Diaphorina citri psyllid: psy10374


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60-----
MDAAHKGSNSIRLVKRCTKPDRREFQKIAIATAIGFSIMGFIGFFVKLIHIPINNIIVLRNSFTF
ccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEcEEEEEcccccc
*DAAHKGSNSIRLVKRCTKPDRREFQKIAIATAIGFSIMGFIGFFVKLIHIPINNIIVLRN****
xxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDAAHKGSNSIRLVKRCTKPDRREFQKIAIATAIGFSIMGFIGFFVKLIHIPINNIIVLRNSFTF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein transport protein Sec61 subunit gamma Necessary for protein translocation in the endoplasmic reticulum.very confidentP60058
Protein transport protein Sec61 subunit gamma Necessary for protein translocation in the endoplasmic reticulum.very confidentQ3T104
Protein transport protein Sec61 subunit gamma Necessary for protein translocation in the endoplasmic reticulum.very confidentP60059

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0010507 [BP]negative regulation of autophagyprobableGO:0009894, GO:0009895, GO:0009892, GO:0019222, GO:0031329, GO:0031330, GO:0031324, GO:0031323, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0010506, GO:0050789, GO:0048523
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0005784 [CC]Sec61 translocon complexprobableGO:0005783, GO:0044464, GO:0005789, GO:0042175, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0044432, GO:0005791, GO:0071256, GO:0012505, GO:0043234, GO:0032991, GO:0043231, GO:0030867, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0018996 [BP]molting cycle, collagen and cuticulin-based cuticleprobableGO:0008150, GO:0032501, GO:0042303, GO:0044699, GO:0044707
GO:0006616 [BP]SRP-dependent cotranslational protein targeting to membrane, translocationprobableGO:0008104, GO:0006613, GO:0006612, GO:0006614, GO:0051641, GO:0044699, GO:0070972, GO:0071806, GO:0070727, GO:0006886, GO:0051179, GO:0065002, GO:0071702, GO:0033036, GO:0006810, GO:0072599, GO:0072594, GO:0034613, GO:0006605, GO:0045184, GO:0033365, GO:0044765, GO:0044763, GO:0051649, GO:0051234, GO:0055085, GO:0016482, GO:0046907, GO:0045047, GO:0015031, GO:0008150, GO:0009987
GO:0030176 [CC]integral to endoplasmic reticulum membraneprobableGO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0031301, GO:0031300, GO:0043227, GO:0031227, GO:0031224, GO:0005737, GO:0044446, GO:0031090, GO:0016021, GO:0016020, GO:0043226, GO:0044432, GO:0012505, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0015450 [MF]P-P-bond-hydrolysis-driven protein transmembrane transporter activityprobableGO:0008565, GO:0022891, GO:0022892, GO:0022884, GO:0005215, GO:0008320, GO:0015399, GO:0022857, GO:0003674, GO:0015405, GO:0022804
GO:0001555 [BP]oocyte growthprobableGO:0048610, GO:0048589, GO:0048588, GO:0030154, GO:0048468, GO:0019953, GO:0007292, GO:0007276, GO:0016049, GO:0000003, GO:0048869, GO:0009994, GO:0044699, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0007281, GO:0022414, GO:0044763, GO:0022412, GO:0040007, GO:0044767, GO:0044702, GO:0003006, GO:0048856, GO:0008150
GO:0030728 [BP]ovulationprobableGO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0007292, GO:0022414, GO:0032501, GO:0008150, GO:0007276, GO:0044699, GO:0000003
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0002479 [BP]antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependentprobableGO:0002474, GO:0019882, GO:0019884, GO:0002478, GO:0002376, GO:0042590, GO:0008150, GO:0048002
GO:0006412 [BP]translationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WWB, chain B
Confidence level:very confident
Coverage over the Query: 2-60
View the alignment between query and template
View the model in PyMOL