has been detected in brain, heart, gastrointestinal tract, kidney, liver, lung, spleen, testes, epidermis, aorta, and thymus. Structural data supports the homo- and hetero-dimeric as well as hetero-tetrameric nature of the protein. S100A10 has multiple binding partners in its calcium free state and is therefore involved in many diverse biological functions.
Probab=62.78  E-value=17  Score=24.90  Aligned_cols=27  Identities=15%  Similarity=0.313  Sum_probs=22.4

Q ss_pred             CCCCCCCHHHHHHHHHHHhhhhhCCCC
Q psy10340         46 DGNHVWDEEEVKMLFLKELDKMYKEGM   72 (98)
Q Consensus        46 n~DG~~d~~El~ai~~kEl~K~y~~~~   72 (98)
                      -..|.|+..|++.++.+||-.+-....
T Consensus        19 G~~~tLsk~Elk~Ll~~Elp~~l~~~~   45 (91)
T cd05024          19 GEKNYLNRDDLQKLMEKEFSEFLKNQN   45 (91)
T ss_pred             CCCCcCCHHHHHHHHHHHhHHHHcCCC
Confidence            345699999999999999998776644


No 55 
>PLN02964 phosphatidylserine decarboxylase
Probab=61.97  E-value=20  Score=32.13  Aligned_cols=24  Identities=21%  Similarity=0.182  Sum_probs=21.1

Q ss_pred             hhhhhhcCCCCCCCCHHHHHHHHH
Q psy10340         38 AFFAMHDLDGNHVWDEEEVKMLFL   61 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~ai~~   61 (98)
                      ..|...|.|+||.++-+|+.+++.
T Consensus       183 ~mf~~~D~DgdG~IdfdEFl~lL~  206 (644)
T PLN02964        183 RILAIVDYDEDGQLSFSEFSDLIK  206 (644)
T ss_pred             HHHHHhCCCCCCeEcHHHHHHHHH
Confidence            567888999999999999988886


No 56 
>PLN02964 phosphatidylserine decarboxylase
Probab=61.79  E-value=8.1  Score=34.55  Aligned_cols=26  Identities=27%  Similarity=0.442  Sum_probs=24.0

Q ss_pred             hhhhhhhcCCCCCCCCHHHHHHHHHH
Q psy10340         37 KAFFAMHDLDGNHVWDEEEVKMLFLK   62 (98)
Q Consensus        37 ~tFF~lHD~n~DG~~d~~El~ai~~k   62 (98)
                      +.+|...|.|+||+++.+||.+++..
T Consensus       218 ~eaFk~fDkDgdG~Is~dEL~~vL~~  243 (644)
T PLN02964        218 EELFKAADLNGDGVVTIDELAALLAL  243 (644)
T ss_pred             HHHHHHhCCCCCCcCCHHHHHHHHHh
Confidence            47899999999999999999999886


No 57 
>PF10197 Cir_N:  N-terminal domain of CBF1 interacting co-repressor CIR;  InterPro: IPR019339  This entry represents a 45 residue conserved region at the N-terminal end of a family of proteins referred to as CIRs (CBF1-interacting co-repressors). CBF1 (centromere-binding factor 1) acts as a transcription factor that causes repression by binding specifically to GTGGGAA motifs in responsive promoters, and it requires CIR as a co-repressor. CIR binds to histone deacetylase and to SAP30 and serves as a linker between CBF1 and the histone deacetylase complex []. It may also modulate splice site selection during alternative splicing of pre-mRNAs.
Probab=61.63  E-value=6.5  Score=22.77  Aligned_cols=14  Identities=57%  Similarity=1.182  Sum_probs=13.0

Q ss_pred             CCCCChHHHHHHHH
Q psy10340         11 HHPGSKKQLEEVWQ   24 (98)
Q Consensus        11 ~hPGSk~ql~evWe   24 (98)
                      .|||+..-.+.||.
T Consensus         2 wHP~~~~Nq~kVw~   15 (37)
T PF10197_consen    2 WHPGNKKNQEKVWK   15 (37)
T ss_pred             CCCCcchHHHHHHH
Confidence            59999999999998


No 58 
>KOG1029|consensus
Probab=60.47  E-value=7  Score=36.71  Aligned_cols=29  Identities=24%  Similarity=0.509  Sum_probs=23.7

Q ss_pred             hhhhhhcCCCCCCCCHHH-HHHHHHHHhhh
Q psy10340         38 AFFAMHDLDGNHVWDEEE-VKMLFLKELDK   66 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~E-l~ai~~kEl~K   66 (98)
                      +-..|.|.|+||.|+.+| |.|+|.-|.-|
T Consensus       233 ~IW~LsDvd~DGkL~~dEfilam~liema~  262 (1118)
T KOG1029|consen  233 HIWTLSDVDGDGKLSADEFILAMHLIEMAK  262 (1118)
T ss_pred             hheeeeccCCCCcccHHHHHHHHHHHHHHh
Confidence            455689999999999999 88998866443


No 59 
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 . Note that the S-100 hierarchy, to which this Calgranulin group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. These proteins are expressed mainly in granulocytes, and are involved in inflammation, allergy, and neuritogenesis, as well as in host-parasite response. Calgranulins are modulated not only by calcium, but also by other metals such as zinc and copper. Structural data suggested that calgranulins may exist in  multiple structural forms, homodimers, as well as hetero-oligomers. For example, the S100A8/S100A9 complex called calprotectin plays important roles in the regulation of inflammatory processes, wound repair, and regulating zinc-dependent enzymes as well as microbial growth.
Probab=59.85  E-value=13  Score=24.18  Aligned_cols=53  Identities=17%  Similarity=0.159  Sum_probs=34.2

Q ss_pred             CChHHHHHHHHhhc--CCCCCCCC---chhhhhhhcCCCCCCCCHHHHHHHHHHHhhhhh
Q psy10340         14 GSKKQLEEVWQEQD--HMGNTEFN---PKAFFAMHDLDGNHVWDEEEVKMLFLKELDKMY   68 (98)
Q Consensus        14 GSk~ql~evWeeed--~i~~~~FD---p~tFF~lHD~n~DG~~d~~El~ai~~kEl~K~y   68 (98)
                      .|++.|+.+=...-  .++ ...+   -...|...|.|+||.++-+|+..++. .+-+.|
T Consensus        27 Is~~El~~ll~~~~g~~~t-~~~~~~~v~~i~~~~D~d~dG~I~f~eF~~~~~-~~~~~~   84 (88)
T cd05030          27 LYKKEFKQLVEKELPNFLK-KEKNQKAIDKIFEDLDTNQDGQLSFEEFLVLVI-KVGVAA   84 (88)
T ss_pred             CCHHHHHHHHHHHhhHhhc-cCCCHHHHHHHHHHcCCCCCCcCcHHHHHHHHH-HHHHHh
Confidence            56777777754211  111 1111   23688888999999999999998877 344444


No 60 
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1. S100A1 is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A1 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. As is the case with many other members of S100 protein family, S100A1 is implicated in intracellular and extracellular regulatory activities, including interaction with myosin-associated twitchin kinase, actin-capping protein CapZ, sinapsin I, and tubulin. Structural data suggests that S100A1 proteins exist within cells as antiparallel homodimers, while heterodimers  with S100A4 and S100B also has been reported. Upon binding calcium S100A1 changes conformation to expose a hydrophobic cleft which is the interaction site of S100A1 with its more that 20 known target  proteins.
Probab=58.63  E-value=14  Score=23.64  Aligned_cols=49  Identities=22%  Similarity=0.209  Sum_probs=33.7

Q ss_pred             CChHHHHHHHHh-h-cCC--CCCCCCchhhhhhhcCCCCCCCCHHHHHHHHHH
Q psy10340         14 GSKKQLEEVWQE-Q-DHM--GNTEFNPKAFFAMHDLDGNHVWDEEEVKMLFLK   62 (98)
Q Consensus        14 GSk~ql~evWee-e-d~i--~~~~FDp~tFF~lHD~n~DG~~d~~El~ai~~k   62 (98)
                      .|+.+|+.+... . .-+  .+..=.....|...|.|++|.++-+|+..++.+
T Consensus        28 Is~~El~~~l~~~lg~~~~~~~s~~~v~~i~~~~D~d~~G~I~f~eF~~l~~~   80 (92)
T cd05025          28 LSKKELKDLLQTELSDFLDAQKDADAVDKIMKELDENGDGEVDFQEFVVLVAA   80 (92)
T ss_pred             ECHHHHHHHHHHHHHHHccCCCCHHHHHHHHHHHCCCCCCcCcHHHHHHHHHH
Confidence            567888888642 1 101  111223448899999999999999999888763


No 61 
>KOG0031|consensus
Probab=57.65  E-value=17  Score=27.95  Aligned_cols=25  Identities=24%  Similarity=0.333  Sum_probs=22.4

Q ss_pred             hhhhhhcCCCCCCCCHHHHHHHHHH
Q psy10340         38 AFFAMHDLDGNHVWDEEEVKMLFLK   62 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~ai~~k   62 (98)
                      .-|.+.|.+++|.++++.|+++++.
T Consensus       105 ~AF~~FD~~~~G~I~~d~lre~Ltt  129 (171)
T KOG0031|consen  105 NAFKTFDDEGSGKIDEDYLRELLTT  129 (171)
T ss_pred             HHHHhcCccCCCccCHHHHHHHHHH
Confidence            5688999999999999999999874


No 62 
>KOG0044|consensus
Probab=57.39  E-value=9.6  Score=29.17  Aligned_cols=25  Identities=16%  Similarity=0.013  Sum_probs=22.4

Q ss_pred             hhhhhhcCCCCCCCCHHHHHHHHHH
Q psy10340         38 AFFAMHDLDGNHVWDEEEVKMLFLK   62 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~ai~~k   62 (98)
                      .+|...|.|.||.+|-+|+.....+
T Consensus       151 ~if~k~D~n~Dg~lT~eef~~~~~~  175 (193)
T KOG0044|consen  151 KIFSKMDKNKDGKLTLEEFIEGCKA  175 (193)
T ss_pred             HHHHHcCCCCCCcccHHHHHHHhhh
Confidence            8999999999999999998877664


No 63 
>KOG4223|consensus
Probab=57.15  E-value=13  Score=31.08  Aligned_cols=45  Identities=20%  Similarity=0.182  Sum_probs=32.2

Q ss_pred             HHhhcCCCCCC--CCchhhhhhhcCCCCCCCCHHHHHHHHHHHhhhh
Q psy10340         23 WQEQDHMGNTE--FNPKAFFAMHDLDGNHVWDEEEVKMLFLKELDKM   67 (98)
Q Consensus        23 Weeed~i~~~~--FDp~tFF~lHD~n~DG~~d~~El~ai~~kEl~K~   67 (98)
                      =.+.+.+.+.+  ..-..+|.+.|.|+||+++..||.+-+.....|.
T Consensus        64 ~~~fd~l~~ee~~~rl~~l~~~iD~~~Dgfv~~~El~~wi~~s~k~~  110 (325)
T KOG4223|consen   64 ADEFDQLTPEESQERLGKLVPKIDSDSDGFVTESELKAWIMQSQKKY  110 (325)
T ss_pred             hhhhhhhCcchhHHHHHHHHhhhcCCCCCceeHHHHHHHHHHHHHHH
Confidence            33556666544  1112899999999999999999998887554443


No 64 
>KOG0030|consensus
Probab=54.65  E-value=44  Score=25.24  Aligned_cols=58  Identities=17%  Similarity=0.102  Sum_probs=37.4

Q ss_pred             hhhhhhhcCCCCCCCCHHHHH---HHH-----HHHhhhhhCCCCCc--chHHHHHHHHHHHHHHHhhh
Q psy10340         37 KAFFAMHDLDGNHVWDEEEVK---MLF-----LKELDKMYKEGMPQ--NDLMERAEERQTVFTGLFCS   94 (98)
Q Consensus        37 ~tFF~lHD~n~DG~~d~~El~---ai~-----~kEl~K~y~~~~~e--dd~~e~~eE~~rMRehv~~e   94 (98)
                      +--|.|+|.++||.++...+-   +..     ..||.|+-..-..+  .-.+--=|+...|.++|-++
T Consensus        14 ke~F~lfD~~gD~ki~~~q~gdvlRalG~nPT~aeV~k~l~~~~~~~~~~~rl~FE~fLpm~q~vakn   81 (152)
T KOG0030|consen   14 KEAFLLFDRTGDGKISGSQVGDVLRALGQNPTNAEVLKVLGQPKRREMNVKRLDFEEFLPMYQQVAKN   81 (152)
T ss_pred             HHHHHHHhccCcccccHHHHHHHHHHhcCCCcHHHHHHHHcCcccchhhhhhhhHHHHHHHHHHHHhc
Confidence            367999999999999987743   333     23566655433322  11333447778888888766


No 65 
>KOG2643|consensus
Probab=52.64  E-value=25  Score=30.83  Aligned_cols=36  Identities=8%  Similarity=0.202  Sum_probs=28.8

Q ss_pred             hhhhhhcCCCCCCCCHHHHHHHHHHHhhh-hhCCCCC
Q psy10340         38 AFFAMHDLDGNHVWDEEEVKMLFLKELDK-MYKEGMP   73 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~ai~~kEl~K-~y~~~~~   73 (98)
                      +.|.+.|.|+||.|+..|..++.-.=+.. +-.|.+.
T Consensus       429 vvF~IFD~N~Dg~LS~~EFl~Vmk~Rmhrgl~~p~~~  465 (489)
T KOG2643|consen  429 VVFTIFDENNDGTLSHKEFLAVMKRRMHRGLELPKDT  465 (489)
T ss_pred             eEEEEEccCCCCcccHHHHHHHHHHHhhccccCCccc
Confidence            66888899999999999999998876666 5555443


No 66 
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional
Probab=52.61  E-value=13  Score=31.10  Aligned_cols=25  Identities=24%  Similarity=0.234  Sum_probs=22.3

Q ss_pred             hhhhhhhcCCCCCCCCHHHHHHHHH
Q psy10340         37 KAFFAMHDLDGNHVWDEEEVKMLFL   61 (98)
Q Consensus        37 ~tFF~lHD~n~DG~~d~~El~ai~~   61 (98)
                      ...|...|.|+||.++.+|+..++.
T Consensus       360 ~~~F~~~D~d~DG~Is~eEf~~~~~  384 (391)
T PRK12309        360 DAVFDALDLNHDGKITPEEMRAGLG  384 (391)
T ss_pred             HHHHHHhCCCCCCCCcHHHHHHHHH
Confidence            4678999999999999999998875


No 67 
>KOG0041|consensus
Probab=51.72  E-value=14  Score=29.75  Aligned_cols=25  Identities=28%  Similarity=0.300  Sum_probs=22.5

Q ss_pred             hhhhhhcCCCCCCCCHHHHHHHHHH
Q psy10340         38 AFFAMHDLDGNHVWDEEEVKMLFLK   62 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~ai~~k   62 (98)
                      +-|+..|.+.||++|-.||+.+..|
T Consensus       103 ~~Fk~yDe~rDgfIdl~ELK~mmEK  127 (244)
T KOG0041|consen  103 SMFKQYDEDRDGFIDLMELKRMMEK  127 (244)
T ss_pred             HHHHHhcccccccccHHHHHHHHHH
Confidence            6789999999999999999988764


No 68 
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B. S100B is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100B group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100B is most abundant in glial cells of the central nervous system, predominately in astrocytes. S100B is involved in signal transduction via the inhibition of protein phoshorylation, regulation of enzyme activity and by affecting the calcium homeostasis. Upon calcium binding the S100B homodimer changes conformation to expose a hydrophobic cleft, which represents the interaction site of S100B with its more than 20 known target  proteins. These target proteins include several cellular architecture proteins such as tubulin and GFAP; S100B can inhibit polymerization of these oligomeric molecules. Furthermore, S100B i
Probab=49.91  E-value=22  Score=23.34  Aligned_cols=26  Identities=19%  Similarity=0.190  Sum_probs=22.3

Q ss_pred             hhhhhhhcCCCCCCCCHHHHHHHHHH
Q psy10340         37 KAFFAMHDLDGNHVWDEEEVKMLFLK   62 (98)
Q Consensus        37 ~tFF~lHD~n~DG~~d~~El~ai~~k   62 (98)
                      ..++.-.|.|+||.++-+|+..++..
T Consensus        54 ~~~i~~~D~n~dG~v~f~eF~~li~~   79 (88)
T cd05027          54 DKVMETLDSDGDGECDFQEFMAFVAM   79 (88)
T ss_pred             HHHHHHhCCCCCCcCcHHHHHHHHHH
Confidence            47888889999999999999888763


No 69 
>KOG1707|consensus
Probab=48.56  E-value=14  Score=33.24  Aligned_cols=24  Identities=33%  Similarity=0.434  Sum_probs=22.1

Q ss_pred             hhhhhhcCCCCCCCCHHHHHHHHH
Q psy10340         38 AFFAMHDLDGNHVWDEEEVKMLFL   61 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~ai~~   61 (98)
                      .-|..+|.|+||-|+.+|+.++|.
T Consensus       319 ~~f~~~D~d~Dg~L~p~El~~LF~  342 (625)
T KOG1707|consen  319 DVFEKFDRDNDGALSPEELKDLFS  342 (625)
T ss_pred             HHHHhccCCCCCCcCHHHHHHHhh
Confidence            457899999999999999999997


No 70 
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 . Note that the S-100 hierarchy, to which this Calgranulin group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. These proteins are expressed mainly in granulocytes, and are involved in inflammation, allergy, and neuritogenesis, as well as in host-parasite response. Calgranulins are modulated not only by calcium, but also by other metals such as zinc and copper. Structural data suggested that calgranulins may exist in  multiple structural forms, homodimers, as well as hetero-oligomers. For example, the S100A8/S100A9 complex called calprotectin plays important roles in the regulation of inflammatory processes, wound repair, and regulating zinc-dependent enzymes as well as microbial growth.
Probab=47.58  E-value=55  Score=21.09  Aligned_cols=27  Identities=26%  Similarity=0.241  Sum_probs=19.3

Q ss_pred             hhhhhcCC--CCCCCCHHHHHHHHHHHhh
Q psy10340         39 FFAMHDLD--GNHVWDEEEVKMLFLKELD   65 (98)
Q Consensus        39 FF~lHD~n--~DG~~d~~El~ai~~kEl~   65 (98)
                      -|.-++.+  .+|+++.+||..++.+++-
T Consensus        13 ~f~~y~~~~~~~~~Is~~El~~ll~~~~g   41 (88)
T cd05030          13 VFHQYSVRKGHPDTLYKKEFKQLVEKELP   41 (88)
T ss_pred             HHHHHhccCCCcccCCHHHHHHHHHHHhh
Confidence            34444433  4799999999999986543


No 71 
>COG5533 UBP5 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]
Probab=47.33  E-value=22  Score=30.42  Aligned_cols=57  Identities=19%  Similarity=0.345  Sum_probs=48.1

Q ss_pred             CCCchhhhhhh-----cCCCCCCCCHHHHHHHHHHHhhhhhCCCCCcchHHHHHHHHHHHHH
Q psy10340         33 EFNPKAFFAMH-----DLDGNHVWDEEEVKMLFLKELDKMYKEGMPQNDLMERAEERQTVFT   89 (98)
Q Consensus        33 ~FDp~tFF~lH-----D~n~DG~~d~~El~ai~~kEl~K~y~~~~~edd~~e~~eE~~rMRe   89 (98)
                      +-.|+-|-...     ++++||.-|.+|+...|..=|+.--+.+.+-.-..+..+|-++|||
T Consensus       140 sis~~nF~~i~~~~n~~fs~dmQqD~qEFl~fflD~LHedln~N~Srs~i~~l~de~e~~Re  201 (415)
T COG5533         140 SISPRNFIDILSGRNKLFSGDMQQDSQEFLIFFLDLLHEDLNGNKSRSPILELKDEFEEVRE  201 (415)
T ss_pred             ccchHHHHHHHccccccccccchhhHHHHHHHHHHHHHhhhcCCcccccccccchHHHHHHh
Confidence            34466688866     6899999999999999988788777788887778899999999999


No 72 
>PF01234 NNMT_PNMT_TEMT:  NNMT/PNMT/TEMT family;  InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals. The reaction is catalysed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented. Three classes of DNA Mtases transfer the methyl group from AdoMet to the target base to form either N-6-methyladenine, or N-4-methylcytosine, or C-5- methylcytosine. In C-5-cytosine Mtases, ten conserved motifs are arranged in the same order []. Motif I (a glycine-rich or closely related consensus sequence; FAGxGG in M.HhaI []), shared by other AdoMet-Mtases [], is part of the cofactor binding site and motif IV (PCQ) is part of the catalytic site. In contrast, sequence comparison among N-6-adenine and N-4-cytosine Mtases indicated two of the conserved segments [], although more conserved segments may be present. One of them corresponds to motif I in C-5-cytosine Mtases, and the other is named (D/N/S)PP(Y/F). Crystal structures are known for a number of Mtases [, , , ]. The cofactor binding sites are almost identical and the essential catalytic amino acids coincide. The comparable protein folding and the existence of equivalent amino acids in similar secondary and tertiary positions indicate that many (if not all) AdoMet-Mtases have a common catalytic domain structure. This permits tertiary structure prediction of other DNA, RNA, protein, and small-molecule AdoMet-Mtases from their amino acid sequences []. Several cytoplasmic vertebrate methyltransferases are evolutionary related [], including nicotinamide N-methyltransferase (2.1.1.1 from EC) (NNMT); phenylethanolamine N-methyltransferase (2.1.1.28 from EC) (PNMT); and thioether S-methyltransferase (2.1.1.96 from EC) (TEMT). NNMT catalyzes the N-methylation of nicotinamide and other pyridines to form pyridinium ions. This activity is important for the biotransformation of many drugs and xenobiotic compounds. PNMT catalyzes the last step in catecholamine biosynthesis, the conversion of noradrenalin to adrenalin; and TEMT catalyzes the methylation of dimethyl sulphide into trimethylsulphonium. These three enzymes use S-adenosyl-L-methionine as the methyl donor. They are proteins of 30 to 32 kDa.; GO: 0008168 methyltransferase activity; PDB: 2IIP_C 3ROD_A 2OBF_A 3HCA_B 2ONY_B 3KR1_A 2OPB_B 3KQP_B 2AN4_B 3KQM_A ....
Probab=45.58  E-value=22  Score=28.14  Aligned_cols=41  Identities=27%  Similarity=0.425  Sum_probs=34.3

Q ss_pred             CCCchhhhhhhcCCCCCCCCHHHHHHHHHHHhhhhhCCCCC
Q psy10340         33 EFNPKAFFAMHDLDGNHVWDEEEVKMLFLKELDKMYKEGMP   73 (98)
Q Consensus        33 ~FDp~tFF~lHD~n~DG~~d~~El~ai~~kEl~K~y~~~~~   73 (98)
                      .|||+.|+.......+|...++++...+.+.+.+.+.++.-
T Consensus        15 ~FdP~~Yl~~yY~~~~~~~~~~~~~~~~L~~l~~~f~~g~~   55 (256)
T PF01234_consen   15 EFDPRAYLDTYYSFPSGDDAEDEILLFFLKNLHETFSSGGV   55 (256)
T ss_dssp             HB-HHHHHHHHHSTSSS-CHHHHHHHHHHHHHHHHHHTSSS
T ss_pred             cCCHHHHHHHhcCCCccCcccchhHHHHHHHHHHHhCccCc
Confidence            79999999999999999888899999999999998886653


No 73 
>KOG0034|consensus
Probab=44.07  E-value=23  Score=26.86  Aligned_cols=25  Identities=28%  Similarity=0.210  Sum_probs=21.6

Q ss_pred             hhhhhhcCCCCCCCCHHHHHHHHHH
Q psy10340         38 AFFAMHDLDGNHVWDEEEVKMLFLK   62 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~ai~~k   62 (98)
                      .-|.-.|.++||.++-+|...++.+
T Consensus       151 ~t~~e~D~d~DG~IsfeEf~~~v~~  175 (187)
T KOG0034|consen  151 KTFEEADTDGDGKISFEEFCKVVEK  175 (187)
T ss_pred             HHHHHhCCCCCCcCcHHHHHHHHHc
Confidence            4567789999999999999988875


No 74 
>PF15178 TOM_sub5:  Mitochondrial import receptor subunit TOM5 homolog
Probab=42.19  E-value=21  Score=22.49  Aligned_cols=16  Identities=19%  Similarity=0.333  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHHhhhcc
Q psy10340         81 AEERQTVFTGLFCSLR   96 (98)
Q Consensus        81 ~eE~~rMRehv~~e~~   96 (98)
                      +|+..+||+-|.+.++
T Consensus        14 eE~k~kmR~dvissvr   29 (51)
T PF15178_consen   14 EEMKRKMREDVISSVR   29 (51)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            5678899999998876


No 75 
>PF06226 DUF1007:  Protein of unknown function (DUF1007);  InterPro: IPR010412 This is a family of conserved bacterial proteins with unknown function.
Probab=42.19  E-value=32  Score=25.92  Aligned_cols=29  Identities=24%  Similarity=0.242  Sum_probs=21.4

Q ss_pred             chhhhhhhcCCCCCCCCHHHHHHHHHHHh
Q psy10340         36 PKAFFAMHDLDGNHVWDEEEVKMLFLKEL   64 (98)
Q Consensus        36 p~tFF~lHD~n~DG~~d~~El~ai~~kEl   64 (98)
                      +.....=.|.|+||.++.+|+.+|...-+
T Consensus        52 S~~ll~~~D~~~dg~~~~~el~~l~~~~~   80 (212)
T PF06226_consen   52 SAYLLEGLDKDGDGKLDPEELAALAKEIF   80 (212)
T ss_pred             HHHHHHhhhhcccCCCCHHHHHHHHHHHH
Confidence            33444445899999999999998876433


No 76 
>PF09912 DUF2141:  Uncharacterized protein conserved in bacteria (DUF2141);  InterPro: IPR018673  This family of conserved hypothetical proteins has no known function. 
Probab=40.81  E-value=12  Score=25.81  Aligned_cols=18  Identities=33%  Similarity=0.392  Sum_probs=14.3

Q ss_pred             hhhhhhcCCCCCCCCHHH
Q psy10340         38 AFFAMHDLDGNHVWDEEE   55 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~E   55 (98)
                      .+..+||.|+||.||...
T Consensus        56 Ai~v~hD~N~NgklD~n~   73 (112)
T PF09912_consen   56 AIAVFHDENGNGKLDTNF   73 (112)
T ss_pred             EEEEEEeCCCCCcCCcCC
Confidence            455689999999998653


No 77 
>smart00426 TEA TEA domain.
Probab=39.71  E-value=42  Score=22.16  Aligned_cols=27  Identities=22%  Similarity=0.431  Sum_probs=21.4

Q ss_pred             CCCCCCCHHHHHHHHHHHhhhhhCCCCCc
Q psy10340         46 DGNHVWDEEEVKMLFLKELDKMYKEGMPQ   74 (98)
Q Consensus        46 n~DG~~d~~El~ai~~kEl~K~y~~~~~e   74 (98)
                      +|+++|. .+|+..|. |.-.+|.+.+.-
T Consensus         1 dg~~vWp-~~lE~Af~-~aL~~~~~~g~~   27 (68)
T smart00426        1 DAEGVWS-PDIEQAFQ-EALAIYPPCGRR   27 (68)
T ss_pred             CCCCcCc-HHHHHHHH-HHHHHcCccCcc
Confidence            5889999 89999999 566677776654


No 78 
>PF14658 EF-hand_9:  EF-hand domain
Probab=38.96  E-value=61  Score=21.03  Aligned_cols=24  Identities=8%  Similarity=0.018  Sum_probs=20.9

Q ss_pred             hhhhhhcCCCCCCCCHHHHHHHHH
Q psy10340         38 AFFAMHDLDGNHVWDEEEVKMLFL   61 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~ai~~   61 (98)
                      +-|.++|.+..|.+.-..|.+++.
T Consensus         2 ~~F~~fD~~~tG~V~v~~l~~~Lr   25 (66)
T PF14658_consen    2 TAFDAFDTQKTGRVPVSDLITYLR   25 (66)
T ss_pred             cchhhcCCcCCceEeHHHHHHHHH
Confidence            569999999999999999887764


No 79 
>KOG1707|consensus
Probab=37.92  E-value=21  Score=32.26  Aligned_cols=23  Identities=17%  Similarity=0.335  Sum_probs=20.3

Q ss_pred             hhhhhhcCCCCCCCCHHHHHHHH
Q psy10340         38 AFFAMHDLDGNHVWDEEEVKMLF   60 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~ai~   60 (98)
                      .-|.++|.|.||.++..|+...=
T Consensus       199 RIFki~D~d~D~~Lsd~Eln~fQ  221 (625)
T KOG1707|consen  199 RIFKISDSDNDGALSDAELNDFQ  221 (625)
T ss_pred             HHHhhhccccccccchhhhhHHH
Confidence            67999999999999999987653


No 80 
>KOG0038|consensus
Probab=36.80  E-value=22  Score=27.43  Aligned_cols=25  Identities=16%  Similarity=0.379  Sum_probs=21.1

Q ss_pred             hhhhhhcCCCCCCCCHHHHHHHHHH
Q psy10340         38 AFFAMHDLDGNHVWDEEEVKMLFLK   62 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~ai~~k   62 (98)
                      .-|++.|.|+|+++-.++|+..+++
T Consensus       112 YAFkIYDfd~D~~i~~~DL~~~l~~  136 (189)
T KOG0038|consen  112 YAFKIYDFDGDEFIGHDDLEKTLTS  136 (189)
T ss_pred             heeEEeecCCCCcccHHHHHHHHHH
Confidence            4477899999999999999887763


No 81 
>PF15080 DUF4547:  Domain of unknown function (DUF4547)
Probab=32.31  E-value=57  Score=25.41  Aligned_cols=49  Identities=18%  Similarity=0.500  Sum_probs=33.1

Q ss_pred             HHHHHHH---hhcCCCCCCCCch-hhhhhhcCCCCCCCCHHHHHHHHHHHhhhhh
Q psy10340         18 QLEEVWQ---EQDHMGNTEFNPK-AFFAMHDLDGNHVWDEEEVKMLFLKELDKMY   68 (98)
Q Consensus        18 ql~evWe---eed~i~~~~FDp~-tFF~lHD~n~DG~~d~~El~ai~~kEl~K~y   68 (98)
                      +++-||+   ++-|+...+-.+- |||.-|...+.-+  ..++...|.+.+.-+.
T Consensus        99 ~Ir~vwesvLee~GLqE~dv~aLCtFfiahgnkaehy--~a~~R~~yi~dv~~mI  151 (196)
T PF15080_consen   99 RIRVVWESVLEECGLQEGDVTALCTFFIAHGNKAEHY--AAKVRQMYIRDVTFMI  151 (196)
T ss_pred             HHHHHHHHHHHHcCCCcccHHHHHHHHHHhcchHhHh--HHHHHHHHHhhHHHHH
Confidence            6688899   8889986555443 9999998877654  2345555555544433


No 82 
>KOG3555|consensus
Probab=30.96  E-value=34  Score=29.53  Aligned_cols=24  Identities=21%  Similarity=0.297  Sum_probs=21.2

Q ss_pred             hhhhhhcCCCCCCCCHHHHHHHHH
Q psy10340         38 AFFAMHDLDGNHVWDEEEVKMLFL   61 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~ai~~   61 (98)
                      =-|.--|.|.||.|+..||.+|+.
T Consensus       254 WMFnklD~N~Dl~Ld~sEl~~I~l  277 (434)
T KOG3555|consen  254 WMFNKLDTNYDLLLDQSELRAIEL  277 (434)
T ss_pred             hhhhccccccccccCHHHhhhhhc
Confidence            357777999999999999999986


No 83 
>PF05820 DUF845:  Baculovirus protein of unknown function (DUF845);  InterPro: IPR008563 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf81; it is a family of uncharacterised viral proteins.
Probab=28.77  E-value=24  Score=25.73  Aligned_cols=8  Identities=38%  Similarity=0.978  Sum_probs=6.2

Q ss_pred             chhhhhhh
Q psy10340         36 PKAFFAMH   43 (98)
Q Consensus        36 p~tFF~lH   43 (98)
                      |+||=..|
T Consensus        68 P~TFQ~v~   75 (119)
T PF05820_consen   68 PRTFQTVH   75 (119)
T ss_pred             Ccchhccc
Confidence            77887777


No 84 
>TIGR01748 rhaA L-rhamnose isomerase. This enzyme interconverts L-rhamnose and L-rhamnulose. In some species, including E. coli, this is the first step in rhamnose catabolism. Sequential steps are catalyzed by rhamnulose kinase (rhaB), then rhamnulose-1-phosphate aldolase (rhaD) to yield glycerone phosphate and (S)-lactaldehyde. Characterization of this family is based on members in E. coli and Salmonella.
Probab=28.46  E-value=60  Score=28.01  Aligned_cols=64  Identities=20%  Similarity=0.426  Sum_probs=42.5

Q ss_pred             HHhhcCCCCCCCCchhhhhhhcCCCCC-CCC----------------HHHHHHHHHHH-----hhhhhCCCCCcchHHHH
Q psy10340         23 WQEQDHMGNTEFNPKAFFAMHDLDGNH-VWD----------------EEEVKMLFLKE-----LDKMYKEGMPQNDLMER   80 (98)
Q Consensus        23 Weeed~i~~~~FDp~tFF~lHD~n~DG-~~d----------------~~El~ai~~kE-----l~K~y~~~~~edd~~e~   80 (98)
                      |+++.+|.=+ |||.+|  -|+.=.+| .|+                +-+|-+-|.++     |..++-|++..+-...+
T Consensus       117 ~Ak~~glglD-fNpn~F--sh~~~k~G~SLshpD~~iR~fwI~H~~~c~~I~~~fg~~lGs~~l~niWipDG~kd~~~d~  193 (414)
T TIGR01748       117 WAKANGLGLD-FNPTCF--SHPLSADGFTLSHPDDSIRQFWIDHCKASRRISEYFGKELGTPSVMNIWIPDGMKDIPVDR  193 (414)
T ss_pred             HHHHcCCCcC-cCcccC--CCccccCCCcccCCCHHHHHHHHHHHHHHHHHHHHHHHHhCCchhheeecCCCCCCCCccc
Confidence            8899999877 999888  55555577 444                33465556666     55788888877665444


Q ss_pred             HHHHHHHHH
Q psy10340         81 AEERQTVFT   89 (98)
Q Consensus        81 ~eE~~rMRe   89 (98)
                      ---+.|+.+
T Consensus       194 ~~~r~Rl~e  202 (414)
T TIGR01748       194 LTPRKRLLE  202 (414)
T ss_pred             ccHHHHHHH
Confidence            433555554


No 85 
>PF01023 S_100:  S-100/ICaBP type calcium binding domain;  InterPro: IPR013787 The calcium-binding domain found in S100 and CaBP-9k proteins is a subfamily of the EF-hand calcium-binding domain []. S100s are small dimeric acidic calcium and zinc-binding proteins abundant in the brain, with S100B playing an important role in modulating the proliferation and differentiation of neurons and glia cells []. S100 proteins have two different types of calcium-binding sites: a low affinity one with a special structure, and a 'normal' EF-hand type high-affinity site. Calbindin-D9k (CaBP-9k) also belong to this family of proteins, but it does not form dimers. CaBP-9k is a cytosolic protein expressed in a variety of tissues. Although its precise function is unknown, it appears to be under the control of the steroid hormones oestrogen and progesterone in the female reproductive system []. In the intestine, CaBP-9k may be involved in calcium absorption by mediating intracellular diffusion []. This entry represents a subdomain of the calcium-binding domain found in S100, CaBP-9k, and related proteins.; PDB: 2RGI_A 4DUQ_B 2KAY_B 2KAX_A 2CNP_A 1CNP_A 1A03_A 1JWD_B 2JTT_A 1XK4_B ....
Probab=27.53  E-value=52  Score=19.32  Aligned_cols=21  Identities=29%  Similarity=0.411  Sum_probs=17.5

Q ss_pred             CCCCCCHHHHHHHHHHHhhhh
Q psy10340         47 GNHVWDEEEVKMLFLKELDKM   67 (98)
Q Consensus        47 ~DG~~d~~El~ai~~kEl~K~   67 (98)
                      ....|+..|+++++.+|+-.+
T Consensus        21 d~~~Lsk~Elk~Ll~~Elp~f   41 (44)
T PF01023_consen   21 DKDTLSKKELKELLEKELPNF   41 (44)
T ss_dssp             STTSEEHHHHHHHHHHHSTTT
T ss_pred             CCCeEcHHHHHHHHHHHHHHH
Confidence            457899999999999998544


No 86 
>PF00249 Myb_DNA-binding:  Myb-like DNA-binding domain;  InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins. These belong to the SANT domain family that specifically recognise the sequence YAAC(G/T)G [, ]. In myb, one of the most conserved regions consisting of three tandem repeats has been shown to be involved in DNA-binding [].; PDB: 1X41_A 2XAF_B 2XAG_B 2XAH_B 2UXN_B 2Y48_B 2XAQ_B 2X0L_B 2IW5_B 2XAJ_B ....
Probab=25.18  E-value=91  Score=17.70  Aligned_cols=21  Identities=33%  Similarity=0.439  Sum_probs=14.3

Q ss_pred             CCCCHHHHHHHHHHHhhhhhCCC
Q psy10340         49 HVWDEEEVKMLFLKELDKMYKEG   71 (98)
Q Consensus        49 G~~d~~El~ai~~kEl~K~y~~~   71 (98)
                      |.||.+|-+.+..  +-+.|+.+
T Consensus         2 ~~Wt~eE~~~l~~--~v~~~g~~   22 (48)
T PF00249_consen    2 GPWTEEEDEKLLE--AVKKYGKD   22 (48)
T ss_dssp             -SS-HHHHHHHHH--HHHHSTTT
T ss_pred             CCCCHHHHHHHHH--HHHHhCCc
Confidence            6799999877766  67777664


No 87 
>KOG3478|consensus
Probab=25.03  E-value=1.5e+02  Score=21.65  Aligned_cols=30  Identities=17%  Similarity=0.240  Sum_probs=23.6

Q ss_pred             HHHHHHhhhhhCCCCCcchHHHHHHHHHHHHHHHhh
Q psy10340         58 MLFLKELDKMYKEGMPQNDLMERAEERQTVFTGLFC   93 (98)
Q Consensus        58 ai~~kEl~K~y~~~~~edd~~e~~eE~~rMRehv~~   93 (98)
                      ..|.+|+..+-      +..+.+++|+..||+.|++
T Consensus        79 efI~~Eikr~e------~~i~d~q~e~~k~R~~v~k  108 (120)
T KOG3478|consen   79 EFISKEIKRLE------NQIRDSQEEFEKQREAVIK  108 (120)
T ss_pred             HHHHHHHHHHH------HHHHHHHHHHHHHHHHHHH
Confidence            34667776654      6778899999999999986


No 88 
>KOG0038|consensus
Probab=24.23  E-value=67  Score=24.85  Aligned_cols=20  Identities=30%  Similarity=0.456  Sum_probs=17.8

Q ss_pred             hcCCCCCCCCHHHHHHHHHH
Q psy10340         43 HDLDGNHVWDEEEVKMLFLK   62 (98)
Q Consensus        43 HD~n~DG~~d~~El~ai~~k   62 (98)
                      -|.+|||.|+-.|++.++.+
T Consensus       158 AD~DgDgkl~~~eFe~~i~r  177 (189)
T KOG0038|consen  158 ADLDGDGKLSFAEFEHVILR  177 (189)
T ss_pred             hcCCCCCcccHHHHHHHHHh
Confidence            48999999999999998875


No 89 
>PF15005 IZUMO:  Izumo sperm-egg fusion
Probab=23.63  E-value=2.1e+02  Score=21.46  Aligned_cols=55  Identities=20%  Similarity=0.154  Sum_probs=37.8

Q ss_pred             hhhhhcCCC-CCCCCHHH---HHHHHHHHhhhhhCCCCCcchHHHHHHHHHHHHHHHhhhcc
Q psy10340         39 FFAMHDLDG-NHVWDEEE---VKMLFLKELDKMYKEGMPQNDLMERAEERQTVFTGLFCSLR   96 (98)
Q Consensus        39 FF~lHD~n~-DG~~d~~E---l~ai~~kEl~K~y~~~~~edd~~e~~eE~~rMRehv~~e~~   96 (98)
                      ||..+..|+ =|+++++-   +...|.+++.++++.+-.+.-  -.. |+..||+.+.+++-
T Consensus        49 ~~~~~~~~a~~g~vd~~~L~~va~~~~~~lkrl~~s~~kg~~--ll~-EL~~~r~~~~~~lk  107 (160)
T PF15005_consen   49 FFLPYAEDAFMGVVDEDTLDKVAWSFKNQLKRLTDSDLKGEP--LLK-ELVWMRQNQKKELK  107 (160)
T ss_pred             cccccchhhhhhhccHHHHHHHHHHHHHHHHHHhcCCcccch--HHH-HHHHHHHHHHHHHH
Confidence            455554443 36777766   455688999999977765533  333 99999999987763


No 90 
>PF15304 AKAP2_C:  A-kinase anchor protein 2 C-terminus
Probab=23.37  E-value=1.2e+02  Score=25.22  Aligned_cols=27  Identities=19%  Similarity=0.192  Sum_probs=21.1

Q ss_pred             HHHHHHHHhhhhhCCCCCcchHHHHHHHHHHHHHHHh
Q psy10340         56 VKMLFLKELDKMYKEGMPQNDLMERAEERQTVFTGLF   92 (98)
Q Consensus        56 l~ai~~kEl~K~y~~~~~edd~~e~~eE~~rMRehv~   92 (98)
                      ...++.+||.          ++.++++|+.++|.-++
T Consensus       211 t~s~iE~EIr----------~~~eRE~EL~~QR~~~~  237 (344)
T PF15304_consen  211 TSSMIEEEIR----------AAQEREEELKRQRRSAL  237 (344)
T ss_pred             cHHHHHHHHH----------HHHHHHHHHHHHHHHhh
Confidence            4667777776          67899999999996543


No 91 
>PRK11546 zraP zinc resistance protein; Provisional
Probab=23.18  E-value=1.4e+02  Score=22.02  Aligned_cols=32  Identities=16%  Similarity=0.168  Sum_probs=26.7

Q ss_pred             HhhhhhCCCCCcch-HHHHHHHHHHHHHHHhhh
Q psy10340         63 ELDKMYKEGMPQND-LMERAEERQTVFTGLFCS   94 (98)
Q Consensus        63 El~K~y~~~~~edd-~~e~~eE~~rMRehv~~e   94 (98)
                      ||.-++..++|+.. +.....|+..+|..+..+
T Consensus        76 ELnALl~~~~pD~~kI~aL~kEI~~Lr~kL~e~  108 (143)
T PRK11546         76 EYNALLTANPPDSSKINAVAKEMENLRQSLDEL  108 (143)
T ss_pred             HHHHHHcCCCCCHHHHHHHHHHHHHHHHHHHHH
Confidence            68888888888887 888999999999877643


No 92 
>COG0501 HtpX Zn-dependent protease with chaperone function [Posttranslational modification, protein turnover, chaperones]
Probab=22.90  E-value=81  Score=23.67  Aligned_cols=21  Identities=14%  Similarity=0.441  Sum_probs=19.0

Q ss_pred             CCCHHHHHHHHHHHhhhhhCC
Q psy10340         50 VWDEEEVKMLFLKELDKMYKE   70 (98)
Q Consensus        50 ~~d~~El~ai~~kEl~K~y~~   70 (98)
                      .++++||++++..|+-|+..-
T Consensus       151 ~l~~dEl~aVlaHElgHi~~r  171 (302)
T COG0501         151 LLNDDELEAVLAHELGHIKNR  171 (302)
T ss_pred             hCCHHHHHHHHHHHHHHHhcc
Confidence            689999999999999999854


No 93 
>smart00271 DnaJ DnaJ molecular chaperone homology domain.
Probab=22.85  E-value=1.6e+02  Score=16.75  Aligned_cols=34  Identities=15%  Similarity=0.284  Sum_probs=25.6

Q ss_pred             hhhhhhcCCCCCCCCHHHHHHHHHHHhhhhhCCCCCc
Q psy10340         38 AFFAMHDLDGNHVWDEEEVKMLFLKELDKMYKEGMPQ   74 (98)
Q Consensus        38 tFF~lHD~n~DG~~d~~El~ai~~kEl~K~y~~~~~e   74 (98)
                      ++|.+-++..+  .+.++|++-|.+ |-+.|-|+...
T Consensus         2 ~~y~vLgl~~~--~~~~~ik~ay~~-l~~~~HPD~~~   35 (60)
T smart00271        2 DYYEILGVPRD--ASLDEIKKAYRK-LALKYHPDKNP   35 (60)
T ss_pred             CHHHHcCCCCC--CCHHHHHHHHHH-HHHHHCcCCCC
Confidence            46777777665  899999999985 77777676654


No 94 
>PRK14290 chaperone protein DnaJ; Provisional
Probab=22.77  E-value=2.9e+02  Score=22.42  Aligned_cols=37  Identities=19%  Similarity=0.339  Sum_probs=25.8

Q ss_pred             hhhhhhhcCCCCCCCCHHHHHHHHHHHhhhhhCCCCCcch
Q psy10340         37 KAFFAMHDLDGNHVWDEEEVKMLFLKELDKMYKEGMPQND   76 (98)
Q Consensus        37 ~tFF~lHD~n~DG~~d~~El~ai~~kEl~K~y~~~~~edd   76 (98)
                      +.||.+-+++.+  .+.+||++-|.+=.-|+. |+...++
T Consensus         3 ~d~y~vLgv~~~--a~~~eik~ayr~la~~~H-PD~~~~~   39 (365)
T PRK14290          3 KDYYKILGVDRN--ASQEDIKKAFRELAKKWH-PDLHPGN   39 (365)
T ss_pred             CChhhhcCCCCC--CCHHHHHHHHHHHHHHHC-cCCCCCc
Confidence            467888888775  899999999997444444 5443333


No 95 
>PF00550 PP-binding:  Phosphopantetheine attachment site;  InterPro: IPR006163  Phosphopantetheine (or pantetheine 4' phosphate) is the prosthetic group of acyl carrier proteins (ACP) in some multienzyme complexes where it serves as a 'swinging arm' for the attachment of activated fatty acid and amino-acid groups [].  The amino-terminal region of the ACP proteins is well defined and consists of alpha four helices arranged in a right-handed bundle held together by interhelical hydrophobic interactions. The Asp-Ser-Leu (DSL)motif is conserved in all of the ACP sequences, and the 4'-PP prosthetic group is covalently linked via a phosphodiester bond to the serine residue. The DSL sequence is present at the amino terminus of helix II, a domain of the protein referred to as the recognition helix and which is responsible for the interaction of ACPs with the enzymes of type II fatty acid synthesis [].; GO: 0048037 cofactor binding; PDB: 3EJB_E 3EJE_G 1L0I_A 2FHS_C 3EJD_E 2FAE_B 2FAD_B 2FAC_B 2K94_A 1ACP_A ....
Probab=22.53  E-value=51  Score=19.18  Aligned_cols=24  Identities=33%  Similarity=0.542  Sum_probs=18.8

Q ss_pred             HHHHHHHHhhcCCCCCCCCch-hhh
Q psy10340         17 KQLEEVWQEQDHMGNTEFNPK-AFF   40 (98)
Q Consensus        17 ~ql~evWeeed~i~~~~FDp~-tFF   40 (98)
                      +++++.|.+.=+++...++|. .||
T Consensus         1 e~l~~~~~~~l~~~~~~i~~~~~~~   25 (67)
T PF00550_consen    1 EQLREIIAEVLGVDPEEIDPDTDFF   25 (67)
T ss_dssp             HHHHHHHHHHHTSSGGCTSTTSBTT
T ss_pred             CHHHHHHHHHHCcCHhhCCCCCCHH
Confidence            478888997777887889888 455


No 96 
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism]
Probab=21.77  E-value=1.1e+02  Score=26.37  Aligned_cols=35  Identities=20%  Similarity=0.302  Sum_probs=27.2

Q ss_pred             CCCHHHHHHHHHHHhhhhhCCCCCcchHHHHHHHHHHHHHHHhhhccc
Q psy10340         50 VWDEEEVKMLFLKELDKMYKEGMPQNDLMERAEERQTVFTGLFCSLRA   97 (98)
Q Consensus        50 ~~d~~El~ai~~kEl~K~y~~~~~edd~~e~~eE~~rMRehv~~e~~~   97 (98)
                      +|+..||+|...+||+             +|.+=+..||.-+.+.|.+
T Consensus       297 IL~~p~Lra~W~~El~-------------~Mr~Ri~~mR~~lv~~L~~  331 (396)
T COG1448         297 ILNNPELRAEWEQELE-------------EMRQRILEMRQALVDALKA  331 (396)
T ss_pred             HhCCHHHHHHHHHHHH-------------HHHHHHHHHHHHHHHHHHh
Confidence            5777899999997765             5666778888888877764


No 97 
>PLN02736 long-chain acyl-CoA synthetase
Probab=21.71  E-value=65  Score=27.11  Aligned_cols=25  Identities=24%  Similarity=0.371  Sum_probs=23.5

Q ss_pred             CCCCCCCCHHHHHHHHHHHhhhhhC
Q psy10340         45 LDGNHVWDEEEVKMLFLKELDKMYK   69 (98)
Q Consensus        45 ~n~DG~~d~~El~ai~~kEl~K~y~   69 (98)
                      ++..|.+....|++.|.++|+++|+
T Consensus       624 lT~~~Ki~R~~i~~~~~~~i~~~y~  648 (651)
T PLN02736        624 LTPTFKVKRPQAKAYFAKAISDMYA  648 (651)
T ss_pred             CChhhhhhHHHHHHHHHHHHHHHHh
Confidence            5899999999999999999999995


No 98 
>cd09236 V_AnPalA_UmRIM20_like Protein-interacting V-domains of Aspergillus nidulans PalA/RIM20, Ustilago maydis RIM20, and related proteins. This family belongs to the V_Alix_like superfamily which includes the V-shaped (V) domains of Bro1 and Rim20 from Saccharomyces cerevisiae, mammalian Alix (apoptosis-linked gene-2 interacting protein X), His-Domain type N23 protein tyrosine phosphatase (HD-PTP, also known as PTPN23), and related domains. Aspergillus nidulas PalA/RIM20 and Ustilago maydis RIM20, like Saccharomyces cerevisiae Rim20, participate in the response to the external pH via the Pal/Rim101 pathway; however, Saccharomyces cerevisiae Rim20 does not belong to this family. This pathway is a signaling cascade resulting in the activation of the transcription factor PacC/Rim101. The mammalian Alix V-domain (belonging to a different family) contains a binding site, partially conserved in the superfamily, for the retroviral late assembly (L) domain YPXnL motif. Aspergillus nidulas Pa
Probab=21.21  E-value=76  Score=25.65  Aligned_cols=23  Identities=26%  Similarity=0.265  Sum_probs=18.5

Q ss_pred             CCCCCCHHHHHHHHHHHhhhhhCC
Q psy10340         47 GNHVWDEEEVKMLFLKELDKMYKE   70 (98)
Q Consensus        47 ~DG~~d~~El~ai~~kEl~K~y~~   70 (98)
                      +++.+....++.||.+||.| |+|
T Consensus       243 ~~~~i~~~~fe~lf~~eL~k-f~~  265 (353)
T cd09236         243 PATEVAPAHFEDLFDKRLAK-YDK  265 (353)
T ss_pred             ccccccHHHHHHHHHHHHHH-hhH
Confidence            44557777889999999988 866


No 99 
>PF01839 FG-GAP:  FG-GAP repeat;  InterPro: IPR013517 This region contains the extracellular repeat that is found in up to seven copies in alpha integrins. This repeat has been predicted to fold into a beta propeller structure []. The repeat is called the FG-GAP repeat after two conserved motifs in the repeat []. The FG-GAP repeats are found in the N terminus of integrin alpha chains, a region that has been shown to be important for ligand binding []. A putative Ca2+ binding motif is found in some of the repeats. ; PDB: 1L5G_A 3IJE_A 1M1X_A 1JV2_A 1U8C_A 3V4P_C 3V4V_C 3VI3_A 3VI4_C 2VDN_A ....
Probab=21.18  E-value=41  Score=18.70  Aligned_cols=10  Identities=30%  Similarity=0.445  Sum_probs=7.2

Q ss_pred             hcCCCCCCCC
Q psy10340         43 HDLDGNHVWD   52 (98)
Q Consensus        43 HD~n~DG~~d   52 (98)
                      -|.|+||+-|
T Consensus         8 gD~ngDG~~D   17 (34)
T PF01839_consen    8 GDFNGDGYDD   17 (34)
T ss_dssp             ESTSSSSS-E
T ss_pred             EEcCCCCCcc
Confidence            4899999743


Done!