BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy10394
(82 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1XI4|A Chain A, Clathrin D6 Coat
pdb|1XI4|B Chain B, Clathrin D6 Coat
pdb|1XI4|C Chain C, Clathrin D6 Coat
pdb|1XI4|D Chain D, Clathrin D6 Coat
pdb|1XI4|E Chain E, Clathrin D6 Coat
pdb|1XI4|F Chain F, Clathrin D6 Coat
pdb|1XI4|G Chain G, Clathrin D6 Coat
pdb|1XI4|H Chain H, Clathrin D6 Coat
pdb|1XI4|I Chain I, Clathrin D6 Coat
pdb|1XI5|A Chain A, Clathrin D6 Coat With Auxilin J-Domain
pdb|1XI5|B Chain B, Clathrin D6 Coat With Auxilin J-Domain
pdb|1XI5|C Chain C, Clathrin D6 Coat With Auxilin J-Domain
pdb|1XI5|D Chain D, Clathrin D6 Coat With Auxilin J-Domain
pdb|1XI5|E Chain E, Clathrin D6 Coat With Auxilin J-Domain
pdb|1XI5|F Chain F, Clathrin D6 Coat With Auxilin J-Domain
pdb|1XI5|G Chain G, Clathrin D6 Coat With Auxilin J-Domain
pdb|1XI5|H Chain H, Clathrin D6 Coat With Auxilin J-Domain
pdb|1XI5|I Chain I, Clathrin D6 Coat With Auxilin J-Domain
pdb|3IYV|A Chain A, Clathrin D6 Coat As Full-Length Triskelions
pdb|3IYV|B Chain B, Clathrin D6 Coat As Full-Length Triskelions
pdb|3IYV|C Chain C, Clathrin D6 Coat As Full-Length Triskelions
pdb|3IYV|D Chain D, Clathrin D6 Coat As Full-Length Triskelions
pdb|3IYV|E Chain E, Clathrin D6 Coat As Full-Length Triskelions
pdb|3IYV|F Chain F, Clathrin D6 Coat As Full-Length Triskelions
pdb|3IYV|G Chain G, Clathrin D6 Coat As Full-Length Triskelions
pdb|3IYV|H Chain H, Clathrin D6 Coat As Full-Length Triskelions
pdb|3IYV|I Chain I, Clathrin D6 Coat As Full-Length Triskelions
Length = 1630
Score = 89.4 bits (220), Expect = 5e-19, Method: Composition-based stats.
Identities = 39/49 (79%), Positives = 48/49 (97%)
Query: 34 QIATKYHEQLTTKALIDLFESFKSYEGLFYFLGSIVNYSQDQEVHFKYI 82
Q+A+KYHEQL+T++LI+LFESFKS+EGLFYFLGSIVN+SQD +VHFKYI
Sbjct: 684 QVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVNFSQDPDVHFKYI 732
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.137 0.392
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,370,053
Number of Sequences: 62578
Number of extensions: 75774
Number of successful extensions: 161
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 160
Number of HSP's gapped (non-prelim): 1
length of query: 82
length of database: 14,973,337
effective HSP length: 51
effective length of query: 31
effective length of database: 11,781,859
effective search space: 365237629
effective search space used: 365237629
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)