BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy10399
(442 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3MCA|B Chain B, Structure Of The Dom34-Hbs1 Complex And Implications For
Its Role In No-Go Decay
Length = 390
Score = 29.6 bits (65), Expect = 3.1, Method: Compositional matrix adjust.
Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 7/67 (10%)
Query: 231 WQRPKMNHLLPAFKIDAMSDRLLEMKKFTNNDKMQLNQHTWLDLVACGKEISFMWCPSHC 290
W P NH+L AF++ A+ + L+ F ++D + W+ LV KEI+ CP +
Sbjct: 293 WYGP--NHVLKAFELGAIGELLISDSLFRSSDIA--TRKKWVSLVEGVKEIN---CPVYI 345
Query: 291 GISGNEA 297
S +E+
Sbjct: 346 FSSLHES 352
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.134 0.413
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,773,434
Number of Sequences: 62578
Number of extensions: 563822
Number of successful extensions: 1078
Number of sequences better than 100.0: 11
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 11
Number of HSP's that attempted gapping in prelim test: 1078
Number of HSP's gapped (non-prelim): 11
length of query: 442
length of database: 14,973,337
effective HSP length: 102
effective length of query: 340
effective length of database: 8,590,381
effective search space: 2920729540
effective search space used: 2920729540
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)