Psyllid ID: psy10373


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-----
MAIAIVALNFYRYLRPDTESKKYPHCFGGAPLDAEKAEKLDQALGFLNTFLASSPWVAGDNITIADCSIVASLSTIECSTSDHMASQTRHPGNLLVLMFSSRAIIAYLAEQYGKDDSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFMTIDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPTMDDNGYTLSER
cHHHHHHHHHHHHHHHHHHHcHHcHHcccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHEEEEEEccccccccccccHHHHHcccccccHHHHHHHHHHHcccccccccccccccccccHHHHcccccccccEEEEccEEEEcc
cHHHHHHHHHHHHHcHHHHHccHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHccHHHHcccccccccHHHHEEcHHHHHHHHHHHHcccHHHccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHcEEEEccccHHHHHHHHHHHHHccccEEEEccccccccccHHHHHHcccccccEEEEccEEEEcc
MAIAIVALNFYrylrpdteskkyphcfggapldaEKAEKLDQALGFLNTflasspwvagdnitiaDCSIVASlstiecstsdhmasqtrhpgnLLVLMFSSRAIIAYLAEQygkddslypkdpkargivnqrlyFDIGTLYQRFADYFMTIdfyyvpgsapcRAVQLAAAQigvplnlkhtdlmkgehltpeflklnpqhtvptmddngytlser
MAIAIVALNFYRYLRPDTESKKYPHCFGGAPLDAEKAEKLDQALGFLNTFLASSPWVAGDNITIADCSIVASLSTIECSTSDHMASQTRHPGNLLVLMFSSRAIIAYLAEQygkddslypkdpkargivNQRLYFDIGTLYQRFADYFMTIDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPeflklnpqhtvptmddngytlser
MAIAIVALNFYRYLRPDTESKKYPHCFGGAPLDAEKAEKLDQALGFLNTFLASSPWVAGDNITIADCSIVASLSTIECSTSDHMASQTRHPGNLLVLMFSSRAIIAYLAEQYGKDDSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFMTIDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPTMDDNGYTLSER
**IAIVALNFYRYLRPDTESKKYPHCFGGAPLDAEKAEKLDQALGFLNTFLASSPWVAGDNITIADCSIVASLSTIECSTSD*****TRHPGNLLVLMFSSRAIIAYLAEQYGKDDSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFMTIDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLK********************
*AIAIVALNFYRYLRPDTESKKYPHCFGGAPLDAEKAEKLDQALGFLNTFLASSPWVAGDNITIADCSIVASLSTIECSTSDHMASQTRHPGNLLVLMFSSRAIIAYLAEQYGKDDSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFMTIDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPTMDDNGYTLSER
MAIAIVALNFYRYLRPDTESKKYPHCFGGAPLDAEKAEKLDQALGFLNTFLASSPWVAGDNITIADCSIVASLSTIECS********TRHPGNLLVLMFSSRAIIAYLAEQYGKDDSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFMTIDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPTMDDNGYTLSER
MAIAIVALNFYRYLRPDTESKKYPHCFGGAPLDAEKAEKLDQALGFLNTFLASSPWVAGDNITIADCSIVASLSTIECSTSDHMASQTRHPGNLLVLMFSSRAIIAYLAEQYGKDDSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFMTIDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPTMDDNGYTLSER
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIAIVALNFYRYLRPDTESKKYPHCFGGAPLDAEKAEKLDQALGFLNTFLASSPWVAGDNITIADCSIVASLSTIECSTSDHMASQTRHPGNLLVLMFSSRAIIAYLAEQYGKDDSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFMTIDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPTMDDNGYTLSER
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query215 2.2.26 [Sep-21-2011]
O77473 216 Glutathione S-transferase yes N/A 0.251 0.25 0.75 2e-23
Q93113 209 Glutathione S-transferase no N/A 0.297 0.306 0.734 3e-23
Q93112 209 Glutathione S-transferase no N/A 0.297 0.306 0.718 5e-23
O77462 186 Glutathione S-transferase no N/A 0.297 0.344 0.707 6e-22
P20432 209 Glutathione S-transferase yes N/A 0.293 0.301 0.609 7e-19
P67805 209 Glutathione S-transferase N/A N/A 0.293 0.301 0.619 1e-18
P30108 209 Glutathione S-transferase N/A N/A 0.279 0.287 0.619 2e-18
P30106 209 Glutathione S-transferase N/A N/A 0.293 0.301 0.619 2e-18
P46431 210 Glutathione S-transferase N/A N/A 0.293 0.3 0.578 1e-17
P46432 210 Glutathione S-transferase N/A N/A 0.293 0.3 0.578 1e-17
>sp|O77473|GST1B_ANOGA Glutathione S-transferase 1, isoform B OS=Anopheles gambiae GN=GstD1 PE=2 SV=2 Back     alignment and function desciption
 Score =  108 bits (271), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 55/64 (85%)

Query: 151 IDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPTMDDNGY 210
           +DFYY+PGSAPCRAVQ+ AA +GV LNLK TDLMKGEH+ PEFLKLNPQH VPT+ DNG+
Sbjct: 1   MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTDLMKGEHMKPEFLKLNPQHCVPTLVDNGF 60

Query: 211 TLSE 214
            L E
Sbjct: 61  ALWE 64




Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Anopheles gambiae (taxid: 7165)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 1EC: 8
>sp|Q93113|GST1D_ANOGA Glutathione S-transferase 1, isoform D OS=Anopheles gambiae GN=GstD1 PE=1 SV=1 Back     alignment and function description
>sp|Q93112|GST1C_ANOGA Glutathione S-transferase 1, isoform C OS=Anopheles gambiae GN=GstD1 PE=1 SV=2 Back     alignment and function description
>sp|O77462|GST1A_ANOGA Glutathione S-transferase 1, isoform A OS=Anopheles gambiae GN=GstD1 PE=2 SV=3 Back     alignment and function description
>sp|P20432|GSTT1_DROME Glutathione S-transferase 1-1 OS=Drosophila melanogaster GN=GstD1 PE=1 SV=1 Back     alignment and function description
>sp|P67805|GSTT1_DROSI Glutathione S-transferase 1-1 OS=Drosophila simulans GN=GstD1 PE=2 SV=2 Back     alignment and function description
>sp|P30108|GSTT1_DROYA Glutathione S-transferase 1-1 OS=Drosophila yakuba GN=GstD1 PE=3 SV=2 Back     alignment and function description
>sp|P30106|GSTT1_DROSE Glutathione S-transferase 1-1 OS=Drosophila sechellia GN=GstD1 PE=3 SV=2 Back     alignment and function description
>sp|P46431|GSTT2_MUSDO Glutathione S-transferase 2 OS=Musca domestica GN=Gst2 PE=2 SV=2 Back     alignment and function description
>sp|P46432|GSTT3_MUSDO Glutathione S-transferase 3 OS=Musca domestica GN=Gst3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query215
312376606 372 hypothetical protein AND_12514 [Anophele 0.869 0.502 0.384 1e-25
270005507 411 hypothetical protein TcasGA2_TC007571 [T 0.855 0.447 0.336 2e-23
380016373 457 PREDICTED: uncharacterized protein LOC10 0.846 0.398 0.361 2e-23
359326557216 glutathione S transferase class delta va 0.293 0.291 0.757 7e-23
91080623216 PREDICTED: similar to glutathione S-tran 0.265 0.263 0.757 1e-22
60678789216 Per a 5 allergen [Periplaneta americana] 0.293 0.291 0.742 3e-22
388523609216 glutathione s-transferase d1 [Cryptocerc 0.306 0.305 0.742 3e-22
359326583216 glutathione S transferase class delta [B 0.306 0.305 0.742 3e-22
154936819216 glutathione S-transferase [Blattella ger 0.306 0.305 0.742 3e-22
161137518216 delta class glutathione S-transferase [B 0.306 0.305 0.742 4e-22
>gi|312376606|gb|EFR23639.1| hypothetical protein AND_12514 [Anopheles darlingi] Back     alignment and taxonomy information
 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 87/226 (38%), Positives = 115/226 (50%), Gaps = 39/226 (17%)

Query: 23  YPHCFGGA-PLDAEKAEKLDQALGFLNTFLASSPWVAG-DNITIADCSIVASLSTIECST 80
           YP  FG   P DA++   ++Q LGFL+ FL    +VAG ++ TIAD SI AS++T E + 
Sbjct: 118 YPQIFGKKLPADADRLRSMEQGLGFLDAFLEGERYVAGGEDFTIADLSIFASIATYEVAG 177

Query: 81  SD------------HMAS--------------QTRHPGNLLV----LMFSSRAIIAYLAE 110
            D            HM S                +H    LV     ++ SRAI  YL E
Sbjct: 178 YDLCQYVNVHRWYEHMKSVAPAADKNAEGAQVNPQHCIPTLVDNGFALWESRAICTYLVE 237

Query: 111 QYGKDDSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFMTIDFYYVPGSAPCRAVQLAAA 170
           +YGKD+ LYPK+P+ R +VNQRLYFD+GTLYQRFADY+    F   P +A        A 
Sbjct: 238 KYGKDEQLYPKEPQKRAVVNQRLYFDMGTLYQRFADYYYPQIFAKQPANAENEKKMKDAV 297

Query: 171 QIGVPLN--LKHTDLMKGEHLTPEFLKLNPQHTVPTMDDNGYTLSE 214
                LN  L     + G+HLT     L+   TV T D  G+ L++
Sbjct: 298 DF---LNTFLDGQKYVAGDHLT--VADLSILATVSTYDVAGFELAK 338




Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270005507|gb|EFA01955.1| hypothetical protein TcasGA2_TC007571 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|380016373|ref|XP_003692160.1| PREDICTED: uncharacterized protein LOC100872123 [Apis florea] Back     alignment and taxonomy information
>gi|359326557|gb|AEV23867.1| glutathione S transferase class delta variant 1 [Periplaneta americana] gi|359326559|gb|AEV23868.1| glutathione S transferase class delta variant 2 [Periplaneta americana] Back     alignment and taxonomy information
>gi|91080623|ref|XP_974273.1| PREDICTED: similar to glutathione S-transferase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|60678789|gb|AAX33729.1| Per a 5 allergen [Periplaneta americana] Back     alignment and taxonomy information
>gi|388523609|gb|AFK49803.1| glutathione s-transferase d1 [Cryptocercus punctulatus] Back     alignment and taxonomy information
>gi|359326583|gb|AEV23880.1| glutathione S transferase class delta [Blattella germanica] Back     alignment and taxonomy information
>gi|154936819|emb|CAO85744.1| glutathione S-transferase [Blattella germanica] Back     alignment and taxonomy information
>gi|161137518|gb|ABX57814.1| delta class glutathione S-transferase [Blattella germanica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query215
UNIPROTKB|O77473 216 GstD1 "Glutathione S-transfera 0.297 0.296 0.75 1e-22
UNIPROTKB|O77462 186 GstD1 "Glutathione S-transfera 0.297 0.344 0.707 1.1e-21
FB|FBgn0001149 209 GstD1 "Glutathione S transfera 0.297 0.306 0.609 1.7e-18
FB|FBgn0010041216 GstD5 "Glutathione S transfera 0.423 0.421 0.436 3.7e-16
FB|FBgn0010042215 GstD6 "Glutathione S transfera 0.269 0.269 0.610 6e-16
FB|FBgn0038020 218 GstD9 "Glutathione S transfera 0.297 0.293 0.531 7.7e-16
FB|FBgn0010038 215 GstD2 "Glutathione S transfera 0.297 0.297 0.531 2e-15
FB|FBgn0010044 212 GstD8 "Glutathione S transfera 0.297 0.301 0.546 2.6e-15
UNIPROTKB|O76483 218 GstD7 "Glutathione S-transfera 0.306 0.302 0.545 6.9e-15
FB|FBgn0010040 215 GstD4 "Glutathione S transfera 0.297 0.297 0.515 2.3e-14
UNIPROTKB|O77473 GstD1 "Glutathione S-transferase 1, isoform B" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
 Score = 263 (97.6 bits), Expect = 1.0e-22, P = 1.0e-22
 Identities = 48/64 (75%), Positives = 55/64 (85%)

Query:   151 IDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPTMDDNGY 210
             +DFYY+PGSAPCRAVQ+ AA +GV LNLK TDLMKGEH+ PEFLKLNPQH VPT+ DNG+
Sbjct:     1 MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTDLMKGEHMKPEFLKLNPQHCVPTLVDNGF 60

Query:   211 TLSE 214
              L E
Sbjct:    61 ALWE 64


GO:0004364 "glutathione transferase activity" evidence=ISS
GO:0005576 "extracellular region" evidence=ISS
GO:0006749 "glutathione metabolic process" evidence=ISS
UNIPROTKB|O77462 GstD1 "Glutathione S-transferase 1, isoform A" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
FB|FBgn0001149 GstD1 "Glutathione S transferase D1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0010041 GstD5 "Glutathione S transferase D5" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0010042 GstD6 "Glutathione S transferase D6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038020 GstD9 "Glutathione S transferase D9" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0010038 GstD2 "Glutathione S transferase D2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0010044 GstD8 "Glutathione S transferase D8" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|O76483 GstD7 "Glutathione S-transferase D7" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
FB|FBgn0010040 GstD4 "Glutathione S transferase D4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.5.1.18LOW CONFIDENCE prediction!
3rd Layer2.5.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query215
cd0304574 cd03045, GST_N_Delta_Epsilon, GST_N family, Class 7e-33
cd03177117 cd03177, GST_C_Delta_Epsilon, C-terminal, alpha he 4e-20
cd0305076 cd03050, GST_N_Theta, GST_N family, Class Theta su 5e-16
cd0057071 cd00570, GST_N_family, Glutathione S-transferase ( 2e-13
cd0305673 cd03056, GST_N_4, GST_N family, unknown subfamily 2e-12
cd03177117 cd03177, GST_C_Delta_Epsilon, C-terminal, alpha he 4e-10
cd0305376 cd03053, GST_N_Phi, GST_N family, Class Phi subfam 5e-10
cd0304881 cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-lik 1e-08
cd0304273 cd03042, GST_N_Zeta, GST_N family, Class Zeta subf 2e-08
cd0305777 cd03057, GST_N_Beta, GST_N family, Class Beta subf 3e-08
cd03183126 cd03183, GST_C_Theta, C-terminal, alpha helical do 6e-07
COG0625 211 COG0625, Gst, Glutathione S-transferase [Posttrans 8e-07
cd0305174 cd03051, GST_N_GTT2_like, GST_N family, Saccharomy 8e-07
TIGR01262 210 TIGR01262, maiA, maleylacetoacetate isomerase 1e-06
PLN02395 215 PLN02395, PLN02395, glutathione S-transferase 1e-06
cd0304475 cd03044, GST_N_EF1Bgamma, GST_N family, Gamma subu 6e-06
cd03206100 cd03206, GST_C_7, C-terminal, alpha helical domain 7e-06
pfam0279874 pfam02798, GST_N, Glutathione S-transferase, N-ter 7e-06
cd10424103 cd10424, GST_C_9, C-terminal, alpha helical domain 1e-05
cd03181123 cd03181, GST_C_EF1Bgamma_like, Glutathione S-trans 5e-05
cd0304676 cd03046, GST_N_GTT1_like, GST_N family, Saccharomy 5e-05
pfam1341775 pfam13417, GST_N_3, Glutathione S-transferase, N-t 2e-04
cd00299100 cd00299, GST_C_family, C-terminal, alpha helical d 5e-04
COG0625211 COG0625, Gst, Glutathione S-transferase [Posttrans 0.002
pfam0004392 pfam00043, GST_C, Glutathione S-transferase, C-ter 0.002
cd0304773 cd03047, GST_N_2, GST_N family, unknown subfamily 0.002
PRK15113 214 PRK15113, PRK15113, glutathione S-transferase; Pro 0.002
PRK13972 215 PRK13972, PRK13972, GSH-dependent disulfide bond o 0.004
>gnl|CDD|239343 cd03045, GST_N_Delta_Epsilon, GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
 Score =  113 bits (284), Expect = 7e-33
 Identities = 45/64 (70%), Positives = 51/64 (79%)

Query: 151 IDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPTMDDNGY 210
           ID YY+PGS PCRAV L A  +G+ LNLK  +LMKGEHL PEFLKLNPQHTVPT+ DNG+
Sbjct: 1   IDLYYLPGSPPCRAVLLTAKALGLELNLKEVNLMKGEHLKPEFLKLNPQHTVPTLVDNGF 60

Query: 211 TLSE 214
            L E
Sbjct: 61  VLWE 64


GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. The class Delta and Epsilon subfamily is made up primarily of insect GSTs, which play major roles in insecticide resistance by facilitating reductive dehydrochlorination of insecticides or conjugating them with GSH to produce water-soluble metabolites that are easily excreted. They are also implicated in protection against cellular damage by oxidative stress. Length = 74

>gnl|CDD|198287 cd03177, GST_C_Delta_Epsilon, C-terminal, alpha helical domain of Class Delta and Epsilon Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|239348 cd03050, GST_N_Theta, GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>gnl|CDD|238319 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|239354 cd03056, GST_N_4, GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>gnl|CDD|198287 cd03177, GST_C_Delta_Epsilon, C-terminal, alpha helical domain of Class Delta and Epsilon Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|239351 cd03053, GST_N_Phi, GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>gnl|CDD|239346 cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>gnl|CDD|239340 cd03042, GST_N_Zeta, GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|239355 cd03057, GST_N_Beta, GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|198292 cd03183, GST_C_Theta, C-terminal, alpha helical domain of Class Theta Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|239349 cd03051, GST_N_GTT2_like, GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>gnl|CDD|233333 TIGR01262, maiA, maleylacetoacetate isomerase Back     alignment and domain information
>gnl|CDD|166036 PLN02395, PLN02395, glutathione S-transferase Back     alignment and domain information
>gnl|CDD|239342 cd03044, GST_N_EF1Bgamma, GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>gnl|CDD|198315 cd03206, GST_C_7, C-terminal, alpha helical domain of an unknown subfamily 7 of Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|217234 pfam02798, GST_N, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|198344 cd10424, GST_C_9, C-terminal, alpha helical domain of an unknown subfamily 9 of Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|198290 cd03181, GST_C_EF1Bgamma_like, Glutathione S-transferase C-terminal-like, alpha helical domain of the Gamma subunit of Elongation Factor 1B and similar proteins Back     alignment and domain information
>gnl|CDD|239344 cd03046, GST_N_GTT1_like, GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>gnl|CDD|205595 pfam13417, GST_N_3, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|198286 cd00299, GST_C_family, C-terminal, alpha helical domain of the Glutathione S-transferase family Back     alignment and domain information
>gnl|CDD|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215674 pfam00043, GST_C, Glutathione S-transferase, C-terminal domain Back     alignment and domain information
>gnl|CDD|239345 cd03047, GST_N_2, GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>gnl|CDD|185068 PRK15113, PRK15113, glutathione S-transferase; Provisional Back     alignment and domain information
>gnl|CDD|172475 PRK13972, PRK13972, GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 215
PLN02473214 glutathione S-transferase 99.83
PLN02395215 glutathione S-transferase 99.83
KOG0867|consensus226 99.82
COG0625211 Gst Glutathione S-transferase [Posttranslational m 99.82
PRK10542201 glutathionine S-transferase; Provisional 99.82
PRK13972215 GSH-dependent disulfide bond oxidoreductase; Provi 99.82
PRK09481211 sspA stringent starvation protein A; Provisional 99.81
KOG0868|consensus217 99.81
PRK15113214 glutathione S-transferase; Provisional 99.81
PRK11752264 putative S-transferase; Provisional 99.77
PRK10357202 putative glutathione S-transferase; Provisional 99.77
TIGR01262210 maiA maleylacetoacetate isomerase. Maleylacetoacet 99.74
PRK10387210 glutaredoxin 2; Provisional 99.66
KOG0406|consensus231 99.6
PTZ00057205 glutathione s-transferase; Provisional 99.6
PLN02378213 glutathione S-transferase DHAR1 99.59
TIGR02182209 GRXB Glutaredoxin, GrxB family. This model include 99.55
PLN02817265 glutathione dehydrogenase (ascorbate) 99.52
TIGR00862236 O-ClC intracellular chloride channel protein. Thes 99.5
PLN02907 722 glutamate-tRNA ligase 99.47
KOG1695|consensus206 99.37
cd0307582 GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar 99.1
cd0305777 GST_N_Beta GST_N family, Class Beta subfamily; GST 99.04
cd0305076 GST_N_Theta GST_N family, Class Theta subfamily; c 99.04
cd0304676 GST_N_GTT1_like GST_N family, Saccharomyces cerevi 99.02
cd0304881 GST_N_Ure2p_like GST_N family, Ure2p-like subfamil 99.0
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and 98.98
cd0305273 GST_N_GDAP1 GST_N family, Ganglioside-induced diff 98.98
cd0307779 GST_N_Alpha GST_N family, Class Alpha subfamily; G 98.98
PF0279876 GST_N: Glutathione S-transferase, N-terminal domai 98.97
cd0303884 GST_N_etherase_LigE GST_N family, Beta etherase Li 98.92
cd0307974 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me 98.89
cd0305376 GST_N_Phi GST_N family, Class Phi subfamily; compo 98.85
cd0306191 GST_N_CLIC GST_N family, Chloride Intracellular Ch 98.83
cd0304773 GST_N_2 GST_N family, unknown subfamily 2; compose 98.8
cd0304475 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo 98.8
KOG4420|consensus 325 98.79
cd0307673 GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar 98.78
cd0304273 GST_N_Zeta GST_N family, Class Zeta subfamily; GST 98.76
cd0308075 GST_N_Metaxin_like GST_N family, Metaxin subfamily 98.76
cd0305874 GST_N_Tau GST_N family, Class Tau subfamily; GSTs 98.74
PF1341775 GST_N_3: Glutathione S-transferase, N-terminal dom 98.73
cd0305673 GST_N_4 GST_N family, unknown subfamily 4; compose 98.7
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 98.69
cd0305973 GST_N_SspA GST_N family, Stringent starvation prot 98.68
cd0304373 GST_N_1 GST_N family, unknown subfamily 1; compose 98.66
cd0303972 GST_N_Sigma_like GST_N family, Class Sigma_like; c 98.65
cd03189119 GST_C_GTT1_like GST_C family, Saccharomyces cerevi 98.64
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevi 98.6
cd03196115 GST_C_5 GST_C family, unknown subfamily 5; compose 98.55
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub 98.54
cd0304973 GST_N_3 GST_N family, unknown subfamily 3; compose 98.52
PF1340970 GST_N_2: Glutathione S-transferase, N-terminal dom 98.49
KOG1422|consensus221 98.47
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandi 98.41
cd03179105 GST_C_1 GST_C family, unknown subfamily 1; compose 98.38
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; G 98.37
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 98.35
cd0305472 GST_N_Metaxin GST_N family, Metaxin subfamily; com 98.33
cd03188114 GST_C_Beta GST_C family, Class Beta subfamily; GST 98.31
cd03186107 GST_C_SspA GST_N family, Stringent starvation prot 98.27
cd03180110 GST_C_2 GST_C family, unknown subfamily 2; compose 98.27
cd03177118 GST_C_Delta_Epsilon GST_C family, Class Delta and 98.26
cd03182117 GST_C_GTT2_like GST_C family, Saccharomyces cerevi 98.23
cd0320096 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed 98.23
cd03187118 GST_C_Phi GST_C family, Class Phi subfamily; compo 98.22
cd0305273 GST_N_GDAP1 GST_N family, Ganglioside-induced diff 98.19
cd03178113 GST_C_Ure2p_like GST_C family, Ure2p-like subfamil 98.19
cd03185126 GST_C_Tau GST_C family, Class Tau subfamily; GSTs 98.18
cd03191121 GST_C_Zeta GST_C family, Class Zeta subfamily; GST 98.1
cd0057071 GST_N_family Glutathione S-transferase (GST) famil 98.03
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and 98.03
KOG0867|consensus 226 98.02
cd03181123 GST_C_EFB1gamma GST_C family, Gamma subunit of Elo 97.97
cd0304773 GST_N_2 GST_N family, unknown subfamily 2; compose 97.93
cd03190142 GST_C_ECM4_like GST_C family, ECM4-like subfamily; 97.86
cd0305076 GST_N_Theta GST_N family, Class Theta subfamily; c 97.85
cd03195114 GST_C_4 GST_C family, unknown subfamily 4; compose 97.81
cd03183126 GST_C_Theta GST_C family, Class Theta subfamily; c 97.78
PLN02473 214 glutathione S-transferase 97.78
cd0305376 GST_N_Phi GST_N family, Class Phi subfamily; compo 97.76
cd0305673 GST_N_4 GST_N family, unknown subfamily 4; compose 97.74
PRK15113 214 glutathione S-transferase; Provisional 97.71
cd03203120 GST_C_Lambda GST_C family, Class Lambda subfamily; 97.63
cd0304881 GST_N_Ure2p_like GST_N family, Ure2p-like subfamil 97.6
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevi 97.59
cd0304273 GST_N_Zeta GST_N family, Class Zeta subfamily; GST 97.58
PF0279876 GST_N: Glutathione S-transferase, N-terminal domai 97.45
PRK09481 211 sspA stringent starvation protein A; Provisional 97.44
cd00299100 GST_C_family Glutathione S-transferase (GST) famil 97.44
cd03207103 GST_C_8 GST_C family, unknown subfamily 8; compose 97.43
cd0305777 GST_N_Beta GST_N family, Class Beta subfamily; GST 97.42
PLN02395 215 glutathione S-transferase 97.41
cd03206100 GST_C_7 GST_C family, unknown subfamily 7; compose 97.39
KOG2903|consensus319 97.39
COG0435324 ECM4 Predicted glutathione S-transferase [Posttran 97.38
cd0304475 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo 97.37
PRK13972 215 GSH-dependent disulfide bond oxidoreductase; Provi 97.36
cd03184124 GST_C_Omega GST_C family, Class Omega subfamily; G 97.3
cd0304676 GST_N_GTT1_like GST_N family, Saccharomyces cerevi 97.3
cd0305973 GST_N_SspA GST_N family, Stringent starvation prot 97.26
COG0625 211 Gst Glutathione S-transferase [Posttranslational m 97.22
cd0307673 GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar 97.18
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 97.15
cd0307873 GST_N_Metaxin1_like GST_N family, Metaxin subfamil 97.13
cd0305874 GST_N_Tau GST_N family, Class Tau subfamily; GSTs 97.12
cd0303972 GST_N_Sigma_like GST_N family, Class Sigma_like; c 97.07
PRK11752 264 putative S-transferase; Provisional 97.06
PF1449799 GST_C_3: Glutathione S-transferase, C-terminal dom 97.0
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 97.0
KOG0868|consensus 217 96.99
PRK10542 201 glutathionine S-transferase; Provisional 96.98
cd0307582 GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar 96.96
cd0304373 GST_N_1 GST_N family, unknown subfamily 1; compose 96.92
KOG3027|consensus257 96.92
TIGR01262 210 maiA maleylacetoacetate isomerase. Maleylacetoacet 96.88
KOG4244|consensus281 96.85
PF1341775 GST_N_3: Glutathione S-transferase, N-terminal dom 96.76
cd0304973 GST_N_3 GST_N family, unknown subfamily 3; compose 96.59
PLN02378 213 glutathione S-transferase DHAR1 96.5
cd0306191 GST_N_CLIC GST_N family, Chloride Intracellular Ch 96.48
PRK10357 202 putative glutathione S-transferase; Provisional 96.39
PF1340970 GST_N_2: Glutathione S-transferase, N-terminal dom 96.39
cd03192104 GST_C_Sigma_like GST_C family, Class Sigma_like; c 96.29
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; G 96.26
PF1341069 GST_C_2: Glutathione S-transferase, C-terminal dom 96.25
cd0319388 GST_C_Metaxin GST_C family, Metaxin subfamily; com 96.2
cd0303884 GST_N_etherase_LigE GST_N family, Beta etherase Li 96.11
TIGR00862 236 O-ClC intracellular chloride channel protein. Thes 95.95
cd03194114 GST_C_3 GST_C family, unknown subfamily 3; compose 95.92
cd03198134 GST_C_CLIC GST_C family, Chloride Intracellular Ch 95.71
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub 95.55
cd03209121 GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar 95.52
cd0057071 GST_N_family Glutathione S-transferase (GST) famil 95.49
PRK10387 210 glutaredoxin 2; Provisional 95.47
cd0308075 GST_N_Metaxin_like GST_N family, Metaxin subfamily 95.4
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandi 95.38
PF0004395 GST_C: Glutathione S-transferase, C-terminal domai 95.18
cd03204111 GST_C_GDAP1 GST_C family, Ganglioside-induced diff 95.14
PLN02817 265 glutathione dehydrogenase (ascorbate) 94.93
cd03201121 GST_C_DHAR GST_C family, Dehydroascorbate Reductas 94.85
PTZ00057 205 glutathione s-transferase; Provisional 94.81
TIGR02182 209 GRXB Glutaredoxin, GrxB family. This model include 94.73
cd03188114 GST_C_Beta GST_C family, Class Beta subfamily; GST 94.57
cd03202124 GST_C_etherase_LigE GST_C family, Beta etherase Li 94.26
cd03177118 GST_C_Delta_Epsilon GST_C family, Class Delta and 93.97
cd0320598 GST_C_6 GST_C family, unknown subfamily 6; compose 93.93
COG2999215 GrxB Glutaredoxin 2 [Posttranslational modificatio 93.92
cd0307779 GST_N_Alpha GST_N family, Class Alpha subfamily; G 93.9
cd0305472 GST_N_Metaxin GST_N family, Metaxin subfamily; com 93.84
cd0307974 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me 93.39
KOG3029|consensus 370 93.11
cd03211126 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me 92.96
cd03210126 GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar 92.8
cd03189119 GST_C_GTT1_like GST_C family, Saccharomyces cerevi 92.52
KOG3028|consensus313 92.49
cd03197149 GST_C_mPGES2 GST_C family; microsomal Prostaglandi 92.33
PF1056872 Tom37: Outer mitochondrial membrane transport comp 92.11
PF0004395 GST_C: Glutathione S-transferase, C-terminal domai 91.88
cd03196115 GST_C_5 GST_C family, unknown subfamily 5; compose 91.82
cd03179105 GST_C_1 GST_C family, unknown subfamily 1; compose 91.63
cd0319388 GST_C_Metaxin GST_C family, Metaxin subfamily; com 91.37
PF1341069 GST_C_2: Glutathione S-transferase, C-terminal dom 90.85
cd03190142 GST_C_ECM4_like GST_C family, ECM4-like subfamily; 90.83
cd03180110 GST_C_2 GST_C family, unknown subfamily 2; compose 90.78
cd03206100 GST_C_7 GST_C family, unknown subfamily 7; compose 90.76
COG0435324 ECM4 Predicted glutathione S-transferase [Posttran 90.69
cd03208137 GST_C_Alpha GST_C family, Class Alpha subfamily; G 90.61
cd03198134 GST_C_CLIC GST_C family, Chloride Intracellular Ch 90.54
cd00299100 GST_C_family Glutathione S-transferase (GST) famil 90.32
cd03201121 GST_C_DHAR GST_C family, Dehydroascorbate Reductas 90.22
cd03207103 GST_C_8 GST_C family, unknown subfamily 8; compose 90.18
cd03178113 GST_C_Ure2p_like GST_C family, Ure2p-like subfamil 90.1
cd03187118 GST_C_Phi GST_C family, Class Phi subfamily; compo 89.9
cd03182117 GST_C_GTT2_like GST_C family, Saccharomyces cerevi 89.86
cd03212137 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, 89.66
cd03186107 GST_C_SspA GST_N family, Stringent starvation prot 89.45
cd03185126 GST_C_Tau GST_C family, Class Tau subfamily; GSTs 89.2
KOG0406|consensus 231 89.04
KOG4420|consensus 325 88.57
cd03202124 GST_C_etherase_LigE GST_C family, Beta etherase Li 88.47
cd03208137 GST_C_Alpha GST_C family, Class Alpha subfamily; G 88.37
cd03209121 GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar 87.68
cd03181123 GST_C_EFB1gamma GST_C family, Gamma subunit of Elo 86.96
cd03184124 GST_C_Omega GST_C family, Class Omega subfamily; G 85.57
cd0320096 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed 85.47
cd03210126 GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar 85.13
cd03203120 GST_C_Lambda GST_C family, Class Lambda subfamily; 84.37
cd03204111 GST_C_GDAP1 GST_C family, Ganglioside-induced diff 84.03
PF09635122 MetRS-N: MetRS-N binding domain; InterPro: IPR0182 83.89
cd03183126 GST_C_Theta GST_C family, Class Theta subfamily; c 83.57
PF1449799 GST_C_3: Glutathione S-transferase, C-terminal dom 82.49
PF14834117 GST_C_4: Glutathione S-transferase, C-terminal dom 81.91
>PLN02473 glutathione S-transferase Back     alignment and domain information
Probab=99.83  E-value=9.5e-22  Score=158.58  Aligned_cols=152  Identities=16%  Similarity=0.152  Sum_probs=105.0

Q ss_pred             hHHHHhhCCCCcccccceeecccccccccceeeccCCcCC-------CCcceecC--CCCeeeeeHHHHHHHHHHHhCCC
Q psy10373         45 GFLNTFLASSPWVAGDNITIADCSIVASLSTIECSTSDHM-------ASQTRHPG--NLLVLMFSSRAIIAYLAEQYGKD  115 (215)
Q Consensus        45 ~~l~~~~~g~~y~~~~~l~l~~~~~~~~~~~~~~~~~e~~-------~P~GkVPv--ddg~~L~ES~AI~~YL~~~~~~~  115 (215)
                      |+++.-.+.++.++.+.|...+++++.  ..+|+.+++++       ||+|+||+  |||.+|+||.||++||+++|++.
T Consensus         4 kLy~~~~s~~~~rv~~~L~e~gi~ye~--~~v~~~~~~~~~~~~~~~nP~g~vP~L~~~g~~l~ES~aI~~YL~~~~~~~   81 (214)
T PLN02473          4 KVYGQIKAANPQRVLLCFLEKGIEFEV--IHVDLDKLEQKKPEHLLRQPFGQVPAIEDGDLKLFESRAIARYYATKYADQ   81 (214)
T ss_pred             EEecCCCCCchHHHHHHHHHcCCCceE--EEecCcccccCCHHHHhhCCCCCCCeEEECCEEEEehHHHHHHHHHHcCCc
Confidence            444333345667888878778887655  33477666554       59999999  88999999999999999999742


Q ss_pred             -CCCCCCCHHHHHHHHHHHhhhccccchhcccceeeccccC-CCCCCch----HHHHHHHHHcC-CCcEEEeccCCCCCC
Q psy10373        116 -DSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFMTIDFYY-VPGSAPC----RAVQLAAAQIG-VPLNLKHTDLMKGEH  188 (215)
Q Consensus       116 -~~L~p~d~~era~v~~wl~~~~~~l~~~~~~~~~~~~l~~-~~~~~~~----~~~~~~~~~l~-le~~L~~~~fl~Gd~  188 (215)
                       ..|+|.++.+|+++++|+.|.++.+.+.+........+.. .......    .....+.+.++ +|.+|++++|++||+
T Consensus        82 ~~~l~p~~~~~ra~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~~~l~Gd~  161 (214)
T PLN02473         82 GTDLLGKTLEHRAIVDQWVEVENNYFYAVALPLVINLVFKPRLGEPCDVALVEELKVKFDKVLDVYENRLATNRYLGGDE  161 (214)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHhcccHHHHHHHHHHHhcccccCCCChHHHHHHHHHHHHHHHHHHHHhccCCcccCCC
Confidence             2599999999999999999988776553322111111111 1111111    12234445555 588888889999999


Q ss_pred             CCHhHHhhCC
Q psy10373        189 LTPEFLKLNP  198 (215)
Q Consensus       189 ~T~ADi~l~P  198 (215)
                      +|+||+++.|
T Consensus       162 ~t~ADi~~~~  171 (214)
T PLN02473        162 FTLADLTHMP  171 (214)
T ss_pred             CCHHHHHHHH
Confidence            9999999854



>PLN02395 glutathione S-transferase Back     alignment and domain information
>KOG0867|consensus Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10542 glutathionine S-transferase; Provisional Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>KOG0868|consensus Back     alignment and domain information
>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>PRK11752 putative S-transferase; Provisional Back     alignment and domain information
>PRK10357 putative glutathione S-transferase; Provisional Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>KOG0406|consensus Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>PLN02907 glutamate-tRNA ligase Back     alignment and domain information
>KOG1695|consensus Back     alignment and domain information
>cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>KOG4420|consensus Back     alignment and domain information
>cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A Back     alignment and domain information
>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha Back     alignment and domain information
>cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B Back     alignment and domain information
>KOG1422|consensus Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene Back     alignment and domain information
>cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>KOG0867|consensus Back     alignment and domain information
>cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 Back     alignment and domain information
>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>PLN02473 glutathione S-transferase Back     alignment and domain information
>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs Back     alignment and domain information
>cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PLN02395 glutathione S-transferase Back     alignment and domain information
>cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>KOG2903|consensus Back     alignment and domain information
>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi Back     alignment and domain information
>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha Back     alignment and domain information
>PRK11752 putative S-transferase; Provisional Back     alignment and domain information
>PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>KOG0868|consensus Back     alignment and domain information
>PRK10542 glutathionine S-transferase; Provisional Back     alignment and domain information
>cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>KOG3027|consensus Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>KOG4244|consensus Back     alignment and domain information
>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A Back     alignment and domain information
>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
>PRK10357 putative glutathione S-transferase; Provisional Back     alignment and domain information
>PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B Back     alignment and domain information
>cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B Back     alignment and domain information
>cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family Back     alignment and domain information
>cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>KOG3029|consensus Back     alignment and domain information
>cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>KOG3028|consensus Back     alignment and domain information
>cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space Back     alignment and domain information
>PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B Back     alignment and domain information
>cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 Back     alignment and domain information
>cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins Back     alignment and domain information
>cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant Back     alignment and domain information
>cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins Back     alignment and domain information
>cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>KOG0406|consensus Back     alignment and domain information
>KOG4420|consensus Back     alignment and domain information
>cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene Back     alignment and domain information
>cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs Back     alignment and domain information
>cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>PF09635 MetRS-N: MetRS-N binding domain; InterPro: IPR018285 This entry represents the N-terminal domain of methionyl-tRNA synthetase (MetRS) Back     alignment and domain information
>cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B Back     alignment and domain information
>PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query215
1pn9_A 209 Crystal Structure Of An Insect Delta-class Glutathi 2e-24
1jlv_A 209 Anopheles Dirus Species B Glutathione S-transferase 6e-23
3g7j_A 219 Crystal Structure Of A Genetically Modified Delta C 7e-22
3f6d_A 219 Crystal Structure Of A Genetically Modified Delta C 7e-22
1jlw_A 219 Anopheles Dirus Species B Glutathione S-Transferase 8e-22
3ein_A 209 Delta Class Gst Length = 209 5e-20
1r5a_A 218 Glutathione S-Transferase Length = 218 6e-17
3vk9_A216 Crystal Structure Of Delta-Class Glutathione Transf 8e-17
3vk9_A 216 Crystal Structure Of Delta-Class Glutathione Transf 3e-16
1v2a_A210 Glutathione S-transferase 1-6 From Anopheles Dirus 7e-15
1v2a_A 210 Glutathione S-transferase 1-6 From Anopheles Dirus 9e-09
2il3_A 221 Structures Of An Insect Epsilon-Class Glutathione S 2e-14
3f6f_A210 Crystal Structure Of Glutathione Transferase Dmgstd 6e-14
3f6f_A 210 Crystal Structure Of Glutathione Transferase Dmgstd 1e-13
3ay8_A 216 Glutathione S-Transferase Unclassified 2 From Bomby 3e-13
3vwx_A222 Structural Analysis Of An Epsilon-class Glutathione 2e-11
3vwx_A 222 Structural Analysis Of An Epsilon-class Glutathione 5e-08
2c3q_A 247 Human Glutathione-S-Transferase T1-1 W234r Mutant, 6e-09
2c3n_A 247 Human Glutathione-S-Transferase T1-1, Apo Form Leng 6e-09
4hi7_A228 Crystal Structure Of Glutathione Transferase Homolo 6e-09
4hi7_A 228 Crystal Structure Of Glutathione Transferase Homolo 1e-07
1ljr_A 244 Glutathione Transferase (Hgst T2-2) From Human Leng 3e-08
3qav_A 243 Crystal Structure Of A Glutathione S-transferase Fr 4e-04
>pdb|1PN9|A Chain A, Crystal Structure Of An Insect Delta-class Glutathione S- Transferase From A Ddt-resistant Strain Of The Malaria Vector Anopheles Gambiae Length = 209 Back     alignment and structure

Iteration: 1

Score = 108 bits (270), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 47/64 (73%), Positives = 55/64 (85%) Query: 151 IDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPTMDDNGY 210 +DFYY+PGSAPCRAVQ+ AA +GV LNLK TDLMKGEH+ PEFLKLNPQH +PT+ DNG+ Sbjct: 1 MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTDLMKGEHMKPEFLKLNPQHCIPTLVDNGF 60 Query: 211 TLSE 214 L E Sbjct: 61 ALWE 64
>pdb|1JLV|A Chain A, Anopheles Dirus Species B Glutathione S-transferases 1-3 Length = 209 Back     alignment and structure
>pdb|3G7J|A Chain A, Crystal Structure Of A Genetically Modified Delta Class Gst (adgstd4- 4) From Anopheles Dirus, Y119e, In Complex With S-hexyl Glutathione Length = 219 Back     alignment and structure
>pdb|3F6D|A Chain A, Crystal Structure Of A Genetically Modified Delta Class Gst (Adgstd4- 4) From Anopheles Dirus, F123a, In Complex With S-Hexyl Glutathione Length = 219 Back     alignment and structure
>pdb|1JLW|A Chain A, Anopheles Dirus Species B Glutathione S-Transferases 1-4 Length = 219 Back     alignment and structure
>pdb|3EIN|A Chain A, Delta Class Gst Length = 209 Back     alignment and structure
>pdb|1R5A|A Chain A, Glutathione S-Transferase Length = 218 Back     alignment and structure
>pdb|3VK9|A Chain A, Crystal Structure Of Delta-Class Glutathione Transferase From Silkmoth Length = 216 Back     alignment and structure
>pdb|3VK9|A Chain A, Crystal Structure Of Delta-Class Glutathione Transferase From Silkmoth Length = 216 Back     alignment and structure
>pdb|1V2A|A Chain A, Glutathione S-transferase 1-6 From Anopheles Dirus Species B Length = 210 Back     alignment and structure
>pdb|1V2A|A Chain A, Glutathione S-transferase 1-6 From Anopheles Dirus Species B Length = 210 Back     alignment and structure
>pdb|2IL3|A Chain A, Structures Of An Insect Epsilon-Class Glutathione S- Transferase From The Malaria Vector Anopheles Gambiae: Evidence For High Ddt-Detoxifying Activity Length = 221 Back     alignment and structure
>pdb|3F6F|A Chain A, Crystal Structure Of Glutathione Transferase Dmgstd10 From Drosophila Melanogaster Length = 210 Back     alignment and structure
>pdb|3F6F|A Chain A, Crystal Structure Of Glutathione Transferase Dmgstd10 From Drosophila Melanogaster Length = 210 Back     alignment and structure
>pdb|3AY8|A Chain A, Glutathione S-Transferase Unclassified 2 From Bombyx Mori Length = 216 Back     alignment and structure
>pdb|3VWX|A Chain A, Structural Analysis Of An Epsilon-class Glutathione S-transferase From Housefly, Musca Domestica Length = 222 Back     alignment and structure
>pdb|3VWX|A Chain A, Structural Analysis Of An Epsilon-class Glutathione S-transferase From Housefly, Musca Domestica Length = 222 Back     alignment and structure
>pdb|2C3Q|A Chain A, Human Glutathione-S-Transferase T1-1 W234r Mutant, Complex With S-Hexylglutathione Length = 247 Back     alignment and structure
>pdb|2C3N|A Chain A, Human Glutathione-S-Transferase T1-1, Apo Form Length = 247 Back     alignment and structure
>pdb|4HI7|A Chain A, Crystal Structure Of Glutathione Transferase Homolog From Drosophilia Mojavensis, Target Efi-501819, With Bound Glutathione Length = 228 Back     alignment and structure
>pdb|4HI7|A Chain A, Crystal Structure Of Glutathione Transferase Homolog From Drosophilia Mojavensis, Target Efi-501819, With Bound Glutathione Length = 228 Back     alignment and structure
>pdb|1LJR|A Chain A, Glutathione Transferase (Hgst T2-2) From Human Length = 244 Back     alignment and structure
>pdb|3QAV|A Chain A, Crystal Structure Of A Glutathione S-transferase From Antarctic Clam Laternula Elliptica Length = 243 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query215
1r5a_A 218 Glutathione transferase; glutathione S-transferase 3e-32
1r5a_A218 Glutathione transferase; glutathione S-transferase 1e-21
1r5a_A218 Glutathione transferase; glutathione S-transferase 9e-16
1ljr_A 244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 6e-31
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 2e-19
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 2e-09
1pn9_A 209 GST class-delta, glutathione S-transferase 1-6; pr 6e-31
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 4e-23
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 1e-15
3ay8_A 216 Glutathione S-transferase; GST fold, GST binding, 1e-30
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 3e-21
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 1e-13
2imi_A 221 Epsilon-class glutathione S-transferase; HET: GSH; 2e-30
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 4e-21
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 6e-11
3ein_A 209 GST class-theta, glutathione S-transferase 1-1; de 2e-30
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 6e-24
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 2e-15
2c3n_A 247 Glutathione S-transferase theta 1; glutathione tra 5e-30
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 4e-18
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 3e-10
3f6d_A 219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 3e-29
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 5e-21
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 9e-11
1v2a_A 210 Glutathione transferase GST1-6; glutathione S-tran 2e-28
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 9e-22
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 1e-12
3qav_A 243 RHO-class glutathione S-transferase; cytosol; 2.10 2e-25
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 1e-12
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 2e-08
1gnw_A 211 Glutathione S-transferase; herbicide detoxificatio 2e-24
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 9e-09
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 1e-08
1axd_A 209 Glutathione S-transferase I; transferase, herbicid 8e-22
1axd_A209 Glutathione S-transferase I; transferase, herbicid 5e-13
1axd_A209 Glutathione S-transferase I; transferase, herbicid 2e-08
1e6b_A 221 Glutathione S-transferase; 1.65A {Arabidopsis thal 2e-21
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 2e-10
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 2e-05
2v6k_A 214 Maleylpyruvate isomerase; glutathione-S-transferas 7e-19
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 1e-07
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 1e-04
3ibh_A 233 GST-II, saccharomyces cerevisiae GTT2; glutathione 9e-19
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 2e-09
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 2e-08
2cz2_A 223 Maleylacetoacetate isomerase; structural genomics, 2e-18
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 3e-08
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 3e-06
1aw9_A 216 Glutathione S-transferase III; herbicide detoxific 6e-17
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 3e-09
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 2e-06
3m8n_A 225 Possible glutathione S-transferase; PSI-II, struct 3e-16
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 8e-06
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 9e-06
3niv_A 222 Glutathione S-transferase; structural genomics, PS 6e-15
3niv_A222 Glutathione S-transferase; structural genomics, PS 2e-04
3bby_A 215 Uncharacterized GST-like protein YFCF; NP_416804.1 8e-15
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 5e-12
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 5e-05
4exj_A 238 Uncharacterized protein; transferase-like protein, 1e-13
4exj_A238 Uncharacterized protein; transferase-like protein, 2e-09
4exj_A238 Uncharacterized protein; transferase-like protein, 2e-04
3n5o_A 235 Glutathione transferase; seattle structural genomi 2e-13
3n5o_A235 Glutathione transferase; seattle structural genomi 1e-05
3m3m_A 210 Glutathione S-transferase; PSI-II, structural geno 6e-12
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 3e-04
1n2a_A 201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 8e-12
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 6e-06
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 3e-04
2dsa_A 203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 5e-11
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 3e-05
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 2e-04
4g9h_A 211 Glutathione S-transferase; GST, enzyme function in 1e-10
4g9h_A211 Glutathione S-transferase; GST, enzyme function in 3e-06
4g9h_A211 Glutathione S-transferase; GST, enzyme function in 2e-04
1pmt_A 203 PMGST, GST B1-1, glutathione transferase; glutathi 1e-10
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 2e-05
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 2e-04
3uar_A 227 Glutathione S-transferase; GSH binding site; HET: 6e-10
3uar_A227 Glutathione S-transferase; GSH binding site; HET: 1e-04
3lxz_A 229 Glutathione S-transferase family protein; structur 1e-09
3lxz_A229 Glutathione S-transferase family protein; structur 5e-07
2pvq_A 201 Glutathione S-transferase; xenobiotics detoxificat 3e-09
1f2e_A 201 Glutathione S-transferase; GST complexed with glut 6e-09
1f2e_A201 Glutathione S-transferase; GST complexed with glut 2e-04
1f2e_A201 Glutathione S-transferase; GST complexed with glut 3e-04
3lsz_A 225 Glutathione S-transferase; xenobiotic, biodegradat 6e-09
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 4e-06
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 2e-04
3ubk_A 242 Glutathione transferase; GSH binding; 1.95A {Lepto 7e-09
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 2e-06
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 2e-04
2x64_A 207 Glutathione-S-transferase; detoxification enzyme; 8e-09
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 8e-04
1nhy_A 219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 8e-09
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 2e-08
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 1e-05
3m0f_A 213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 4e-07
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 7e-06
3tou_A 226 Glutathione S-transferase protein; GSH binding sit 5e-07
3tou_A226 Glutathione S-transferase protein; GSH binding sit 1e-05
3c8e_A288 YGHU, glutathione S-transferase homologue; glutath 1e-06
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 1e-06
2ycd_A 230 Glutathione S-transferase; SOIL bacteria, herbicid 2e-05
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 1e-06
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 7e-06
3lyp_A 215 Stringent starvation protein A; structural genomic 3e-06
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 5e-06
3cbu_A 214 Probable GST-related protein; thioredoxin fold, GS 2e-04
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 7e-06
4ecj_A244 Glutathione S-transferase; transferase-like protei 2e-05
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 3e-05
1yy7_A 213 SSPA, stringent starvation protein A; GST fold, tr 3e-05
1k0d_A260 URE2 protein; nitrate assimilation, structural gen 5e-05
1k0d_A 260 URE2 protein; nitrate assimilation, structural gen 8e-04
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 5e-05
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 7e-05
3r2q_A 202 Uncharacterized GST-like protein YIBF; transferase 8e-05
3lyk_A 216 Stringent starvation protein A homolog; structural 8e-05
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 9e-05
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 2e-04
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 3e-04
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 3e-04
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 4e-04
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 4e-04
2ahe_A 267 Chloride intracellular channel protein 4; glutathi 4e-04
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 4e-04
1k0m_A 241 CLIC1, NCC27, chloride intracellular channel prote 5e-04
2fhe_A216 GST, glutathione S-transferase; transferase-substr 8e-04
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218 Back     alignment and structure
 Score =  115 bits (290), Expect = 3e-32
 Identities = 37/66 (56%), Positives = 48/66 (72%)

Query: 149 MTIDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPTMDDN 208
           MT   YY+P S PCR+V L A  IGV L+LK  ++M+GE L P+F++LNPQH +PTMDD+
Sbjct: 1   MTTVLYYLPASPPCRSVLLLAKMIGVELDLKVLNIMEGEQLKPDFVELNPQHCIPTMDDH 60

Query: 209 GYTLSE 214
           G  L E
Sbjct: 61  GLVLWE 66


>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218 Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218 Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244 Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244 Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244 Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Length = 209 Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Length = 209 Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Length = 209 Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216 Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216 Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216 Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Length = 221 Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Length = 221 Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Length = 221 Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Length = 209 Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Length = 209 Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Length = 209 Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247 Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247 Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247 Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Length = 219 Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Length = 219 Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Length = 219 Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Length = 210 Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Length = 210 Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Length = 210 Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Length = 243 Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Length = 243 Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Length = 243 Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211 Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211 Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211 Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209 Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209 Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209 Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Length = 221 Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Length = 221 Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Length = 221 Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214 Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214 Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214 Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233 Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233 Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233 Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216 Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216 Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216 Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Length = 225 Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Length = 225 Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Length = 225 Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Length = 222 Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Length = 222 Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Length = 215 Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Length = 215 Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Length = 215 Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Length = 238 Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Length = 238 Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Length = 238 Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Length = 235 Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Length = 235 Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Length = 210 Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Length = 210 Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Length = 201 Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Length = 201 Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Length = 201 Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Length = 203 Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Length = 203 Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Length = 203 Back     alignment and structure
>4g9h_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 2.10A {Yersinia pestis} Length = 211 Back     alignment and structure
>4g9h_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 2.10A {Yersinia pestis} Length = 211 Back     alignment and structure
>4g9h_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 2.10A {Yersinia pestis} Length = 211 Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Length = 203 Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Length = 203 Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Length = 203 Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Length = 227 Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Length = 227 Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Length = 201 Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Length = 201 Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Length = 201 Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Length = 201 Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Length = 225 Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Length = 225 Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Length = 225 Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242 Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242 Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242 Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Length = 207 Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Length = 207 Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219 Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219 Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219 Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Length = 213 Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Length = 213 Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226 Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226 Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Length = 288 Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Length = 230 Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Length = 230 Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Length = 174 Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Length = 174 Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214 Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214 Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Length = 215 Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Length = 244 Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Length = 224 Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Length = 260 Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Length = 260 Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Length = 218 Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Length = 202 Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216 Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Length = 219 Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Length = 254 Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Length = 234 Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Length = 280 Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Length = 218 Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Length = 198 Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Length = 210 Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Length = 216 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query215
3vk9_A216 Glutathione S-transferase delta; glutathione bindi 99.9
4hi7_A228 GI20122; GST, glutathione S-transferase, enzyme fu 99.87
4gf0_A215 Glutathione S-transferase; GST, enzyme function in 99.87
4glt_A225 Glutathione S-transferase-like protein; structural 99.85
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 99.85
4gci_A211 Glutathione S-transferase; GST, enzyme function in 99.85
4hoj_A210 REGF protein; GST, glutathione S-transferase, enzy 99.84
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 99.84
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 99.84
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 99.84
1r5a_A218 Glutathione transferase; glutathione S-transferase 99.84
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 99.83
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 99.83
4hz4_A217 Glutathione-S-transferase; enzyme function initiat 99.82
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 99.82
1f2e_A201 Glutathione S-transferase; GST complexed with glut 99.82
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 99.82
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 99.81
4exj_A238 Uncharacterized protein; transferase-like protein, 99.81
4iel_A229 Glutathione S-transferase, N-terminal domain PROT; 99.81
1axd_A209 Glutathione S-transferase I; transferase, herbicid 99.81
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 99.81
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 99.8
3lyp_A215 Stringent starvation protein A; structural genomic 99.8
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 99.8
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 99.8
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 99.8
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 99.8
3uar_A227 Glutathione S-transferase; GSH binding site; HET: 99.8
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 99.8
3niv_A222 Glutathione S-transferase; structural genomics, PS 99.8
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 99.8
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 99.8
3n5o_A235 Glutathione transferase; seattle structural genomi 99.79
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 99.79
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 99.79
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 99.79
3tou_A226 Glutathione S-transferase protein; GSH binding sit 99.79
4g10_A265 Glutathione S-transferase homolog; thioredoxin fol 99.79
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 99.79
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 99.79
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 99.79
4hz2_A230 Glutathione S-transferase domain; glutathione,enzy 99.79
3lyk_A216 Stringent starvation protein A homolog; structural 99.78
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 99.78
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 99.78
4ikh_A244 Glutathione S-transferase; enzyme function initiat 99.78
3lxz_A229 Glutathione S-transferase family protein; structur 99.77
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 99.77
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 99.77
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 99.77
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 99.77
1k0d_A260 URE2 protein; nitrate assimilation, structural gen 99.77
4dej_A231 Glutathione S-transferase related protein; transfe 99.77
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 99.76
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 99.76
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 99.76
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 99.75
4ecj_A244 Glutathione S-transferase; transferase-like protei 99.75
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 99.75
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 99.75
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 99.75
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 99.74
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 99.74
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 99.74
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 99.74
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 99.74
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 99.74
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 99.73
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 99.73
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 99.73
3h1n_A252 Probable glutathione S-transferase; APC84167, bord 99.73
3c8e_A288 YGHU, glutathione S-transferase homologue; glutath 99.73
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 99.73
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 99.73
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 99.73
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 99.72
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 99.72
2fhe_A216 GST, glutathione S-transferase; transferase-substr 99.72
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 99.71
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 99.71
4id0_A214 Glutathione S-transferase-like protein YIBF; GST, 99.71
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 99.71
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 99.71
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 99.71
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 99.71
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 99.71
1b8x_A 280 Protein (AML-1B); nuclear matrix targeting signal 99.71
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 99.7
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 99.7
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 99.7
2fno_A248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 99.7
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 99.69
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 99.68
2hsn_A160 Methionyl-tRNA synthetase, cytoplasmic; protein co 99.67
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 99.67
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 99.62
3ic8_A 310 Uncharacterized GST-like proteinprotein; glutathio 99.62
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 99.61
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 99.59
2r4v_A247 XAP121, chloride intracellular channel protein 2; 99.56
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 99.56
4f03_A253 Glutathione transferase; GST fold; 1.80A {Phaneroc 99.55
3m1g_A362 Putative glutathione S-transferase; ECM4-like subf 99.55
2ahe_A267 Chloride intracellular channel protein 4; glutathi 99.55
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.52
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 99.48
1z9h_A290 Membrane-associated prostaglandin E synthase-2; me 99.47
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 99.45
3ppu_A352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 99.39
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 99.36
2hra_A209 Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l 99.36
4fqu_A313 Putative glutathione transferase; glutathionyl-hyd 99.19
4g0i_A328 Protein YQJG; glutathionyl-hydroquinone reductase, 99.14
3vk9_A 216 Glutathione S-transferase delta; glutathione bindi 98.13
2hqt_A124 GU4 nucleic-binding protein 1; GST-fold, biosynthe 98.0
4hi7_A 228 GI20122; GST, glutathione S-transferase, enzyme fu 97.94
4gf0_A 215 Glutathione S-transferase; GST, enzyme function in 97.61
1axd_A 209 Glutathione S-transferase I; transferase, herbicid 97.5
1aw9_A 216 Glutathione S-transferase III; herbicide detoxific 97.47
1r5a_A 218 Glutathione transferase; glutathione S-transferase 97.46
1e6b_A 221 Glutathione S-transferase; 1.65A {Arabidopsis thal 97.43
4hoj_A 210 REGF protein; GST, glutathione S-transferase, enzy 97.43
3ay8_A 216 Glutathione S-transferase; GST fold, GST binding, 97.43
1gnw_A 211 Glutathione S-transferase; herbicide detoxificatio 97.43
1pn9_A 209 GST class-delta, glutathione S-transferase 1-6; pr 97.42
4glt_A 225 Glutathione S-transferase-like protein; structural 97.37
1ljr_A 244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 97.37
3f6d_A 219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 97.36
2v6k_A 214 Maleylpyruvate isomerase; glutathione-S-transferas 97.35
3ein_A 209 GST class-theta, glutathione S-transferase 1-1; de 97.34
4hz2_A 230 Glutathione S-transferase domain; glutathione,enzy 97.31
3m3m_A 210 Glutathione S-transferase; PSI-II, structural geno 97.31
4iel_A 229 Glutathione S-transferase, N-terminal domain PROT; 97.31
3niv_A 222 Glutathione S-transferase; structural genomics, PS 97.29
2imi_A 221 Epsilon-class glutathione S-transferase; HET: GSH; 97.28
2c3n_A 247 Glutathione S-transferase theta 1; glutathione tra 97.28
3qav_A 243 RHO-class glutathione S-transferase; cytosol; 2.10 97.27
3bby_A 215 Uncharacterized GST-like protein YFCF; NP_416804.1 97.23
2cz2_A 223 Maleylacetoacetate isomerase; structural genomics, 97.17
3lsz_A 225 Glutathione S-transferase; xenobiotic, biodegradat 97.17
3m8n_A 225 Possible glutathione S-transferase; PSI-II, struct 97.16
3ibh_A 233 GST-II, saccharomyces cerevisiae GTT2; glutathione 97.15
1v2a_A 210 Glutathione transferase GST1-6; glutathione S-tran 97.08
4id0_A 214 Glutathione S-transferase-like protein YIBF; GST, 97.05
1k0d_A 260 URE2 protein; nitrate assimilation, structural gen 97.02
3n5o_A 235 Glutathione transferase; seattle structural genomi 96.98
4hz4_A 217 Glutathione-S-transferase; enzyme function initiat 96.92
4gci_A 211 Glutathione S-transferase; GST, enzyme function in 96.9
2pvq_A 201 Glutathione S-transferase; xenobiotics detoxificat 96.89
1yy7_A 213 SSPA, stringent starvation protein A; GST fold, tr 96.87
3gx0_A 215 GST-like protein YFCG; transferase, glutathione, g 96.85
4exj_A 238 Uncharacterized protein; transferase-like protein, 96.77
3r2q_A 202 Uncharacterized GST-like protein YIBF; transferase 96.75
1n2a_A 201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 96.74
3m0f_A 213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 96.72
1yq1_A 208 Glutathione S-transferase; nematoda, structural ge 96.71
2dsa_A 203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 96.71
1pmt_A 203 PMGST, GST B1-1, glutathione transferase; glutathi 96.69
3lyk_A 216 Stringent starvation protein A homolog; structural 96.67
4ikh_A 244 Glutathione S-transferase; enzyme function initiat 96.62
1f2e_A 201 Glutathione S-transferase; GST complexed with glut 96.61
2vo4_A 219 2,4-D inducible glutathione S-transferase; herbici 96.61
3lyp_A 215 Stringent starvation protein A; structural genomic 96.58
2x64_A 207 Glutathione-S-transferase; detoxification enzyme; 96.55
3uar_A 227 Glutathione S-transferase; GSH binding site; HET: 96.55
4dej_A 231 Glutathione S-transferase related protein; transfe 96.47
1oyj_A 231 Glutathione S-transferase; herbicide detoxificatio 96.4
1gwc_A 230 Glutathione S-transferase TSI-1; herbicide detoxif 96.38
4ecj_A 244 Glutathione S-transferase; transferase-like protei 96.38
2cvd_A 198 Glutathione-requiring prostaglandin D synthase; gl 96.36
2r4v_A 247 XAP121, chloride intracellular channel protein 2; 96.3
2ycd_A 230 Glutathione S-transferase; SOIL bacteria, herbicid 96.29
3gtu_B 224 Glutathione S-transferase; conjugation, detoxifica 96.28
3tou_A 226 Glutathione S-transferase protein; GSH binding sit 96.28
2ws2_A 204 NU-class GST, glutathione S-transferase; parasite, 96.26
1tu7_A 208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 96.23
3lxz_A 229 Glutathione S-transferase family protein; structur 96.23
2c4j_A 218 Glutathione S-transferase MU 2; glutathione transf 96.21
2gsq_A 202 Squid GST, glutathione S-transferase; squid digest 96.19
3ic8_A 310 Uncharacterized GST-like proteinprotein; glutathio 96.18
2on5_A 206 Nagst-2, Na glutathione S-transferase 2; hookworm; 96.15
4f03_A 253 Glutathione transferase; GST fold; 1.80A {Phaneroc 96.13
3c8e_A 288 YGHU, glutathione S-transferase homologue; glutath 96.13
1gsu_A 219 GST, CGSTM1-1, class-MU glutathione S-transferase; 96.08
4g10_A 265 Glutathione S-transferase homolog; thioredoxin fol 96.02
3ubk_A 242 Glutathione transferase; GSH binding; 1.95A {Lepto 96.01
1k0m_A 241 CLIC1, NCC27, chloride intracellular channel prote 96.0
2ahe_A 267 Chloride intracellular channel protein 4; glutathi 96.0
1okt_A 211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 96.0
1zl9_A 207 GST class-sigma, glutathione S-transferase 5; glut 95.99
3q18_A 239 GSTO-2, glutathione S-transferase omega-2; glutath 95.98
3iso_A 218 Putative glutathione transferase; GST; HET: GSH; 1 95.93
3fy7_A 250 Chloride intracellular channel protein 3; GST, glu 95.93
2a2r_A 210 Glutathione S-transferase P; detoxification, nitri 95.83
2on7_A 206 Nagst-1, Na glutathione S-transferase 1; hookworm; 95.8
1m0u_A 249 GST2 gene product; flight muscle protein, sigma, t 95.73
1b8x_A 280 Protein (AML-1B); nuclear matrix targeting signal 95.68
3vln_A 241 GSTO-1, glutathione S-transferase omega-1; GST fol 95.67
1tw9_A 206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 95.66
3cbu_A 214 Probable GST-related protein; thioredoxin fold, GS 95.59
1nhy_A 219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 95.53
3rbt_A 246 Glutathione transferase O1; glutathione S-transfer 95.51
2wb9_A 211 Glutathione transferase sigma class; thioredoxin f 95.51
2hnl_A 225 Glutathione S-transferase 1; prostaglandin synthas 95.47
3h1n_A 252 Probable glutathione S-transferase; APC84167, bord 95.42
3ir4_A 218 Glutaredoxin 2; glutathione, IDP00895, structural 95.34
2fno_A 248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 95.19
2fhe_A 216 GST, glutathione S-transferase; transferase-substr 95.17
1k3y_A 221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 95.11
1vf1_A 229 Glutathione S-transferase 3; detoxification; HET: 95.1
1dug_A 234 Chimera of glutathione S-transferase-synthetic lin 95.08
1bg5_A 254 MAB, fusion protein of alpha-Na,K-ATPase with glut 94.96
2yv7_A 260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 94.83
1b48_A 221 GST, mgsta4-4, protein (glutathione S-transferase) 94.47
3ik7_A 222 Glutathione S-transferase A4; human GST A4-4, enzy 94.4
1oe8_A 211 Glutathione S-transferase; schistosomiasis, detoxi 94.23
2hsn_A160 Methionyl-tRNA synthetase, cytoplasmic; protein co 93.1
3ppu_A 352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 92.66
4fqu_A313 Putative glutathione transferase; glutathionyl-hyd 91.84
2yv9_A 291 Chloride intracellular channel EXC-4; chloride ION 91.46
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 91.23
1z9h_A 290 Membrane-associated prostaglandin E synthase-2; me 91.1
2hra_A209 Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l 90.98
4g0i_A328 Protein YQJG; glutathionyl-hydroquinone reductase, 88.8
3m1g_A362 Putative glutathione S-transferase; ECM4-like subf 88.66
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 85.25
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 81.36
>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} Back     alignment and structure
Probab=99.90  E-value=2.7e-26  Score=183.83  Aligned_cols=160  Identities=30%  Similarity=0.446  Sum_probs=118.3

Q ss_pred             HHHHhhCCCCcccccceeecccccccccceeeccCCcCC-------CCcceecC--CCCeeeeeHHHHHHHHHHHhCCCC
Q psy10373         46 FLNTFLASSPWVAGDNITIADCSIVASLSTIECSTSDHM-------ASQTRHPG--NLLVLMFSSRAIIAYLAEQYGKDD  116 (215)
Q Consensus        46 ~l~~~~~g~~y~~~~~l~l~~~~~~~~~~~~~~~~~e~~-------~P~GkVPv--ddg~~L~ES~AI~~YL~~~~~~~~  116 (215)
                      +++.-.|.++.++.+.|...|++++.  ..+|+.++|++       ||+|+|||  |||.+|+||.||++||+++|+.++
T Consensus         5 LY~~~~S~~~~~v~~~l~~~gi~~e~--~~v~~~~~~~~~~~~~~~nP~g~vP~L~d~g~~l~eS~aI~~YL~~~~~~~~   82 (216)
T 3vk9_A            5 LYYVPGSAPCRAVLLTAKALNLNLNL--KLVDLHHGEQLKPEYLKLNPQHTVPTLVDDGLSIWESRAIITYLVNKYAKGS   82 (216)
T ss_dssp             EEECTTCHHHHHHHHHHHHHTCCCEE--EECCGGGTGGGSHHHHHHCTTCCSCEEEETTEEECCHHHHHHHHHHHHCTTC
T ss_pred             EEeCCCChhHHHHHHHHHHcCCCCEE--EEeCCCCCccCCHHHHHhCCCCccceEecCCceeechHHHHHHHHHhcCccc
Confidence            33333344556677777777877655  44588888776       49999999  999999999999999999999766


Q ss_pred             CCCCCCHHHHHHHHHHHhhhccccchhcccceeeccccCCCCCCchHHHHHHHHHcC-CCcEEEeccCCCCCCCCHhHHh
Q psy10373        117 SLYPKDPKARGIVNQRLYFDIGTLYQRFADYFMTIDFYYVPGSAPCRAVQLAAAQIG-VPLNLKHTDLMKGEHLTPEFLK  195 (215)
Q Consensus       117 ~L~p~d~~era~v~~wl~~~~~~l~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~l~-le~~L~~~~fl~Gd~~T~ADi~  195 (215)
                      .|+|.|+.+|+++++|+.|..+.+.+.+...+.+....+.+  ........+.+.++ +|.+|++++|++|+++|+||++
T Consensus        83 ~l~p~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~l~~le~~L~~~~~l~G~~~t~ADi~  160 (216)
T 3vk9_A           83 SLYPEDPKARALVDQRLYFDIGTLYQRFSDYFYPQVFAGAP--ADKAKNEKVQEALQLLDKFLEGQKYVAGPNLTVADLS  160 (216)
T ss_dssp             TTSCCSHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHSCCC--CCHHHHHHHHHHHHHHHHHTTTCSBTTBSSCCHHHHH
T ss_pred             CCCCCCHHHHHHhhhhHHHHhhhhhhHHHHHHHHHHHhcch--hHHHHHHHHHHHHHHHHHHhccCCCCCCCCCCHHHHH
Confidence            79999999999999999999998888776655543322222  22333445555666 6888889999999999999999


Q ss_pred             hCCCCccceEEeCCee
Q psy10373        196 LNPQHTVPTMDDNGYT  211 (215)
Q Consensus       196 l~P~g~lp~l~~~G~~  211 (215)
                      +.|  .+-.+...|++
T Consensus       161 ~~~--~l~~~~~~~~~  174 (216)
T 3vk9_A          161 LIA--SVSSLEASDID  174 (216)
T ss_dssp             HHH--HHHHGGGTTCC
T ss_pred             HHH--HHHHHHHcCCC
Confidence            843  33333334443



>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} Back     alignment and structure
>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} Back     alignment and structure
>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Back     alignment and structure
>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* Back     alignment and structure
>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Back     alignment and structure
>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Back     alignment and structure
>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Back     alignment and structure
>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Back     alignment and structure
>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Back     alignment and structure
>2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* Back     alignment and structure
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Back     alignment and structure
>4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} Back     alignment and structure
>4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* Back     alignment and structure
>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} Back     alignment and structure
>2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B Back     alignment and structure
>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} Back     alignment and structure
>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Back     alignment and structure
>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Back     alignment and structure
>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} Back     alignment and structure
>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Back     alignment and structure
>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Back     alignment and structure
>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Back     alignment and structure
>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Back     alignment and structure
>2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Back     alignment and structure
>4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Back     alignment and structure
>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Back     alignment and structure
>4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* Back     alignment and structure
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 215
d1jlva284 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anoph 7e-17
d1jlva284 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anoph 1e-04
d1r5aa285 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anoph 2e-15
d1r5aa285 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anoph 4e-05
d1ljra279 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sap 5e-14
d1axda280 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), 2e-11
d1aw9a281 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), 8e-11
d1v2aa283 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anoph 1e-10
d1v2aa283 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anoph 4e-05
d1gnwa284 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress ( 1e-09
d1v2aa1125 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Ano 2e-09
d1v2aa1125 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Ano 3e-07
d1e6ba280 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress 6e-09
d1fw1a283 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapi 1e-08
d1r5aa1129 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Ano 1e-08
d1ljra1165 a.45.1.1 (A:80-244) Class theta GST {Human (Homo s 6e-08
d1f2ea280 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas pau 1e-07
d1jlva1123 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Ano 2e-07
d1pmta280 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabili 3e-07
d1z9ha1161 a.45.1.1 (A:213-373) Microsomal prostaglandin E sy 4e-07
d1jlwa1127 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Ano 8e-07
d2fnoa287 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752 1e-06
d1k0da1151 a.45.1.1 (A:201-351) Yeast prion protein ure2p, ni 8e-06
d1k0da1151 a.45.1.1 (A:201-351) Yeast prion protein ure2p, ni 7e-05
d2c4ja284 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapien 8e-06
d2a2ra277 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapien 2e-05
d1k0da292 c.47.1.5 (A:109-200) Yeast prion protein ure2p, ni 2e-05
d1gula277 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sap 3e-05
d1axda1129 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays 7e-05
d1nhya275 c.47.1.5 (A:1-75) GST-like domain of elongation fa 7e-05
d1tu7a277 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulu 9e-05
d1gnwa1126 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress 9e-05
d2cvda274 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sap 1e-04
d1k3ya279 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sap 3e-04
d1b48a278 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musc 4e-04
d1gsua1133 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus 6e-04
d1okta285 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasm 6e-04
d1g7oa275 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli 7e-04
d2cvda1124 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo s 7e-04
d2c4ja1133 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapi 8e-04
d1pmta1121 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabi 9e-04
d1m0ua276 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Dr 0.001
d1b48a1143 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus mu 0.003
d1gula1140 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo s 0.004
d1fhea280 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepati 0.004
d1oe8a1123 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke ( 0.004
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 84 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione S-transferase (GST), N-terminal domain
domain: Class delta GST
species: Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]
 Score = 70.4 bits (172), Expect = 7e-17
 Identities = 44/64 (68%), Positives = 54/64 (84%)

Query: 151 IDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPTMDDNGY 210
           +DFYY+PGSAPCRAVQ+ AA +GV LNLK T+LM GEH+ PEFLK+NPQH +PT+ DNG+
Sbjct: 1   MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTNLMAGEHMKPEFLKINPQHCIPTLVDNGF 60

Query: 211 TLSE 214
            L E
Sbjct: 61  ALWE 64


>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 84 Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 85 Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 85 Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 80 Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 81 Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 83 Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 83 Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 125 Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 125 Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 129 Back     information, alignment and structure
>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 80 Back     information, alignment and structure
>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 123 Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 80 Back     information, alignment and structure
>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Length = 161 Back     information, alignment and structure
>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Length = 127 Back     information, alignment and structure
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Length = 87 Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 151 Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 151 Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 92 Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 129 Back     information, alignment and structure
>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 77 Back     information, alignment and structure
>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 126 Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Length = 133 Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 85 Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 121 Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 Back     information, alignment and structure
>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 143 Back     information, alignment and structure
>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Length = 80 Back     information, alignment and structure
>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Length = 123 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query215
d1jlva284 Class delta GST {Mosquito (Anopheles dirus b), iso 99.51
d1r5aa285 Class delta GST {Mosquito (Anopheles dirus b), iso 99.48
d1v2aa283 Class delta GST {Mosquito (Anopheles dirus b), iso 99.43
d1axda280 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.39
d1gnwa284 Class phi GST {Mouse-ear cress (Arabidopsis thalia 99.36
d1aw9a281 Class phi GST {Maize (Zea mays), type III [TaxId: 99.35
d1e6ba280 Class zeta GST {Mouse-ear cress (Arabidopsis thali 99.33
d1jlwa1127 Class delta GST {Mosquito (Anopheles dirus b), iso 99.25
d1fw1a283 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 99.24
d1pmta280 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.24
d1k0da292 Yeast prion protein ure2p, nitrogen regulation fra 99.24
d1tu7a277 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 99.22
d1ljra279 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.22
d1f2ea280 Class beta GST {Sphingomonas paucimobilis [TaxId: 99.18
d1jlva1123 Class delta GST {Mosquito (Anopheles dirus b), iso 99.17
d1n2aa280 Class beta GST {Escherichia coli [TaxId: 562]} 99.16
d2gsqa275 Class sigma GST {Squid (Ommastrephes sloani pacifi 99.15
d2a2ra277 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 99.15
d1gula277 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.15
d1r5aa1129 Class delta GST {Mosquito (Anopheles dirus b), iso 99.14
d1v2aa1125 Class delta GST {Mosquito (Anopheles dirus b), iso 99.13
d1b48a278 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 99.12
d1k3ya279 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.12
d1k0da1151 Yeast prion protein ure2p, nitrogen regulation fra 99.11
d1tw9a277 Class sigma GST {Heligmosomoides polygyrus [TaxId: 99.08
d2c4ja284 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.05
d2cvda274 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 99.04
d1okta285 Pf GST {Malarial parasite (Plasmodium falciparum) 99.03
d1m0ua276 Class sigma GST {Fruit fly (Drosophila melanogaste 99.03
d1duga280 Class alpha GST {Schistosoma japonicum [TaxId: 618 99.02
d1pmta1121 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.01
d2fnoa287 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 99.01
d1axda1129 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.0
d1fhea280 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 99.0
d1f2ea1121 Class beta GST {Sphingomonas paucimobilis [TaxId: 98.98
d1ljra1165 Class theta GST {Human (Homo sapiens) [TaxId: 9606 98.98
d1oyja284 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 98.96
d1nhya1144 GST-like domain of elongation factor 1-gamma {Bake 98.95
d1n2aa1121 Class beta GST {Escherichia coli [TaxId: 562]} 98.95
d1eema298 Class omega GST {Human (Homo sapiens) [TaxId: 9606 98.93
d1aw9a1135 Class phi GST {Maize (Zea mays), type III [TaxId: 98.93
d1k0ma286 Chloride intracellular channel 1 (clic1) {Human (H 98.88
d1oe8a281 Class alpha GST {Blood fluke (Schistosoma haematob 98.87
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 98.81
d1e6ba1133 Class zeta GST {Mouse-ear cress (Arabidopsis thali 98.76
d1fw1a1125 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 98.75
d1gwca283 Class tau GST {Aegilops tauschii, also known as Tr 98.74
d1gnwa1126 Class phi GST {Mouse-ear cress (Arabidopsis thalia 98.72
d1axda280 Class phi GST {Maize (Zea mays), type I [TaxId: 45 98.65
d1gwca1138 Class tau GST {Aegilops tauschii, also known as Tr 98.65
d1nhya275 GST-like domain of elongation factor 1-gamma {Bake 98.55
d1jlva284 Class delta GST {Mosquito (Anopheles dirus b), iso 98.53
d1z9ha2113 Microsomal prostaglandin E synthase-2 {Crab-eating 98.52
d1r5aa285 Class delta GST {Mosquito (Anopheles dirus b), iso 98.5
d1aw9a281 Class phi GST {Maize (Zea mays), type III [TaxId: 98.49
d1ljra279 Class theta GST {Human (Homo sapiens) [TaxId: 9606 98.4
d1gnwa284 Class phi GST {Mouse-ear cress (Arabidopsis thalia 98.36
d1e6ba280 Class zeta GST {Mouse-ear cress (Arabidopsis thali 98.25
d1eema1139 Class omega GST {Human (Homo sapiens) [TaxId: 9606 98.22
d1k0da292 Yeast prion protein ure2p, nitrogen regulation fra 98.11
d1v2aa283 Class delta GST {Mosquito (Anopheles dirus b), iso 98.08
d3gtub1140 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 98.04
d1fw1a283 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 98.0
d1r5aa1129 Class delta GST {Mosquito (Anopheles dirus b), iso 97.99
d2gsqa1127 Class sigma GST {Squid (Ommastrephes sloani pacifi 97.99
d2a2ra1132 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 97.97
d1oyja1145 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 97.94
d2cvda1124 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 97.92
d1k3ya1142 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 97.85
d1gula1140 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 97.83
d1f2ea280 Class beta GST {Sphingomonas paucimobilis [TaxId: 97.81
d1b48a1143 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 97.79
d1n2aa280 Class beta GST {Escherichia coli [TaxId: 562]} 97.77
d1m0ua1127 Class sigma GST {Fruit fly (Drosophila melanogaste 97.74
d1pmta280 Class beta GST {Proteus mirabilis [TaxId: 584]} 97.74
d1tw9a1129 Class sigma GST {Heligmosomoides polygyrus [TaxId: 97.68
d1jlva1123 Class delta GST {Mosquito (Anopheles dirus b), iso 97.66
d2hrkb1118 GU4 nucleic-binding protein 1, Arc1p {Baker's yeas 97.66
d2gsta1133 Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 97.65
d1gsua1133 Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 97.62
d2c4ja1133 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 97.53
d1jlwa1127 Class delta GST {Mosquito (Anopheles dirus b), iso 97.36
d1v2aa1125 Class delta GST {Mosquito (Anopheles dirus b), iso 97.23
d1oyja284 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 97.21
d2fhea1136 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 97.1
d1nhya275 GST-like domain of elongation factor 1-gamma {Bake 97.03
d1duga1140 Class alpha GST {Schistosoma japonicum [TaxId: 618 96.98
d1eema298 Class omega GST {Human (Homo sapiens) [TaxId: 9606 96.96
d1k0ma286 Chloride intracellular channel 1 (clic1) {Human (H 96.65
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 96.64
d1okta1126 Pf GST {Malarial parasite (Plasmodium falciparum) 96.62
d2c4ja284 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 96.57
d1tu7a1131 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 96.27
d1tu7a277 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 96.22
d2cvda274 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 96.13
d2a2ra277 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 96.0
d1gwca283 Class tau GST {Aegilops tauschii, also known as Tr 95.73
d1gula277 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 95.65
d2gsqa275 Class sigma GST {Squid (Ommastrephes sloani pacifi 95.53
d1k3ya279 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 95.48
d1gnwa1126 Class phi GST {Mouse-ear cress (Arabidopsis thalia 95.39
d1oe8a1123 Class alpha GST {Blood fluke (Schistosoma haematob 95.36
d1z9ha1161 Microsomal prostaglandin E synthase-2 {Crab-eating 95.34
d1b48a278 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 95.29
d1fhea280 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 95.14
d1ljra1165 Class theta GST {Human (Homo sapiens) [TaxId: 9606 94.98
d1nhya1144 GST-like domain of elongation factor 1-gamma {Bake 94.89
d1m0ua276 Class sigma GST {Fruit fly (Drosophila melanogaste 94.74
d1z9ha2113 Microsomal prostaglandin E synthase-2 {Crab-eating 94.38
d1duga280 Class alpha GST {Schistosoma japonicum [TaxId: 618 94.32
d2fnoa287 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 94.21
d1k0ma1149 Chloride intracellular channel 1 (clic1) {Human (H 94.06
d1aw9a1135 Class phi GST {Maize (Zea mays), type III [TaxId: 93.55
d1n2aa1121 Class beta GST {Escherichia coli [TaxId: 562]} 93.51
d1f2ea1121 Class beta GST {Sphingomonas paucimobilis [TaxId: 93.4
d1axda1129 Class phi GST {Maize (Zea mays), type I [TaxId: 45 93.29
d1okta285 Pf GST {Malarial parasite (Plasmodium falciparum) 93.25
d2c4ja1133 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 92.9
d1tw9a277 Class sigma GST {Heligmosomoides polygyrus [TaxId: 92.88
d1k0da1151 Yeast prion protein ure2p, nitrogen regulation fra 91.9
d1pmta1121 Class beta GST {Proteus mirabilis [TaxId: 584]} 91.89
d3gtub1140 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 91.73
d2cvda1124 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 91.62
d1gsua1133 Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 91.53
d2fhea1136 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 90.8
d2gsta1133 Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 90.58
d1duga1140 Class alpha GST {Schistosoma japonicum [TaxId: 618 89.61
d1tw9a1129 Class sigma GST {Heligmosomoides polygyrus [TaxId: 86.65
d1e6ba1133 Class zeta GST {Mouse-ear cress (Arabidopsis thali 85.29
d1eema1139 Class omega GST {Human (Homo sapiens) [TaxId: 9606 84.99
d1gwca1138 Class tau GST {Aegilops tauschii, also known as Tr 83.18
d1k3ya1142 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 83.09
d1oe8a1123 Class alpha GST {Blood fluke (Schistosoma haematob 82.7
d1gula1140 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 82.55
d1b48a1143 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 82.5
d2hrkb1118 GU4 nucleic-binding protein 1, Arc1p {Baker's yeas 80.12
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione S-transferase (GST), N-terminal domain
domain: Class delta GST
species: Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]
Probab=99.51  E-value=1.6e-16  Score=107.29  Aligned_cols=73  Identities=29%  Similarity=0.381  Sum_probs=57.6

Q ss_pred             HHHHhhCCCCcccccceeecccccccccceeeccCCcCCC-------CcceecC--CCCeeeeeHHHHHHHHHHHhCCCC
Q psy10373         46 FLNTFLASSPWVAGDNITIADCSIVASLSTIECSTSDHMA-------SQTRHPG--NLLVLMFSSRAIIAYLAEQYGKDD  116 (215)
Q Consensus        46 ~l~~~~~g~~y~~~~~l~l~~~~~~~~~~~~~~~~~e~~~-------P~GkVPv--ddg~~L~ES~AI~~YL~~~~~~~~  116 (215)
                      +++.-.|.++.++.+.+...+++++.  ..+|+.++|+++       |+|+||+  |||.+|+||.||++||+++|+++.
T Consensus         3 LY~~~~S~~~~~v~~~l~e~gi~~e~--~~v~~~~~~~~~~~~~~~nP~g~vP~L~d~~~~l~ES~aI~~yL~~~~~~~~   80 (84)
T d1jlva2           3 FYYLPGSAPCRAVQMTAAAVGVELNL--KLTNLMAGEHMKPEFLKINPQHCIPTLVDNGFALWESRAICTYLAEKYGKDD   80 (84)
T ss_dssp             EEECTTCHHHHHHHHHHHHTTCCCEE--EECCGGGTGGGSHHHHHHCTTCCSCEEEETTEEEESHHHHHHHHHHHHCCCG
T ss_pred             EEcCCCCHHHHHHHHHHHHcCCCCEE--EEecCCCCccCCHHHHHHhccccCCEEEECCEEEEcHHHHHHHHHHHcCCCC
Confidence            33344455667778888888887765  345888888764       9999999  999999999999999999998665


Q ss_pred             CCCC
Q psy10373        117 SLYP  120 (215)
Q Consensus       117 ~L~p  120 (215)
                      .|+|
T Consensus        81 ~L~P   84 (84)
T d1jlva2          81 KLYP   84 (84)
T ss_dssp             GGSC
T ss_pred             CCCC
Confidence            6776



>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure