Diaphorina citri psyllid: psy10345

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-

MEVTGGGDETSQDRCTFIHRALEICLAEILGTFGLMFFGCMSCIGGFSQGSVPSLQPALMFGFVVSTIITIFGHISSAHLNPSVTVAAFMLGDISVADALVYVMAQLIGAVLGYATLGHHGIPMLWQSEVLKFIFPWLNLVEVEVTGGGGVGSIATYYQLYQVNGPYTGASMNAARSIAPAFINNIWTKQWIYWTAPTLAGTVTPLIYTYAFERKRLEKQF

ccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHEEEEccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHccccccEEEEHHHHHHHHHHHHHHHHHHccccccccc

*************RCTFIHRALEICLAEILGTFGLMFFGCMSCIGGFSQGSVPSLQPALMFGFVVSTIITIFGHISSAHLNPSVTVAAFMLGDISVADALVYVMAQLIGAVLGYATLGHHGIPMLWQSEVLKFIFPWLNLVEVEVTGGGGVGSIATYYQLYQVNGPYTGASMNAARSIAPAFINNIWTKQWIYWTAPTLAGTVTPLIYTYAFE********

xxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Aquaporin-2	Forms a water-specific channel that provides the plasma membranes of renal collecting duct with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.	confident	P79099
Aquaporin AQPAn.G	Forms a water-specific channel.	confident	Q7PWV1
Probable aquaporin TIP4-1	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes. May be involved in transport from the vacuolar compartment to the cytoplasm.	confident	Q75GA5

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0006833 [BP]	water transport	probable	GO:0042044, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0015250 [MF]	water channel activity	probable	GO:0022891, GO:0022892, GO:0005215, GO:0022857, GO:0015267, GO:0003674, GO:0022803, GO:0022838, GO:0005372
GO:0015670 [BP]	carbon dioxide transport	probable	GO:0019755, GO:0006810, GO:0015669, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0016324 [CC]	apical plasma membrane	probable	GO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0016323 [CC]	basolateral plasma membrane	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005911 [CC]	cell-cell junction	probable	GO:0005575, GO:0030054
GO:0033993 [BP]	response to lipid	probable	GO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0046689 [BP]	response to mercury ion	probable	GO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:1901700 [BP]	response to oxygen-containing compound	probable	GO:0042221, GO:0050896, GO:0008150
GO:0070887 [BP]	cellular response to chemical stimulus	probable	GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0042221, GO:0044699
GO:0005216 [MF]	ion channel activity	probable	GO:0022891, GO:0022892, GO:0005215, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022803, GO:0022838
GO:0015204 [MF]	urea transmembrane transporter activity	probable	GO:0022891, GO:0042887, GO:0005215, GO:0022857, GO:0022892, GO:0003674
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005773 [CC]	vacuole	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0015254 [MF]	glycerol channel activity	probable	GO:0022891, GO:0022892, GO:1901476, GO:0005215, GO:1901618, GO:0015665, GO:0022857, GO:0015267, GO:0003674, GO:0015166, GO:0022803, GO:0015168, GO:0015144
GO:0015722 [BP]	canalicular bile acid transport	probable	GO:0015718, GO:0015721, GO:0015849, GO:0006811, GO:0006810, GO:0015711, GO:0044765, GO:0006820, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0009986 [CC]	cell surface	probable	GO:0005575, GO:0044464, GO:0005623
GO:0015698 [BP]	inorganic anion transport	probable	GO:0006811, GO:0006810, GO:0006820, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0071705 [BP]	nitrogen compound transport	probable	GO:0006810, GO:0008150, GO:0051179, GO:0051234
GO:0015105 [MF]	arsenite transmembrane transporter activity	probable	GO:0022891, GO:0022892, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0003674, GO:0015103
GO:0042995 [CC]	cell projection	probable	GO:0005575, GO:0044464, GO:0005623
GO:0015793 [BP]	glycerol transport	probable	GO:0015850, GO:0006810, GO:0008643, GO:0044765, GO:0008150, GO:0015791, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0031410 [CC]	cytoplasmic vesicle	probable	GO:0005737, GO:0031982, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043226
GO:0055085 [BP]	transmembrane transport	probable	GO:0006810, GO:0009987, GO:0044765, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699
GO:0032991 [CC]	macromolecular complex	probable	GO:0005575

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1LDF, chain A
Confidence level:very confident
Coverage over the Query: 20-216
View the alignment between query and template
View the model in PyMOL