Query         psy10364
Match_columns 129
No_of_seqs    60 out of 62
Neff          2.2 
Searched_HMMs 46136
Date          Fri Aug 16 16:00:48 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10364.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10364hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2494|consensus               99.7 6.6E-19 1.4E-23  149.2   4.0   59   11-71     70-131 (331)
  2 KOG2494|consensus               99.3 1.3E-12 2.8E-17  111.2   2.0   82   10-114   229-310 (331)
  3 PF00642 zf-CCCH:  Zinc finger   93.1   0.026 5.7E-07   31.8   0.0   22   13-36      4-27  (27)
  4 smart00356 ZnF_C3H1 zinc finge  89.0    0.24 5.1E-06   26.3   1.2   23   13-36      5-27  (27)
  5 PF10650 zf-C3H1:  Putative zin  55.5     5.6 0.00012   22.8   0.7   19   14-34      2-21  (23)
  6 PF14608 zf-CCCH_2:  Zinc finge  49.8     9.1  0.0002   20.3   0.9   11   23-35      8-19  (19)
  7 KOG4709|consensus               46.9     7.3 0.00016   32.6   0.3   16  112-127    30-45  (217)
  8 COG5175 MOT2 Transcriptional r  44.4     9.9 0.00021   34.6   0.8   30   10-41    200-230 (480)
  9 KOG4791|consensus               42.4     8.4 0.00018   36.3   0.0   37    2-40     22-58  (667)
 10 KOG1492|consensus               19.6      46   0.001   29.2   0.6   19   14-34    263-281 (377)

No 1  
>KOG2494|consensus
Probab=99.75  E-value=6.6e-19  Score=149.16  Aligned_cols=59  Identities=53%  Similarity=0.831  Sum_probs=50.8

Q ss_pred             ccceeehhhcccccCCCCCceecCCChhhHHHHHhhhhhhhHHHH---HHHHhcCCCCCCCCcc
Q psy10364         11 TLNYGTFWILGRCNREKPPCKYFHPPQHLKDQLLINGRNHLALKN---ALLQQMGLTPGQPMVP   71 (129)
Q Consensus        11 ~~~~c~d~iKGRC~RekppCKYfHPP~HLk~qL~ingrnh~a~kn---a~aqqm~~~Pg~pm~~   71 (129)
                      -.++|+||+||||+||+  |||+|||+|||+||+||||+++++|+   |.++|+...||+||..
T Consensus        70 ~v~aC~Ds~kgrCsR~n--CkylHpp~hlkdql~ingrn~l~lq~~~aA~~~q~~~~~g~Pi~~  131 (331)
T KOG2494|consen   70 RVIACFDSQKGRCSREN--CKYLHPPQHLKDQLKINGRNNLILQKTAAAMLAQQMQGPGTPICS  131 (331)
T ss_pred             eEEEEeccccCccCccc--ceecCCChhhhhhhhhcccccHHHHHHHHhhhcccccCCCccccc
Confidence            36789999999999999  99999999999999999999999988   4444444448887776


No 2  
>KOG2494|consensus
Probab=99.27  E-value=1.3e-12  Score=111.17  Aligned_cols=82  Identities=26%  Similarity=0.438  Sum_probs=62.0

Q ss_pred             cccceeehhhcccccCCCCCceecCCChhhHHHHHhhhhhhhHHHHHHHHhcCCCCCCCCccCCccceecccCCCCcccc
Q psy10364         10 STLNYGTFWILGRCNREKPPCKYFHPPQHLKDQLLINGRNHLALKNALLQQMGLTPGQPMVPGQIPAVVSAAFYPHWILF   89 (129)
Q Consensus        10 ~~~~~c~d~iKGRC~RekppCKYfHPP~HLk~qL~ingrnh~a~kna~aqqm~~~Pg~pm~~gq~Pa~v~~a~~Ph~~L~   89 (129)
                      .+.+.|++|++|||++|+  |||||+|.|++.  +++..+++.+. .+++     ||. +-.+++            ..-
T Consensus       229 ~t~~~~~~~t~~~~~~en--~~~~~~~~h~~~--~~~aa~~~~~~-~l~a-----pga-l~~pkr------------~Al  285 (331)
T KOG2494|consen  229 NTVEVCLRYTKGRCETEN--CKYFHAPAHDQA--SAKAAQPRPNS-SLAA-----PGA-LPPPKR------------PAL  285 (331)
T ss_pred             Ccchhccccccceechhc--ccccCchHHHHH--HHHHhhhccch-hhcC-----Ccc-CCCCCC------------CCC
Confidence            356789999999999999  999999999996  45666666555 2222     332 113332            345


Q ss_pred             cCCCcccceeehhhhhhhhhhhhhh
Q psy10364         90 PTDDVASAIWRISCLKNLKSFESRN  114 (129)
Q Consensus        90 P~~n~aS~~~~~svlh~~~~~~~~~  114 (129)
                      ||+||+|++|||+|+||+|+|.+-+
T Consensus       286 eK~ngasavfnp~v~~~qQa~~~~q  310 (331)
T KOG2494|consen  286 PKTNGASAAFNPTVAQWQQAFPGLQ  310 (331)
T ss_pred             CccCccchhcccchhhccccCchhh
Confidence            7999999999999999999998754


No 3  
>PF00642 zf-CCCH:  Zinc finger C-x8-C-x5-C-x3-H type (and similar);  InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents C-x8-C-x5-C-x3-H (CCCH) type Zinc finger (Znf) domains. Proteins containing CCCH Znf domains include Znf proteins from eukaryotes involved in cell cycle or growth phase-related regulation, e.g. human TIS11B (butyrate response factor 1), a probable regulatory protein involved in regulating the response to growth factors, and the mouse TTP growth factor-inducible nuclear protein, which has the same function. The mouse TTP protein is induced by growth factors. Another protein containing this domain is the human splicing factor U2AF 35kDa subunit, which plays a critical role in both constitutive and enhancer-dependent splicing by mediating essential protein-protein interactions and protein-RNA interactions required for 3' splice site selection. It has been shown that different CCCH-type Znf proteins interact with the 3'-untranslated region of various mRNA [, ]. This type of Znf is very often present in two copies. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding; PDB: 1M9O_A 1RGO_A 2CQE_A 2FC6_A 2D9M_A 2E5S_A 2RHK_C 2D9N_A 3D2S_A 3D2Q_C ....
Probab=93.12  E-value=0.026  Score=31.79  Aligned_cols=22  Identities=27%  Similarity=0.759  Sum_probs=16.0

Q ss_pred             ceeehhhc-ccccC-CCCCceecCCC
Q psy10364         13 NYGTFWIL-GRCNR-EKPPCKYFHPP   36 (129)
Q Consensus        13 ~~c~d~iK-GRC~R-ekppCKYfHPP   36 (129)
                      ..|.+|++ |.|.+ ++  |+|.|++
T Consensus         4 ~~C~~f~~~g~C~~G~~--C~f~H~~   27 (27)
T PF00642_consen    4 KLCRFFMRTGTCPFGDK--CRFAHGE   27 (27)
T ss_dssp             SB-HHHHHTS--TTGGG--SSSBSSG
T ss_pred             ccChhhccCCccCCCCC--cCccCCC
Confidence            46888999 99999 66  9999985


No 4  
>smart00356 ZnF_C3H1 zinc finger.
Probab=89.05  E-value=0.24  Score=26.31  Aligned_cols=23  Identities=30%  Similarity=0.674  Sum_probs=19.1

Q ss_pred             ceeehhhcccccCCCCCceecCCC
Q psy10364         13 NYGTFWILGRCNREKPPCKYFHPP   36 (129)
Q Consensus        13 ~~c~d~iKGRC~RekppCKYfHPP   36 (129)
                      .+|-+|..|.|.+.. -|+|.|.+
T Consensus         5 ~~C~~~~~g~C~~g~-~C~~~H~~   27 (27)
T smart00356        5 ELCKFFKRGYCPYGD-RCKFAHPL   27 (27)
T ss_pred             CcCcCccCCCCCCCC-CcCCCCcC
Confidence            478899999999864 59999974


No 5  
>PF10650 zf-C3H1:  Putative zinc-finger domain;  InterPro: IPR019607  This domain is conserved in fungi and might be a zinc-finger domain as it contains three conserved Cs and an H in the C-x8-C-x5-C-x3-H conformation typical of a zinc-finger. 
Probab=55.50  E-value=5.6  Score=22.83  Aligned_cols=19  Identities=26%  Similarity=0.723  Sum_probs=15.5

Q ss_pred             eeehhhcc-cccCCCCCceecC
Q psy10364         14 YGTFWILG-RCNREKPPCKYFH   34 (129)
Q Consensus        14 ~c~d~iKG-RC~RekppCKYfH   34 (129)
                      +|..-+.| .|+.+.  |.|-|
T Consensus         2 lC~yEl~Gg~Cnd~~--C~~QH   21 (23)
T PF10650_consen    2 LCPYELTGGVCNDPD--CEFQH   21 (23)
T ss_pred             CCccccCCCeeCCCC--CCccc
Confidence            46666777 999999  99977


No 6  
>PF14608 zf-CCCH_2:  Zinc finger C-x8-C-x5-C-x3-H type
Probab=49.80  E-value=9.1  Score=20.26  Aligned_cols=11  Identities=36%  Similarity=1.183  Sum_probs=9.3

Q ss_pred             ccCC-CCCceecCC
Q psy10364         23 CNRE-KPPCKYFHP   35 (129)
Q Consensus        23 C~Re-kppCKYfHP   35 (129)
                      |..- +  |.|.||
T Consensus         8 C~~~~~--C~f~HP   19 (19)
T PF14608_consen    8 CTNGDN--CPFSHP   19 (19)
T ss_pred             CCCCCc--CccCCc
Confidence            7766 7  999998


No 7  
>KOG4709|consensus
Probab=46.95  E-value=7.3  Score=32.59  Aligned_cols=16  Identities=56%  Similarity=0.885  Sum_probs=13.4

Q ss_pred             hhhHHHHhhhhhcccc
Q psy10364        112 SRNKEERKEELTGYHK  127 (129)
Q Consensus       112 ~~~~~~~~~~~~~~~~  127 (129)
                      |-.+|.|++-||||||
T Consensus        30 sFDeekrkdylTGFHK   45 (217)
T KOG4709|consen   30 SFDEEKRKDYLTGFHK   45 (217)
T ss_pred             eecHHHHHHHHHHHHH
Confidence            3468899999999997


No 8  
>COG5175 MOT2 Transcriptional repressor [Transcription]
Probab=44.44  E-value=9.9  Score=34.62  Aligned_cols=30  Identities=33%  Similarity=0.644  Sum_probs=22.6

Q ss_pred             cccceeehhhcc-cccCCCCCceecCCChhhHH
Q psy10364         10 STLNYGTFWILG-RCNREKPPCKYFHPPQHLKD   41 (129)
Q Consensus        10 ~~~~~c~d~iKG-RC~RekppCKYfHPP~HLk~   41 (129)
                      .+--||.+||++ .|-.-.  |+|||-|--=++
T Consensus       200 GTTKYCtsYLRn~~CpNp~--CMyLHEpg~e~D  230 (480)
T COG5175         200 GTTKYCTSYLRNAVCPNPD--CMYLHEPGPEKD  230 (480)
T ss_pred             CchHHHHHHHcCCCCCCCC--eeeecCCCcccc
Confidence            355689999997 576655  999999965444


No 9  
>KOG4791|consensus
Probab=42.42  E-value=8.4  Score=36.33  Aligned_cols=37  Identities=35%  Similarity=0.627  Sum_probs=31.4

Q ss_pred             cccccccccccceeehhhcccccCCCCCceecCCChhhH
Q psy10364          2 FRASTYYLSTLNYGTFWILGRCNREKPPCKYFHPPQHLK   40 (129)
Q Consensus         2 ~~~~~~~~~~~~~c~d~iKGRC~RekppCKYfHPP~HLk   40 (129)
                      ||+----|.++++|.-|+-++|-|+.  |.|=|-=.|++
T Consensus        22 ~rh~E~al~n~t~C~~w~~~~~C~k~--C~YRHSe~~~k   58 (667)
T KOG4791|consen   22 FRHCEAALGNETVCTLWQEGRCCRKV--CRYRHSEIDKK   58 (667)
T ss_pred             chhhHHHhcCcchhhhhhhcCccccc--ccchhhHHhhh
Confidence            44444567889999999999999998  99999999988


No 10 
>KOG1492|consensus
Probab=19.60  E-value=46  Score=29.20  Aligned_cols=19  Identities=37%  Similarity=1.128  Sum_probs=12.2

Q ss_pred             eeehhhcccccCCCCCceecC
Q psy10364         14 YGTFWILGRCNREKPPCKYFH   34 (129)
Q Consensus        14 ~c~d~iKGRC~RekppCKYfH   34 (129)
                      .|--||-|.|+.-+  |+|+|
T Consensus       263 acryfllgkcnnpn--cryvh  281 (377)
T KOG1492|consen  263 ACRYFLLGKCNNPN--CRYVH  281 (377)
T ss_pred             hhhhhhhccCCCCC--ceEEE
Confidence            45556666666555  88876


Done!