Query         psy104
Match_columns 86
No_of_seqs    106 out of 514
Neff          6.8 
Searched_HMMs 46136
Date          Fri Aug 16 16:54:33 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy104.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/104hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1547|consensus              100.0 7.4E-33 1.6E-37  199.0   9.1   78    8-85     83-161 (336)
  2 KOG2655|consensus              100.0 4.5E-31 9.7E-36  196.7   8.9   82    4-85     54-135 (366)
  3 COG5019 CDC3 Septin family pro 100.0 7.8E-30 1.7E-34  189.8   9.9   77    9-85     62-139 (373)
  4 PF00735 Septin:  Septin;  Inte  99.9 6.4E-27 1.4E-31  169.5   9.6   80    6-85     40-119 (281)
  5 KOG3859|consensus               99.9 6.6E-26 1.4E-30  165.9   5.6   84    2-85     68-153 (406)
  6 cd01850 CDC_Septin CDC/Septin.  99.9 6.9E-22 1.5E-26  142.5  10.1   78    8-85     42-120 (276)
  7 cd01852 AIG1 AIG1 (avrRpt2-ind  95.1   0.032   7E-07   37.7   3.6   31   10-44     34-64  (196)
  8 cd01853 Toc34_like Toc34-like   95.0   0.059 1.3E-06   38.6   4.9   15   29-43     79-93  (249)
  9 PF04548 AIG1:  AIG1 family;  I  94.9   0.028 6.1E-07   38.8   3.0   29   12-44     36-64  (212)
 10 TIGR03596 GTPase_YlqF ribosome  94.5   0.042   9E-07   39.5   3.2   42   30-71    164-226 (276)
 11 TIGR00991 3a0901s02IAP34 GTP-b  93.9    0.11 2.4E-06   38.8   4.4   14   29-42     86-99  (313)
 12 smart00053 DYNc Dynamin, GTPas  93.4    0.14   3E-06   36.7   4.0   40   29-69    125-164 (240)
 13 cd01876 YihA_EngB The YihA (En  93.0    0.42 9.2E-06   29.9   5.5   15   30-44     46-60  (170)
 14 cd01894 EngA1 EngA1 subfamily.  92.0    0.91   2E-05   28.3   6.1   16   29-44     45-60  (157)
 15 PF00350 Dynamin_N:  Dynamin fa  91.2   0.099 2.2E-06   33.8   1.0   15   28-42    100-114 (168)
 16 PF01926 MMR_HSR1:  50S ribosom  90.9    0.26 5.7E-06   30.2   2.6   14   31-44     49-62  (116)
 17 COG0218 Predicted GTPase [Gene  90.5    0.29 6.4E-06   34.5   2.9   38   31-72     72-109 (200)
 18 TIGR00993 3a0901s04IAP86 chlor  90.1    0.63 1.4E-05   38.5   4.8   15   29-43    166-180 (763)
 19 cd01855 YqeH YqeH.  YqeH is an  89.4    0.44 9.5E-06   31.9   3.0   10   30-39    181-190 (190)
 20 cd01879 FeoB Ferrous iron tran  86.0       1 2.3E-05   28.2   3.1   15   29-43     43-57  (158)
 21 TIGR03597 GTPase_YqeH ribosome  84.5    0.75 1.6E-05   34.5   2.1   34   31-71    206-239 (360)
 22 PTZ00099 rab6; Provisional      83.5       5 0.00011   26.8   5.7   34    7-40      7-40  (176)
 23 cd01861 Rab6 Rab6 subfamily.    83.1     5.5 0.00012   25.0   5.5   29   12-40     32-60  (161)
 24 COG4659 RnfG Predicted NADH:ub  82.1     1.9   4E-05   30.4   3.2   28   22-49    109-140 (195)
 25 cd04164 trmE TrmE (MnmE, ThdF,  81.8     1.3 2.8E-05   27.5   2.1   16   29-44     49-64  (157)
 26 cd01857 HSR1_MMR1 HSR1/MMR1.    81.5    0.94   2E-05   29.0   1.5   11   30-40    129-139 (141)
 27 COG3596 Predicted GTPase [Gene  81.0     1.7 3.8E-05   32.3   2.9   18   29-46     87-104 (296)
 28 cd04167 Snu114p Snu114p subfam  80.9     2.6 5.6E-05   28.7   3.6   18   25-42     67-84  (213)
 29 cd01868 Rab11_like Rab11-like.  80.4     7.6 0.00016   24.6   5.5   30   11-40     34-63  (165)
 30 cd00154 Rab Rab family.  Rab G  80.2     6.6 0.00014   24.0   5.0   31   10-40     30-60  (159)
 31 TIGR03598 GTPase_YsxC ribosome  80.1     3.4 7.4E-05   27.1   3.8   15   30-44     65-79  (179)
 32 PRK00454 engB GTP-binding prot  80.0     3.7 8.1E-05   26.9   4.0   15   29-43     70-84  (196)
 33 cd01897 NOG NOG1 is a nucleola  79.2     1.7 3.6E-05   27.7   2.1   14   28-41     46-59  (168)
 34 cd00877 Ran Ran (Ras-related n  78.4     8.9 0.00019   24.8   5.4   32    9-40     29-60  (166)
 35 cd01864 Rab19 Rab19 subfamily.  78.1     8.5 0.00018   24.5   5.2   19   21-39     44-62  (165)
 36 cd01869 Rab1_Ypt1 Rab1/Ypt1 su  78.0     8.6 0.00019   24.4   5.2   20   21-40     43-62  (166)
 37 PRK04213 GTP-binding protein;   77.4     9.6 0.00021   25.2   5.4   15   30-44     53-67  (201)
 38 cd04119 RJL RJL (RabJ-Like) su  77.1     8.2 0.00018   24.1   4.9   20   21-40     41-60  (168)
 39 cd00880 Era_like Era (E. coli   77.1     1.8 3.8E-05   26.3   1.7   19   28-46     44-62  (163)
 40 cd04142 RRP22 RRP22 subfamily.  76.8      13 0.00028   25.2   6.0   20   21-40     41-60  (198)
 41 cd04113 Rab4 Rab4 subfamily.    76.6      11 0.00024   23.7   5.4   30   11-40     31-60  (161)
 42 cd04168 TetM_like Tet(M)-like   76.5     4.8  0.0001   28.3   3.9   28   13-42     50-77  (237)
 43 TIGR00436 era GTP-binding prot  76.3      11 0.00025   26.6   5.9   13   30-42     49-61  (270)
 44 cd04122 Rab14 Rab14 subfamily.  76.0      11 0.00023   24.1   5.2   18   22-39     44-61  (166)
 45 cd04106 Rab23_lke Rab23-like s  75.8     7.1 0.00015   24.5   4.3   23   17-39     39-61  (162)
 46 cd04108 Rab36_Rab34 Rab34/Rab3  75.8      12 0.00026   24.3   5.5   31   10-40     30-60  (170)
 47 cd04163 Era Era subfamily.  Er  75.2     2.6 5.7E-05   26.0   2.1   16   28-43     50-65  (168)
 48 cd01895 EngA2 EngA2 subfamily.  74.9     5.7 0.00012   24.8   3.7   14   30-43     51-64  (174)
 49 smart00175 RAB Rab subfamily o  74.6      15 0.00032   22.9   5.5   29   11-39     31-59  (164)
 50 cd04112 Rab26 Rab26 subfamily.  73.9     9.6 0.00021   25.2   4.7   17   22-38     43-59  (191)
 51 KOG0462|consensus               73.6       5 0.00011   32.7   3.7   30   12-41    107-137 (650)
 52 PF03193 DUF258:  Protein of un  73.1    0.59 1.3E-05   31.7  -1.4   11   32-42     90-100 (161)
 53 COG0481 LepA Membrane GTPase L  72.9     5.8 0.00013   32.0   3.9   31   11-41     55-88  (603)
 54 cd01866 Rab2 Rab2 subfamily.    72.5      15 0.00031   23.6   5.2   20   20-39     44-63  (168)
 55 cd01884 EF_Tu EF-Tu subfamily.  72.4     4.8  0.0001   27.5   3.0   28   12-41     50-77  (195)
 56 TIGR00231 small_GTP small GTP-  72.2      13 0.00028   22.3   4.7   19   22-40     43-61  (161)
 57 cd01856 YlqF YlqF.  Proteins o  71.6     2.7 5.9E-05   27.6   1.6   12   29-40    160-171 (171)
 58 cd04124 RabL2 RabL2 subfamily.  71.5      18 0.00039   23.0   5.5   29   12-40     32-60  (161)
 59 cd01849 YlqF_related_GTPase Yl  71.3     2.7 5.8E-05   27.2   1.5   10   30-39    146-155 (155)
 60 TIGR01394 TypA_BipA GTP-bindin  71.0     4.6  0.0001   32.5   3.0   29   12-42     49-77  (594)
 61 cd04116 Rab9 Rab9 subfamily.    70.9      18  0.0004   22.9   5.4   27   12-38     37-63  (170)
 62 TIGR00157 ribosome small subun  70.9     5.1 0.00011   28.4   3.0   10   32-41    174-183 (245)
 63 cd00882 Ras_like_GTPase Ras-li  70.6     9.1  0.0002   22.6   3.7   29   15-43     31-59  (157)
 64 smart00176 RAN Ran (Ras-relate  70.2      19 0.00042   24.5   5.7   31   10-40     25-55  (200)
 65 cd01886 EF-G Elongation factor  70.1     9.1  0.0002   27.5   4.2   30   11-42     48-77  (270)
 66 cd01890 LepA LepA subfamily.    69.8     9.7 0.00021   24.4   3.9   17   25-41     63-79  (179)
 67 PLN03071 GTP-binding nuclear p  69.6      16 0.00034   25.1   5.1   32   10-41     43-74  (219)
 68 TIGR03594 GTPase_EngA ribosome  69.1     8.2 0.00018   28.9   3.9   12   30-41     48-59  (429)
 69 PLN03118 Rab family protein; P  68.9      18 0.00039   24.3   5.3   19   21-39     54-72  (211)
 70 PRK00089 era GTPase Era; Revie  68.8      23 0.00049   25.2   6.0   15   29-43     53-67  (292)
 71 cd01881 Obg_like The Obg-like   68.5     3.3 7.3E-05   26.3   1.5   13   29-41     44-56  (176)
 72 cd04104 p47_IIGP_like p47 (47-  68.5     2.7 5.9E-05   28.4   1.1   14   29-42     52-65  (197)
 73 cd01889 SelB_euk SelB subfamil  68.2     6.3 0.00014   26.1   2.8   13   28-40     67-79  (192)
 74 PRK00093 GTP-binding protein D  68.0      17 0.00037   27.3   5.4   13   29-41     49-61  (435)
 75 COG0480 FusA Translation elong  67.9     7.9 0.00017   32.0   3.8   32   10-42     58-89  (697)
 76 cd04130 Wrch_1 Wrch-1 subfamil  67.8      20 0.00043   23.1   5.1   21   20-40     39-59  (173)
 77 cd01862 Rab7 Rab7 subfamily.    67.7      22 0.00047   22.4   5.2   19   22-40     42-60  (172)
 78 cd04118 Rab24 Rab24 subfamily.  67.7      21 0.00046   23.3   5.3   20   21-40     42-61  (193)
 79 cd04169 RF3 RF3 subfamily.  Pe  67.5       9 0.00019   27.5   3.7   28   12-41     56-83  (267)
 80 cd04115 Rab33B_Rab33A Rab33B/R  67.4      24 0.00052   22.6   5.5   20   21-40     43-62  (170)
 81 cd01859 MJ1464 MJ1464.  This f  67.2      10 0.00022   24.2   3.6   10   30-39    147-156 (156)
 82 cd01867 Rab8_Rab10_Rab13_like   66.8      19 0.00041   23.0   4.8   19   21-39     44-62  (167)
 83 PF04784 DUF547:  Protein of un  66.5     3.6 7.8E-05   26.1   1.3   19   67-85     65-86  (117)
 84 cd04117 Rab15 Rab15 subfamily.  66.4      26 0.00057   22.3   5.4   31   10-40     30-60  (161)
 85 cd00881 GTP_translation_factor  66.2     4.2 9.2E-05   26.1   1.6   14   28-41     61-74  (189)
 86 cd01863 Rab18 Rab18 subfamily.  65.9      21 0.00046   22.3   4.9   17   24-40     44-60  (161)
 87 cd01865 Rab3 Rab3 subfamily.    65.3      29 0.00063   22.0   5.5   20   21-40     42-61  (165)
 88 COG1162 Predicted GTPases [Gen  64.8     3.3 7.1E-05   30.9   1.0    9   32-40    219-227 (301)
 89 cd01860 Rab5_related Rab5-rela  64.7      24 0.00052   22.0   5.0   19   21-39     42-60  (163)
 90 cd04170 EF-G_bact Elongation f  64.6     6.1 0.00013   27.9   2.3   20   21-42     58-77  (268)
 91 PRK10218 GTP-binding protein;   64.6      18 0.00038   29.4   5.1   30   12-43     53-82  (607)
 92 cd01885 EF2 EF2 (for archaea a  64.4     5.5 0.00012   27.9   2.0   17   26-42     70-86  (222)
 93 cd04171 SelB SelB subfamily.    64.2     9.9 0.00021   23.7   3.1   12   29-40     51-62  (164)
 94 TIGR01631 Trypano_RHS trypanos  63.9     5.8 0.00012   33.1   2.3   37   28-71    279-315 (760)
 95 PF07999 RHSP:  Retrotransposon  63.5     5.3 0.00011   31.2   1.9   36   28-70    124-159 (439)
 96 PTZ00209 retrotransposon hot s  63.4     5.9 0.00013   32.7   2.3   37   28-71    172-208 (693)
 97 cd01878 HflX HflX subfamily.    63.3      13 0.00028   24.7   3.7   13   30-42     90-102 (204)
 98 cd01898 Obg Obg subfamily.  Th  63.3     5.7 0.00012   25.2   1.8   13   29-41     48-60  (170)
 99 PF12075 KN_motif:  KN motif;    62.0     5.4 0.00012   21.1   1.2   19   34-58      4-22  (39)
100 cd04136 Rap_like Rap-like subf  61.9      19 0.00041   22.5   4.1   19   22-40     42-60  (163)
101 PF00009 GTP_EFTU:  Elongation   61.8     5.6 0.00012   26.4   1.6   14   28-41     69-82  (188)
102 cd01851 GBP Guanylate-binding   60.9     6.4 0.00014   27.4   1.8   17   28-44     59-75  (224)
103 cd01858 NGP_1 NGP-1.  Autoanti  60.6     5.8 0.00013   25.6   1.5    9   31-39    149-157 (157)
104 cd04110 Rab35 Rab35 subfamily.  60.6      29 0.00063   23.1   5.0   19   21-39     47-65  (199)
105 PLN03127 Elongation factor Tu;  60.3     9.3  0.0002   29.6   2.8   30   11-42    108-137 (447)
106 TIGR03594 GTPase_EngA ribosome  60.2      24 0.00051   26.4   4.9   23   21-45    214-236 (429)
107 TIGR00503 prfC peptide chain r  59.9      13 0.00028   29.6   3.5   29   12-42     65-93  (527)
108 COG5256 TEF1 Translation elong  59.7     6.8 0.00015   30.7   1.9   29   13-43     71-99  (428)
109 PRK00741 prfC peptide chain re  59.6      14  0.0003   29.4   3.7   29   12-42     64-92  (526)
110 TIGR03134 malonate_gamma malon  59.2      16 0.00034   26.3   3.6   37   26-65     66-102 (238)
111 cd01893 Miro1 Miro1 subfamily.  58.8      15 0.00034   23.4   3.3   17   25-41     43-59  (166)
112 cd04101 RabL4 RabL4 (Rab-like4  58.6      35 0.00076   21.3   4.9   15   25-39     48-62  (164)
113 cd04145 M_R_Ras_like M-Ras/R-R  58.5      25 0.00054   21.9   4.2   15   25-39     46-60  (164)
114 cd04141 Rit_Rin_Ric Rit/Rin/Ri  58.5      31 0.00067   22.4   4.8   19   22-40     43-61  (172)
115 cd01883 EF1_alpha Eukaryotic e  57.7      13 0.00028   25.5   2.9   26   13-40     63-88  (219)
116 cd01887 IF2_eIF5B IF2/eIF5B (i  57.3     6.3 0.00014   24.8   1.2   13   28-40     49-61  (168)
117 PF00063 Myosin_head:  Myosin h  57.1      15 0.00033   29.7   3.6   37   27-65    362-399 (689)
118 PF00071 Ras:  Ras family;  Int  56.6      30 0.00066   21.6   4.4   30   11-40     30-59  (162)
119 cd04121 Rab40 Rab40 subfamily.  56.2      51  0.0011   22.2   5.6   20   21-40     47-66  (189)
120 PRK12288 GTPase RsgA; Reviewed  56.1      17 0.00036   27.3   3.5   11   32-42    260-270 (347)
121 KOG0458|consensus               56.0      16 0.00035   29.8   3.5   20   27-46    253-272 (603)
122 cd04123 Rab21 Rab21 subfamily.  55.8      46   0.001   20.5   5.2   14   25-38     45-58  (162)
123 cd04175 Rap1 Rap1 subgroup.  T  55.6      28 0.00061   21.9   4.1   19   21-39     41-59  (164)
124 cd04166 CysN_ATPS CysN_ATPS su  55.4      14 0.00031   25.0   2.8   26   13-40     63-88  (208)
125 PLN03110 Rab GTPase; Provision  55.3      50  0.0011   22.4   5.5   29   11-39     43-71  (216)
126 COG1159 Era GTPase [General fu  55.3      11 0.00025   28.1   2.4   15   28-42     53-67  (298)
127 cd04135 Tc10 TC10 subfamily.    55.0      38 0.00082   21.5   4.7   21   21-41     40-60  (174)
128 cd04107 Rab32_Rab38 Rab38/Rab3  54.9      50  0.0011   21.9   5.4   14   26-39     47-60  (201)
129 TIGR03156 GTP_HflX GTP-binding  54.9      18 0.00039   27.1   3.5   26   11-39    222-247 (351)
130 cd04114 Rab30 Rab30 subfamily.  54.6      51  0.0011   20.7   5.6   19   22-40     49-67  (169)
131 cd04178 Nucleostemin_like Nucl  54.1     7.6 0.00017   26.1   1.3   10   30-39    163-172 (172)
132 cd04120 Rab12 Rab12 subfamily.  53.4      53  0.0012   22.4   5.4   29   11-39     31-59  (202)
133 cd04176 Rap2 Rap2 subgroup.  T  53.4      30 0.00065   21.7   4.0   18   22-39     42-59  (163)
134 smart00173 RAS Ras subfamily o  53.2      31 0.00068   21.6   4.0   19   22-40     41-59  (164)
135 PLN00043 elongation factor 1-a  53.0     8.7 0.00019   29.8   1.6   31   10-42     68-98  (447)
136 TIGR01393 lepA GTP-binding pro  52.8      21 0.00046   28.7   3.8   31   12-42     50-83  (595)
137 cd04132 Rho4_like Rho4-like su  52.6      50  0.0011   21.3   5.0   15   25-39     45-59  (187)
138 cd04146 RERG_RasL11_like RERG/  52.5      30 0.00065   21.9   3.9   17   25-41     43-59  (165)
139 TIGR02034 CysN sulfate adenyly  52.5      18 0.00038   27.5   3.1   28   12-41     65-92  (406)
140 COG1084 Predicted GTPase [Gene  52.2      13 0.00028   28.4   2.3   28   13-41    198-227 (346)
141 cd04125 RabA_like RabA-like su  52.0      55  0.0012   21.3   5.2   17   25-41     45-61  (188)
142 smart00174 RHO Rho (Ras homolo  51.9      49  0.0011   20.9   4.8   19   21-39     38-56  (174)
143 PRK12289 GTPase RsgA; Reviewed  50.9     7.8 0.00017   29.2   1.0   10   32-41    227-236 (352)
144 TIGR00485 EF-Tu translation el  50.1      18 0.00039   27.2   2.8   29   11-41     59-87  (394)
145 TIGR01938 nqrC NADH:ubiquinone  49.8     8.3 0.00018   28.0   0.9   20   27-46    162-184 (251)
146 PTZ00141 elongation factor 1-   49.7      13 0.00028   28.8   2.0   29   12-42     70-98  (446)
147 cd04160 Arfrp1 Arfrp1 subfamil  49.1      28 0.00061   21.9   3.3   14   28-41     49-62  (167)
148 cd04128 Spg1 Spg1p.  Spg1p (se  48.6      71  0.0015   21.0   5.3   30   10-39     30-59  (182)
149 cd01854 YjeQ_engC YjeQ/EngC.    48.5      28  0.0006   25.2   3.5   10   32-41    216-225 (287)
150 PF02421 FeoB_N:  Ferrous iron   48.4      65  0.0014   21.5   5.1   27   10-40     32-58  (156)
151 cd04144 Ras2 Ras2 subfamily.    48.3      39 0.00083   22.2   4.0   18   23-40     41-58  (190)
152 cd04111 Rab39 Rab39 subfamily.  47.9      58  0.0013   22.1   4.9   15   25-39     48-62  (211)
153 TIGR00484 EF-G translation elo  47.9      26 0.00057   28.5   3.6   29   13-43     61-89  (689)
154 cd04127 Rab27A Rab27a subfamil  47.5      72  0.0016   20.3   5.3   14   26-39     60-73  (180)
155 cd00157 Rho Rho (Ras homology)  47.3      62  0.0013   20.2   4.7   20   22-41     41-60  (171)
156 TIGR00450 mnmE_trmE_thdF tRNA   47.3      46   0.001   25.8   4.7   16   25-42    249-264 (442)
157 cd04109 Rab28 Rab28 subfamily.  46.7      78  0.0017   21.3   5.4   30   10-39     30-60  (215)
158 CHL00189 infB translation init  46.6      24 0.00052   29.4   3.2   27   15-41    281-307 (742)
159 PF00448 SRP54:  SRP54-type pro  46.5      36 0.00079   23.3   3.7   12   29-40     84-95  (196)
160 PLN03108 Rab family protein; P  46.0      57  0.0012   22.0   4.6   18   22-39     48-65  (210)
161 KOG2486|consensus               45.1      43 0.00093   25.3   4.1   28   21-48    175-202 (320)
162 COG1217 TypA Predicted membran  45.0      31 0.00067   28.0   3.5   30   11-42     52-81  (603)
163 PRK12317 elongation factor 1-a  44.7      26 0.00056   26.6   3.0   27   13-41     70-96  (425)
164 TIGR00490 aEF-2 translation el  44.6      23  0.0005   29.1   2.8   14   28-41     85-98  (720)
165 cd01888 eIF2_gamma eIF2-gamma   44.5      16 0.00034   24.7   1.6   12   29-40     83-94  (203)
166 PLN03126 Elongation factor Tu;  44.4      37 0.00081   26.7   3.9   29   11-41    128-156 (478)
167 PRK05433 GTP-binding protein L  44.2      23  0.0005   28.6   2.7   18   25-42     70-87  (600)
168 cd04154 Arl2 Arl2 subfamily.    44.2      34 0.00073   22.0   3.1   13   28-40     57-69  (173)
169 cd04148 RGK RGK subfamily.  Th  44.2      57  0.0012   22.3   4.4   16   25-40     46-61  (221)
170 cd01385 MYSc_type_IX Myosin mo  44.1      38 0.00083   27.9   4.0   36   28-64    375-411 (692)
171 cd01871 Rac1_like Rac1-like su  44.0      53  0.0011   21.4   4.1   20   21-40     41-60  (174)
172 PRK03003 GTP-binding protein D  43.6 1.5E+02  0.0033   22.9   7.2   11   30-40     87-97  (472)
173 cd04147 Ras_dva Ras-dva subfam  43.6      48   0.001   22.0   3.9   17   23-39     41-57  (198)
174 cd01870 RhoA_like RhoA-like su  43.5      54  0.0012   20.8   4.0   18   22-39     42-59  (175)
175 cd04157 Arl6 Arl6 subfamily.    43.3      20 0.00043   22.4   1.9   13   28-40     44-56  (162)
176 cd00876 Ras Ras family.  The R  43.2      63  0.0014   19.8   4.2   18   23-40     41-58  (160)
177 cd01874 Cdc42 Cdc42 subfamily.  42.8      56  0.0012   21.3   4.1   20   21-40     41-60  (175)
178 CHL00071 tufA elongation facto  42.7      43 0.00093   25.4   3.9   29   11-41     59-87  (409)
179 PRK13796 GTPase YqeH; Provisio  42.6      25 0.00055   26.4   2.6   28   32-66    213-240 (365)
180 cd04140 ARHI_like ARHI subfami  42.6      59  0.0013   20.6   4.1   19   22-40     42-60  (165)
181 PTZ00369 Ras-like protein; Pro  42.5      60  0.0013   21.3   4.2   17   25-41     49-65  (189)
182 PRK05291 trmE tRNA modificatio  42.4      44 0.00096   25.8   4.0   26   12-41    250-275 (449)
183 PRK00049 elongation factor Tu;  42.3      35 0.00077   25.8   3.4   29   10-40     58-86  (396)
184 cd01891 TypA_BipA TypA (tyrosi  42.0      20 0.00044   23.7   1.9   14   28-41     64-77  (194)
185 cd04137 RheB Rheb (Ras Homolog  41.8      57  0.0012   20.8   4.0   19   22-40     42-60  (180)
186 cd01875 RhoG RhoG subfamily.    41.7   1E+02  0.0022   20.3   5.4   18   22-39     44-61  (191)
187 TIGR02584 cas_NE0113 CRISPR-as  41.4      17 0.00038   25.8   1.5   11   75-85    116-126 (209)
188 PRK09518 bifunctional cytidyla  41.3 1.7E+02  0.0036   24.1   7.2   13   29-41    323-335 (712)
189 smart00242 MYSc Myosin. Large   41.3      47   0.001   27.2   4.1   36   27-64    367-403 (677)
190 PRK05724 acetyl-CoA carboxylas  41.2      17 0.00037   27.4   1.5   15   25-40    150-164 (319)
191 PF12508 DUF3714:  Protein of u  41.0      57  0.0012   22.9   4.0   29   11-39    101-129 (200)
192 PRK05124 cysN sulfate adenylyl  40.9      34 0.00073   26.7   3.1   27   12-40     92-118 (474)
193 PTZ00132 GTP-binding nuclear p  40.8      98  0.0021   20.7   5.1   30   10-39     39-68  (215)
194 PRK12736 elongation factor Tu;  40.8      33 0.00071   25.9   3.0   27   11-39     59-85  (394)
195 cd04139 RalA_RalB RalA/RalB su  40.7      64  0.0014   19.9   4.0   17   23-39     42-58  (164)
196 TIGR02836 spore_IV_A stage IV   40.5      19 0.00042   28.7   1.7   26   18-43     79-105 (492)
197 cd04177 RSR1 RSR1 subgroup.  R  40.4      63  0.0014   20.5   4.0   17   24-40     44-60  (168)
198 PRK07560 elongation factor EF-  40.3      29 0.00064   28.5   2.8   15   27-41     85-99  (731)
199 PRK09563 rbgA GTPase YlqF; Rev  39.9      17 0.00037   26.2   1.3   13   30-42    167-179 (287)
200 TIGR00483 EF-1_alpha translati  39.8      44 0.00094   25.4   3.5   26   12-39     70-95  (426)
201 PRK05346 Na(+)-translocating N  39.7      13 0.00029   27.0   0.7   20   27-46    160-182 (256)
202 cd04165 GTPBP1_like GTPBP1-lik  39.5      21 0.00044   24.9   1.6   11   29-39     84-94  (224)
203 PRK00098 GTPase RsgA; Reviewed  39.4      32 0.00069   25.0   2.7    9   32-40    219-227 (298)
204 cd04161 Arl2l1_Arl13_like Arl2  39.4      53  0.0011   21.1   3.5   12   28-39     42-53  (167)
205 cd04133 Rop_like Rop subfamily  38.9      66  0.0014   21.3   4.0   20   21-40     41-60  (176)
206 cd04152 Arl4_Arl7 Arl4/Arl7 su  38.8      46 0.00099   21.8   3.2   16   25-40     48-63  (183)
207 TIGR00475 selB selenocysteine-  38.7      61  0.0013   26.0   4.4   12   29-40     50-61  (581)
208 PRK12740 elongation factor G;   38.3      41 0.00089   27.1   3.3   27   13-41     46-72  (668)
209 PRK12735 elongation factor Tu;  38.1      43 0.00093   25.3   3.3   27   12-40     60-86  (396)
210 PRK00007 elongation factor G;   37.9      43 0.00092   27.4   3.4   28   12-41     60-87  (693)
211 PF09140 MipZ:  ATPase MipZ;  I  37.5      15 0.00033   27.0   0.7   14   29-42     99-112 (261)
212 KOG1030|consensus               37.2      95  0.0021   21.4   4.5   52   17-68     56-107 (168)
213 cd04134 Rho3 Rho3 subfamily.    37.1      81  0.0017   20.7   4.2   18   22-39     41-58  (189)
214 KOG0465|consensus               36.9      39 0.00084   28.1   3.0   27   13-41     90-116 (721)
215 cd04174 Rnd1_Rho6 Rnd1/Rho6 su  36.5 1.2E+02  0.0026   21.3   5.2   20   20-39     52-71  (232)
216 TIGR00513 accA acetyl-CoA carb  36.4      22 0.00049   26.7   1.5   14   26-40    151-164 (316)
217 TIGR00487 IF-2 translation ini  36.2      48   0.001   26.8   3.4   11   30-40    136-146 (587)
218 cd04138 H_N_K_Ras_like H-Ras/N  36.0      94   0.002   19.0   4.2   15   25-39     45-59  (162)
219 KOG0446|consensus               35.7      24 0.00053   28.9   1.7   44   28-72    131-174 (657)
220 TIGR00437 feoB ferrous iron tr  35.6 1.6E+02  0.0034   23.8   6.2   27   14-42     28-54  (591)
221 CHL00198 accA acetyl-CoA carbo  35.5      23  0.0005   26.7   1.5   15   26-41    154-168 (322)
222 COG0532 InfB Translation initi  35.5      57  0.0012   26.2   3.6   29   10-39     37-65  (509)
223 PTZ00416 elongation factor 2;   35.2      31 0.00068   28.9   2.3   15   28-42     91-105 (836)
224 cd04105 SR_beta Signal recogni  35.2      55  0.0012   22.1   3.2   14   28-41     47-60  (203)
225 cd01387 MYSc_type_XV Myosin mo  35.1      72  0.0015   26.3   4.3   36   28-65    360-396 (677)
226 cd01378 MYSc_type_I Myosin mot  35.0      66  0.0014   26.4   4.1   36   27-64    364-400 (674)
227 PRK12739 elongation factor G;   34.6      38 0.00083   27.6   2.6   28   12-41     58-85  (691)
228 cd01900 YchF YchF subfamily.    34.4      35 0.00076   24.9   2.2   14   27-40     60-73  (274)
229 KOG1954|consensus               34.2      20 0.00044   28.3   0.9   33   29-61    147-183 (532)
230 PRK05306 infB translation init  34.1      55  0.0012   27.5   3.5   14   29-42    337-350 (787)
231 cd01380 MYSc_type_V Myosin mot  34.0      66  0.0014   26.5   3.9   35   28-64    367-402 (691)
232 cd01379 MYSc_type_III Myosin m  33.8      72  0.0016   26.2   4.1   35   28-64    372-407 (653)
233 PRK12319 acetyl-CoA carboxylas  33.4      27 0.00059   25.3   1.5   16   25-41     97-112 (256)
234 PF15016 DUF4520:  Domain of un  33.4      29 0.00063   21.2   1.4   13   73-85     19-31  (85)
235 TIGR03779 Bac_Flav_CT_M Bacter  33.3      71  0.0015   25.0   3.8   29   11-39    304-332 (410)
236 PF08189 Meleagrin:  Meleagrin/  33.3      29 0.00062   18.2   1.2   11   75-85     25-35  (39)
237 cd04172 Rnd3_RhoE_Rho8 Rnd3/Rh  33.2 1.5E+02  0.0032   19.7   5.2   19   21-39     45-63  (182)
238 PF00460 Flg_bb_rod:  Flagella   33.2      14 0.00031   18.2   0.0    6   34-39     25-30  (31)
239 cd04131 Rnd Rnd subfamily.  Th  33.1 1.4E+02  0.0031   19.5   5.4   19   21-39     41-59  (178)
240 PRK11058 GTPase HflX; Provisio  33.1      46 0.00099   25.7   2.7   26   11-39    230-255 (426)
241 cd01383 MYSc_type_VIII Myosin   33.0      83  0.0018   25.9   4.3   34   29-64    365-399 (677)
242 cd01382 MYSc_type_VI Myosin mo  32.5      67  0.0014   26.6   3.7   34   29-64    397-431 (717)
243 PRK12685 flgB flagellar basal   32.3      18 0.00039   23.0   0.3    8   33-40     32-39  (116)
244 cd00878 Arf_Arl Arf (ADP-ribos  32.1      70  0.0015   19.8   3.1   14   28-41     42-55  (158)
245 PRK07182 flgB flagellar basal   32.0      19 0.00041   23.8   0.5    7   34-40     33-39  (148)
246 PHA02857 monoglyceride lipase;  31.9      54  0.0012   22.4   2.8   18   29-46     53-70  (276)
247 PF11567 PfUIS3:  Plasmodium fa  31.4      51  0.0011   20.6   2.3   18   51-68     83-100 (101)
248 cd04151 Arl1 Arl1 subfamily.    31.3      40 0.00086   21.2   1.9   13   28-40     42-54  (158)
249 KOG2655|consensus               31.2      39 0.00084   26.0   2.0   74   11-84    217-292 (366)
250 cd01381 MYSc_type_VII Myosin m  31.1      87  0.0019   25.8   4.1   35   28-64    361-396 (671)
251 cd01386 MYSc_type_XVIII Myosin  31.0      83  0.0018   26.4   4.0   36   29-64    373-413 (767)
252 TIGR01947 rnfG electron transp  31.0      31 0.00067   23.5   1.4   20   25-44    106-128 (186)
253 cd04158 ARD1 ARD1 subfamily.    30.8      78  0.0017   20.2   3.2   14   28-41     42-55  (169)
254 cd04173 Rnd2_Rho7 Rnd2/Rho7 su  30.7      99  0.0021   21.5   3.9   21   20-40     40-60  (222)
255 TIGR03319 YmdA_YtgF conserved   30.7      41 0.00089   26.8   2.2   33   28-64    235-267 (514)
256 PF09439 SRPRB:  Signal recogni  30.4      18 0.00039   24.9   0.1   15   28-42     48-62  (181)
257 PLN03230 acetyl-coenzyme A car  30.3      32 0.00069   27.1   1.5   14   26-40    221-234 (431)
258 cd01873 RhoBTB RhoBTB subfamil  30.3      54  0.0012   22.1   2.5   16   24-39     61-76  (195)
259 cd04153 Arl5_Arl8 Arl5/Arl8 su  30.1      75  0.0016   20.4   3.1   13   28-40     58-70  (174)
260 PRK13351 elongation factor G;   29.1      35 0.00076   27.7   1.6   15   28-42     72-86  (687)
261 PLN00116 translation elongatio  29.0      29 0.00062   29.1   1.1   15   28-42     97-111 (843)
262 TIGR03874 4cys_cytochr c-type   29.0      41 0.00088   22.5   1.6   26   35-60     91-116 (143)
263 cd01384 MYSc_type_XI Myosin mo  28.7   1E+02  0.0023   25.4   4.2   35   28-64    366-401 (674)
264 PF14038 YqzE:  YqzE-like prote  28.3      65  0.0014   18.1   2.1   17   50-66      3-19  (54)
265 PRK06003 flgB flagellar basal   28.2      23 0.00051   22.7   0.4    7   34-40     31-37  (126)
266 KOG1145|consensus               28.2      66  0.0014   26.6   2.9   32    5-39    180-211 (683)
267 KOG0095|consensus               27.8 1.6E+02  0.0034   20.5   4.4   26   12-39     41-66  (213)
268 PRK12298 obgE GTPase CgtA; Rev  27.6      44 0.00095   25.5   1.8   12   30-41    208-219 (390)
269 COG4604 CeuD ABC-type enteroch  27.5      33 0.00071   24.9   1.1   51   23-73     82-142 (252)
270 cd04159 Arl10_like Arl10-like   27.3 1.1E+02  0.0024   18.4   3.4   12   29-40     44-55  (159)
271 PF02089 Palm_thioest:  Palmito  27.2      49  0.0011   24.4   1.9   29   33-61      8-36  (279)
272 COG0825 AccA Acetyl-CoA carbox  27.0      37 0.00079   25.6   1.3   11   30-40    153-163 (317)
273 PF14149 YhfH:  YhfH-like prote  26.7      53  0.0012   17.1   1.5   14   53-66     20-33  (37)
274 PF01797 Y1_Tnp:  Transposase I  26.7      29 0.00063   21.1   0.6   12   48-59    110-121 (121)
275 PLN00223 ADP-ribosylation fact  26.6   1E+02  0.0022   20.2   3.3   12   28-39     60-71  (181)
276 PRK15494 era GTPase Era; Provi  26.3      44 0.00096   24.7   1.6   12   30-41    101-112 (339)
277 PRK09866 hypothetical protein;  25.5      43 0.00093   28.1   1.5   27   15-41    215-242 (741)
278 cd04156 ARLTS1 ARLTS1 subfamil  25.5   1E+02  0.0022   19.0   3.1   13   28-40     43-55  (160)
279 PRK01908 electron transport co  25.4      41 0.00088   23.5   1.2   12   34-45    122-133 (205)
280 KOG0464|consensus               25.2      82  0.0018   25.5   2.9   29   11-41     86-114 (753)
281 PTZ00133 ADP-ribosylation fact  25.0   1E+02  0.0022   20.2   3.1   13   28-40     60-72  (182)
282 KOG0078|consensus               24.9 2.6E+02  0.0056   19.9   5.4   32    9-40     41-72  (207)
283 cd04143 Rhes_like Rhes_like su  24.7 1.5E+02  0.0032   20.9   4.0   16   25-40     44-59  (247)
284 PF11144 DUF2920:  Protein of u  24.6      48  0.0011   25.8   1.6   33   28-61     33-65  (403)
285 cd01896 DRG The developmentall  24.5      56  0.0012   22.8   1.8   12   29-40     47-58  (233)
286 KOG0395|consensus               24.5 1.8E+02  0.0038   19.9   4.2   27   11-38     34-60  (196)
287 PRK11126 2-succinyl-6-hydroxy-  24.2 1.4E+02  0.0029   19.8   3.6   16   29-44     28-43  (242)
288 PRK09554 feoB ferrous iron tra  24.1 1.4E+02  0.0031   25.0   4.3   14   29-42     50-63  (772)
289 PF10662 PduV-EutP:  Ethanolami  23.7      36 0.00078   22.6   0.6    7   32-38     39-45  (143)
290 PHA02130 hypothetical protein   23.5      37 0.00081   20.1   0.6   20   47-66     14-33  (81)
291 TIGR03100 hydr1_PEP hydrolase,  23.3 2.3E+02   0.005   19.8   4.8   33   29-61     58-90  (274)
292 COG1160 Predicted GTPases [Gen  23.3 1.3E+02  0.0028   23.8   3.7   32   29-65     51-82  (444)
293 TIGR03680 eif2g_arch translati  23.2      55  0.0012   24.8   1.6   12   28-39     79-90  (406)
294 PLN02824 hydrolase, alpha/beta  23.1   2E+02  0.0043   19.9   4.4   12   31-42     58-69  (294)
295 KOG0468|consensus               22.8   1E+02  0.0022   26.3   3.1   31   10-40    175-208 (971)
296 PF07885 Ion_trans_2:  Ion chan  22.7      58  0.0013   18.5   1.4   17   34-50     36-52  (79)
297 PRK04000 translation initiatio  22.7      57  0.0012   24.9   1.6   13   29-41     85-97  (411)
298 PF06500 DUF1100:  Alpha/beta h  22.5 1.1E+02  0.0024   23.9   3.1   30   29-58    219-254 (411)
299 cd01899 Ygr210 Ygr210 subfamil  22.2      54  0.0012   24.3   1.4   11   29-39     69-79  (318)
300 PRK15467 ethanolamine utilizat  22.2      35 0.00077   22.0   0.4    9   33-41     41-49  (158)
301 KOG0097|consensus               22.1 1.3E+02  0.0028   20.7   3.1   30   10-39     41-70  (215)
302 PF09623 Cas_NE0113:  CRISPR-as  22.1      58  0.0013   23.2   1.5   10   76-85    111-120 (224)
303 COG1161 Predicted GTPases [Gen  22.1      51  0.0011   24.4   1.2   10   31-40    179-188 (322)
304 PF11342 DUF3144:  Protein of u  21.8   1E+02  0.0023   18.5   2.4   19   49-67     55-73  (78)
305 COG2869 NqrC Na+-transporting   21.8      51  0.0011   24.2   1.1   16   34-50    176-191 (264)
306 PF04670 Gtr1_RagA:  Gtr1/RagA   21.7      64  0.0014   22.9   1.6   35    9-46     31-65  (232)
307 PTZ00014 myosin-A; Provisional  21.6 1.5E+02  0.0033   25.1   4.0   35   28-64    461-496 (821)
308 KOG4742|consensus               21.5      36 0.00078   25.4   0.4   11   33-43    234-244 (286)
309 KOG0079|consensus               21.5 1.7E+02  0.0037   20.3   3.6   25   12-38     42-66  (198)
310 PF01039 Carboxyl_trans:  Carbo  21.3      72  0.0016   25.0   2.0   36   26-64    329-364 (493)
311 TIGR02729 Obg_CgtA Obg family   21.1      70  0.0015   23.7   1.8   12   29-40    205-216 (329)
312 PRK09601 GTP-binding protein Y  21.1      60  0.0013   24.8   1.5   15   27-41     64-78  (364)
313 PRK12297 obgE GTPase CgtA; Rev  21.0      68  0.0015   24.9   1.8   13   29-41    206-218 (424)
314 PRK06004 flgB flagellar basal   20.9      38 0.00083   21.8   0.3    7   34-40     23-29  (127)
315 cd00879 Sar1 Sar1 subfamily.    20.7 1.3E+02  0.0029   19.3   3.0   12   29-40     63-74  (190)
316 COG1815 FlgB Flagellar basal b  20.6      40 0.00087   22.2   0.4    8   33-40     31-38  (133)
317 COG4108 PrfC Peptide chain rel  20.6   1E+02  0.0022   24.8   2.7   29   12-42     66-94  (528)
318 TIGR03695 menH_SHCHC 2-succiny  20.5 2.3E+02  0.0051   17.8   4.1   27   29-55     28-58  (251)
319 PF09547 Spore_IV_A:  Stage IV   20.5      73  0.0016   25.5   1.8   17   24-40     86-102 (492)
320 PRK12620 flgB flagellar basal   20.3      41 0.00088   21.5   0.4    7   34-40     33-39  (132)
321 TIGR02240 PHA_depoly_arom poly  20.2 2.4E+02  0.0053   19.3   4.3   29   29-57     52-82  (276)

No 1  
>KOG1547|consensus
Probab=100.00  E-value=7.4e-33  Score=198.98  Aligned_cols=78  Identities=44%  Similarity=0.710  Sum_probs=75.9

Q ss_pred             CCCcceEEEEEEEEEeecCeEEEEEEEeCCCCCCccCCccchhHHHHHHHHHHHHhhhhhcCCccC-CCCCCeeEEeec
Q psy104            8 RQGKTTTIEKKSMDIEERGVKLRLTVVDTPGFGDSINSEESWRACCSYIDDQFRQYFNDESGLNRK-NIVDNREVVDKS   85 (86)
Q Consensus         8 ~~~~t~~I~~~~~~l~e~~~~l~LtIidTpGfGd~i~n~~~~~~i~~yI~~qf~~yl~eE~~i~R~-~~~D~RVH~Cl~   85 (86)
                      +++||.+|...+..++|+|++++|||||||||||++||++||+||++||.+||++||++|..+.|+ .++|+||||||.
T Consensus        83 p~pkT~eik~~thvieE~gVklkltviDTPGfGDqInN~ncWePI~kyIneQye~yL~eElni~R~kripDTRVHccly  161 (336)
T KOG1547|consen   83 PIPKTTEIKSITHVIEEKGVKLKLTVIDTPGFGDQINNDNCWEPIEKYINEQYEQYLREELNIAREKRIPDTRVHCCLY  161 (336)
T ss_pred             cccceEEEEeeeeeeeecceEEEEEEecCCCcccccCccchhHHHHHHHHHHHHHHHHHHHhHHhhhcCCCceEEEEEE
Confidence            789999999999999999999999999999999999999999999999999999999999999996 899999999984


No 2  
>KOG2655|consensus
Probab=99.97  E-value=4.5e-31  Score=196.70  Aligned_cols=82  Identities=48%  Similarity=0.790  Sum_probs=78.8

Q ss_pred             cCCCCCCcceEEEEEEEEEeecCeEEEEEEEeCCCCCCccCCccchhHHHHHHHHHHHHhhhhhcCCccCCCCCCeeEEe
Q psy104            4 RGNNRQGKTTTIEKKSMDIEERGVKLRLTVVDTPGFGDSINSEESWRACCSYIDDQFRQYFNDESGLNRKNIVDNREVVD   83 (86)
Q Consensus         4 ~~~~~~~~t~~I~~~~~~l~e~~~~l~LtIidTpGfGd~i~n~~~~~~i~~yI~~qf~~yl~eE~~i~R~~~~D~RVH~C   83 (86)
                      .|+.++.+|+.|..+++.|+|+|++++|||||||||||.+||+.||.||++||++||++||.+|++++|.++.|+|||||
T Consensus        54 ~~~~~~~~t~~i~~~~~~iee~g~~l~LtvidtPGfGD~vdns~~w~pi~~yi~~q~~~yl~~E~~~~R~~~~D~RVH~c  133 (366)
T KOG2655|consen   54 GASERIKETVEIESTKVEIEENGVKLNLTVIDTPGFGDAVDNSNCWRPIVNYIDSQFDQYLDEESRLNRSKIKDNRVHCC  133 (366)
T ss_pred             CcccCccccceeeeeeeeecCCCeEEeeEEeccCCCcccccccccchhhhHHHHHHHHHHHhhhccCCcccccCCceEEE
Confidence            36678888999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ec
Q psy104           84 KS   85 (86)
Q Consensus        84 l~   85 (86)
                      |.
T Consensus       134 LY  135 (366)
T KOG2655|consen  134 LY  135 (366)
T ss_pred             EE
Confidence            94


No 3  
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton]
Probab=99.96  E-value=7.8e-30  Score=189.81  Aligned_cols=77  Identities=39%  Similarity=0.689  Sum_probs=75.0

Q ss_pred             CCcceEEEEEEEEEeecCeEEEEEEEeCCCCCCccCCccchhHHHHHHHHHHHHhhhhhcCCccC-CCCCCeeEEeec
Q psy104            9 QGKTTTIEKKSMDIEERGVKLRLTVVDTPGFGDSINSEESWRACCSYIDDQFRQYFNDESGLNRK-NIVDNREVVDKS   85 (86)
Q Consensus         9 ~~~t~~I~~~~~~l~e~~~~l~LtIidTpGfGd~i~n~~~~~~i~~yI~~qf~~yl~eE~~i~R~-~~~D~RVH~Cl~   85 (86)
                      .++++.|..++..|.|+|++++|||||||||||.+||+.||.||++||++||++||.+|+++.|+ ++.|+||||||.
T Consensus        62 ~~~~~~i~~~~~~l~e~~~~~~l~vIDtpGfGD~idNs~~we~I~~yI~~q~d~yl~~E~~~~R~~~~~D~RVH~cLY  139 (373)
T COG5019          62 TSPTLEIKITKAELEEDGFHLNLTVIDTPGFGDFIDNSKCWEPIVDYIDDQFDQYLDEEQKIKRNPKFKDTRVHACLY  139 (373)
T ss_pred             CCcceEEEeeeeeeecCCeEEEEEEeccCCccccccccccHHHHHHHHHHHHHHHHHHhhccccccccccCceEEEEE
Confidence            67899999999999999999999999999999999999999999999999999999999999998 999999999994


No 4  
>PF00735 Septin:  Septin;  InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments []. Members of the family were first identified by genetic screening for Saccharomyces cerevisiae (Baker's yeast) mutants defective in cytokinesis []. Temperature-sensitive mutations in four genes, CDC3, CDC10, CDC11 and CDC12, were found to cause cell-cycle arrest and defects in bud growth and cytokinesis. The protein products of these genes localise at the division plane between mother and daughter cells, indicating a role in mother-daughter separation during cytokinesis []. Members of the family were therefore termed septins to reflect their role in septation and cell division. The identification of septin homologues in higher eukaryotes, which localise to the cleavage furrow in dividing cells, supports an orthologous function in cytokinesis. Septins have since been identified in most eukaryotes, except plants []. Septins are approximately 40-50 kDa in molecular mass, and typically comprise a conserved central core domain (more than 35% sequence identity between mammalian and yeast homologues) flanked by more divergent N- and C-termini. Most septins possess a P-loop motif in their N-terminal domain (which is characteristic of GTP-binding proteins), and a predicted C-terminal coiled-coil domain []. A number of septin interaction partners have been identified in yeast, many of which are components of the budding site selection machinery, kinase cascades or of the ubiquitination pathway. It has been proposed that septins may act as a scaffold that provides an interaction matrix for other proteins [, ]. In mammals, septins have been shown to regulate vesicle dynamics []. Mammalian septins have also been implicated in a variety of other cellular processes, including apoptosis, carcinogenesis and neurodegeneration []. This entry represents a variety of septins and homologous sequences involved in the cell division process.; GO: 0005525 GTP binding, 0007049 cell cycle; PDB: 2QAG_B 3FTQ_D 2QA5_A 2QNR_B 3TW4_A 3T5D_C.
Probab=99.94  E-value=6.4e-27  Score=169.47  Aligned_cols=80  Identities=40%  Similarity=0.751  Sum_probs=67.2

Q ss_pred             CCCCCcceEEEEEEEEEeecCeEEEEEEEeCCCCCCccCCccchhHHHHHHHHHHHHhhhhhcCCccCCCCCCeeEEeec
Q psy104            6 NNRQGKTTTIEKKSMDIEERGVKLRLTVVDTPGFGDSINSEESWRACCSYIDDQFRQYFNDESGLNRKNIVDNREVVDKS   85 (86)
Q Consensus         6 ~~~~~~t~~I~~~~~~l~e~~~~l~LtIidTpGfGd~i~n~~~~~~i~~yI~~qf~~yl~eE~~i~R~~~~D~RVH~Cl~   85 (86)
                      .++..++..|..+++.++|++++++|+|||||||||.++|+.+|.+|++||++||+.||.+|.++.|..+.|+||||||.
T Consensus        40 ~~~~~~~~~i~~~~~~l~e~~~~l~LtiiDTpGfGd~i~n~~~~~~I~~yI~~qf~~~l~eE~~~~R~~~~D~RVH~cLY  119 (281)
T PF00735_consen   40 SASISRTLEIEERTVELEENGVKLNLTIIDTPGFGDNIDNSDCWEPIVDYIESQFDSYLEEESKINRPRIEDTRVHACLY  119 (281)
T ss_dssp             -----SCEEEEEEEEEEEETCEEEEEEEEEEC-CSSSSTHCHHHHHHHHHHHHHHHHHHHHHTSSS-TTS----EEEEEE
T ss_pred             ccccccccceeeEEEEeccCCcceEEEEEeCCCccccccchhhhHHHHHHHHHHHHHHHHHhhcccccCcCCCCcceEEE
Confidence            34677889999999999999999999999999999999999999999999999999999999999999999999999994


No 5  
>KOG3859|consensus
Probab=99.92  E-value=6.6e-26  Score=165.94  Aligned_cols=84  Identities=33%  Similarity=0.571  Sum_probs=79.1

Q ss_pred             CccCCCCCCcceEEEEEEEEEeecCeEEEEEEEeCCCCCCccCCccchhHHHHHHHHHHHHhhhhhcCCccC--CCCCCe
Q psy104            2 EKRGNNRQGKTTTIEKKSMDIEERGVKLRLTVVDTPGFGDSINSEESWRACCSYIDDQFRQYFNDESGLNRK--NIVDNR   79 (86)
Q Consensus         2 ~~~~~~~~~~t~~I~~~~~~l~e~~~~l~LtIidTpGfGd~i~n~~~~~~i~~yI~~qf~~yl~eE~~i~R~--~~~D~R   79 (86)
                      +..++.|.-+++.+...++++.|.+++++|||+||.||||++|.+.|++||++||++||+.||++|.+|.|.  .+.|+|
T Consensus        68 ~~~p~~H~~~~V~L~~~TyelqEsnvrlKLtiv~tvGfGDQinK~~Syk~iVdyidaQFEaYLQEELKi~Rsl~~~hDsR  147 (406)
T KOG3859|consen   68 ESEPSTHTLPNVKLQANTYELQESNVRLKLTIVDTVGFGDQINKEDSYKPIVDYIDAQFEAYLQEELKIRRSLFTYHDSR  147 (406)
T ss_pred             CCCCCccCCCCceeecchhhhhhcCeeEEEEEEeecccccccCcccccchHHHHHHHHHHHHHHHHHHHHHHHHHhccCc
Confidence            345677888899999999999999999999999999999999999999999999999999999999999997  789999


Q ss_pred             eEEeec
Q psy104           80 EVVDKS   85 (86)
Q Consensus        80 VH~Cl~   85 (86)
                      ||+||.
T Consensus       148 iH~CLY  153 (406)
T KOG3859|consen  148 IHVCLY  153 (406)
T ss_pred             eEEEEE
Confidence            999994


No 6  
>cd01850 CDC_Septin CDC/Septin.  Septins are a conserved family of GTP-binding proteins associated with diverse processes in dividing and non-dividing cells.  They were first discovered in the budding yeast S. cerevisiae as a set of genes (CDC3, CDC10, CDC11 and CDC12) required for normal bud morphology. Septins are also present in metazoan cells, where they are required for cytokinesis in some systems, and implicated in a variety of other processes involving organization of the cell cortex and exocytosis.  In humans, 12 septin genes generate dozens of polypeptides, many of which comprise heterooligomeric complexes. Since septin mutants are commonly defective in cytokinesis and formation of the neck formation of the neck filaments/septin rings, septins have been considered to be the primary constituents of the neck filaments.  Septins belong to the GTPase superfamily for their conserved GTPase motifs and enzymatic activities.
Probab=99.87  E-value=6.9e-22  Score=142.52  Aligned_cols=78  Identities=47%  Similarity=0.791  Sum_probs=73.8

Q ss_pred             CCCcceEEEEEEEEEeecCeEEEEEEEeCCCCCCccCCccchhHHHHHHHHHHHHhhhhhcCCcc-CCCCCCeeEEeec
Q psy104            8 RQGKTTTIEKKSMDIEERGVKLRLTVVDTPGFGDSINSEESWRACCSYIDDQFRQYFNDESGLNR-KNIVDNREVVDKS   85 (86)
Q Consensus         8 ~~~~t~~I~~~~~~l~e~~~~l~LtIidTpGfGd~i~n~~~~~~i~~yI~~qf~~yl~eE~~i~R-~~~~D~RVH~Cl~   85 (86)
                      +..+|+.+..+...++++|++++|+|+|||||||.++|+.+|++|++||++||+.||.+|.++.| ..+.|+||||||.
T Consensus        42 ~~~~T~~i~~~~~~i~~~g~~~~l~iiDTpGfgd~~~~~~~~~~i~~yi~~q~~~~l~~e~~~~r~~~~~d~rvh~~ly  120 (276)
T cd01850          42 HIDKTVEIKSSKAEIEENGVKLKLTVIDTPGFGDNINNSDCWKPIVDYIDDQFDQYLREESRIKRNPRIPDTRVHACLY  120 (276)
T ss_pred             ccCCceEEEEEEEEEEECCEEEEEEEEecCCccccccchhhHHHHHHHHHHHHHHHHHHHhhhcccccCCCCceEEEEE
Confidence            46788899999999999999999999999999999999999999999999999999999999999 5899999999984


No 7  
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1).  This represents Arabidoposis protein AIG1 that appears to be involved in plant resistance to bacteria.  The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2.  AIG1 exhibits RPS2- and avrRpt1-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2. This subfamily also includes IAN-4 protein, which has GTP-binding activity and shares sequence homology with a novel family of putative GTP-binding proteins: the immuno-associated nucleotide (IAN) family.  The evolutionary conservation of the IAN family provides a unique example of a plant pathogen response gene conserved in animals. The IAN/IMAP subfamily has been proposed to regulate apoptosis in vertebrates and angiosperm plants, particularly in relation to cancer, diabetes, and infections.  The human IAN genes were renamed GIMAP (GTPase of the immunity associated proteins).
Probab=95.05  E-value=0.032  Score=37.66  Aligned_cols=31  Identities=39%  Similarity=0.502  Sum_probs=20.4

Q ss_pred             CcceEEEEEEEEEeecCeEEEEEEEeCCCCCCccC
Q psy104           10 GKTTTIEKKSMDIEERGVKLRLTVVDTPGFGDSIN   44 (86)
Q Consensus        10 ~~t~~I~~~~~~l~e~~~~l~LtIidTpGfGd~i~   44 (86)
                      +.|...+.+...+.  +  ..++|||||||++...
T Consensus        34 ~~T~~~~~~~~~~~--~--~~i~viDTPG~~d~~~   64 (196)
T cd01852          34 SVTKTCQKESAVWD--G--RRVNVIDTPGLFDTSV   64 (196)
T ss_pred             CcccccceeeEEEC--C--eEEEEEECcCCCCccC
Confidence            34555555555442  2  4689999999998754


No 8  
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts).  This family contains several Toc proteins, including Toc34, Toc33, Toc120, Toc159, Toc86, Toc125, and Toc90.  The Toc complex at the outer envelope membrane of chloroplasts is a molecular machine of ~500 kDa that contains a single Toc159 protein, four Toc75 molecules, and four or five copies of Toc34. Toc64 and Toc12 are associated with the translocon, but do not appear to be part of the core complex.  The Toc translocon initiates the import of nuclear-encoded preproteins from the cytosol into the organelle.  Toc34 and Toc159 are both GTPases, while Toc75 is a beta-barrel integral membrane protein.  Toc159 is equally distributed between a soluble cytoplasmic form and a membrane-inserted form, suggesting that assembly of the Toc complex is dynamic.  Toc34 and Toc75 act sequentially to mediate docking and insertion of Toc159 resulting in assembly of the functional translocon.
Probab=94.99  E-value=0.059  Score=38.61  Aligned_cols=15  Identities=40%  Similarity=0.941  Sum_probs=12.5

Q ss_pred             EEEEEEeCCCCCCcc
Q psy104           29 LRLTVVDTPGFGDSI   43 (86)
Q Consensus        29 l~LtIidTpGfGd~i   43 (86)
                      .++++|||||||+..
T Consensus        79 ~~i~vIDTPGl~~~~   93 (249)
T cd01853          79 FKLNIIDTPGLLESV   93 (249)
T ss_pred             eEEEEEECCCcCcch
Confidence            457999999999773


No 9  
>PF04548 AIG1:  AIG1 family;  InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria. The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2. AIG1 (avrRpt2-induced gene) exhibits RPS2- and avrRpt2-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2 [].  The domain is also apparently found in a number of mammalian proteins, for example the rat immune-associated nucleotide 4 protein. ; GO: 0005525 GTP binding; PDB: 3LXX_A 3BB4_A 3DEF_A 3BB3_A 2J3E_A 3V70_B 3BB1_A 1H65_B 2XTP_A 3P1J_C ....
Probab=94.92  E-value=0.028  Score=38.84  Aligned_cols=29  Identities=45%  Similarity=0.491  Sum_probs=15.6

Q ss_pred             ceEEEEEEEEEeecCeEEEEEEEeCCCCCCccC
Q psy104           12 TTTIEKKSMDIEERGVKLRLTVVDTPGFGDSIN   44 (86)
Q Consensus        12 t~~I~~~~~~l~e~~~~l~LtIidTpGfGd~i~   44 (86)
                      |.....+..  ..+|  ..++|||||||+|.-.
T Consensus        36 t~~~~~~~~--~~~g--~~v~VIDTPGl~d~~~   64 (212)
T PF04548_consen   36 TQECQKYSG--EVDG--RQVTVIDTPGLFDSDG   64 (212)
T ss_dssp             -SS-EEEEE--EETT--EEEEEEE--SSEETTE
T ss_pred             ccccceeee--eecc--eEEEEEeCCCCCCCcc
Confidence            344444444  3334  5678999999987654


No 10 
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF. Members of this protein family are GTP-binding proteins involved in ribosome biogenesis, including the essential YlqF protein of Bacillus subtilis, which is an essential protein. They are related to Era, EngA, and other GTPases of ribosome biogenesis, but are circularly permuted. This family is not universal, and is not present in Escherichia coli, and so is not as well studied as some other GTPases. This model is built for bacterial members.
Probab=94.52  E-value=0.042  Score=39.52  Aligned_cols=42  Identities=21%  Similarity=0.430  Sum_probs=31.3

Q ss_pred             EEEEEeCCCC-----CCc----------------cCCccchhHHHHHHHHHHHHhhhhhcCCc
Q psy104           30 RLTVVDTPGF-----GDS----------------INSEESWRACCSYIDDQFRQYFNDESGLN   71 (86)
Q Consensus        30 ~LtIidTpGf-----Gd~----------------i~n~~~~~~i~~yI~~qf~~yl~eE~~i~   71 (86)
                      .+.++||||+     ++.                ++....+..+..||..++..++.+.-++.
T Consensus       164 ~~~l~DtPG~~~~~~~~~~~~~~l~~~g~i~~~~~~~~~~~~~~~~~l~~~~~~~l~~~y~i~  226 (276)
T TIGR03596       164 GLELLDTPGILWPKFEDQEVGLKLAATGAIKDEALDLEDVALFLLEYLLEHYPERLKERYKLD  226 (276)
T ss_pred             CEEEEECCCcccCCCCchHHHHHHHHhCCcccccCChHHHHHHHHHHHHhhCHHHHHHHhCcC
Confidence            5689999999     443                55566677888899998887777665543


No 11 
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase).
Probab=93.93  E-value=0.11  Score=38.82  Aligned_cols=14  Identities=36%  Similarity=0.821  Sum_probs=12.1

Q ss_pred             EEEEEEeCCCCCCc
Q psy104           29 LRLTVVDTPGFGDS   42 (86)
Q Consensus        29 l~LtIidTpGfGd~   42 (86)
                      .+|+||||||+.+.
T Consensus        86 ~~l~VIDTPGL~d~   99 (313)
T TIGR00991        86 FTLNIIDTPGLIEG   99 (313)
T ss_pred             eEEEEEECCCCCch
Confidence            57899999999874


No 12 
>smart00053 DYNc Dynamin, GTPase. Large GTPases that mediate vesicle trafficking. Dynamin participates in the endocytic uptake of receptors, associated ligands, and  plasma membrane following an exocytic event.
Probab=93.37  E-value=0.14  Score=36.69  Aligned_cols=40  Identities=25%  Similarity=0.367  Sum_probs=27.6

Q ss_pred             EEEEEEeCCCCCCccCCccchhHHHHHHHHHHHHhhhhhcC
Q psy104           29 LRLTVVDTPGFGDSINSEESWRACCSYIDDQFRQYFNDESG   69 (86)
Q Consensus        29 l~LtIidTpGfGd~i~n~~~~~~i~~yI~~qf~~yl~eE~~   69 (86)
                      ..|++||||||-..-. ...-..+...+.++.+.|++++..
T Consensus       125 ~~ltLIDlPGl~~~~~-~~~~~~~~~~i~~lv~~yi~~~~~  164 (240)
T smart00053      125 LNLTLIDLPGITKVAV-GDQPPDIEEQIKDMIKQFISKEEC  164 (240)
T ss_pred             CceEEEeCCCcccccc-CCccHHHHHHHHHHHHHHHhCccC
Confidence            6899999999953211 111234677888899999887653


No 13 
>cd01876 YihA_EngB The YihA (EngB) subfamily.  This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control.  YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting).  Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis.  The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target.
Probab=92.96  E-value=0.42  Score=29.86  Aligned_cols=15  Identities=33%  Similarity=0.733  Sum_probs=13.1

Q ss_pred             EEEEEeCCCCCCccC
Q psy104           30 RLTVVDTPGFGDSIN   44 (86)
Q Consensus        30 ~LtIidTpGfGd~i~   44 (86)
                      .+.++||||||+...
T Consensus        46 ~~~~~D~~g~~~~~~   60 (170)
T cd01876          46 KFRLVDLPGYGYAKV   60 (170)
T ss_pred             eEEEecCCCcccccc
Confidence            899999999998754


No 14 
>cd01894 EngA1 EngA1 subfamily.  This CD represents the first GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability.  A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=92.01  E-value=0.91  Score=28.29  Aligned_cols=16  Identities=19%  Similarity=0.289  Sum_probs=13.0

Q ss_pred             EEEEEEeCCCCCCccC
Q psy104           29 LRLTVVDTPGFGDSIN   44 (86)
Q Consensus        29 l~LtIidTpGfGd~i~   44 (86)
                      ..|.++||||+++...
T Consensus        45 ~~~~i~DtpG~~~~~~   60 (157)
T cd01894          45 REFILIDTGGIEPDDE   60 (157)
T ss_pred             eEEEEEECCCCCCchh
Confidence            5789999999987543


No 15 
>PF00350 Dynamin_N:  Dynamin family;  InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another. Dynamins are large GTPases that belong to a protein superfamily [] that, in eukaryotic cells, includes classical dynamins, dynamin-like proteins, OPA1, Mx proteins, mitofusins and guanylate-binding proteins/atlastins [, , , ], and are involved in the scission of a wide range of vesicles and organelles. They play a role in many processes including budding of transport vesicles, division of organelles, cytokinesis and pathogen resistance.   The minimal distinguishing architectural features that are common to all dynamins and are distinct from other GTPases are the structure of the large GTPase domain (300 amino acids) and the presence of two additional domains; the middle domain and the GTPase effector domain (GED), which are involved in oligomerization and regulation of the GTPase activity. This entry represents the GTPase domain, containing the GTP-binding motifs that are needed for guanine-nucleotide binding and hydrolysis. The conservation of these motifs is absolute except for the the final motif in guanylate-binding proteins. The GTPase catalytic activity can be stimulated by oligomerisation of the protein, which is mediated by interactions between the GTPase domain, the middle domain and the GED.; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 1JWY_B 1JX2_B 3ZVR_A 2AKA_B 3L43_B 2X2F_D 2X2E_D 3SNH_A 3ZYS_D 3ZYC_D ....
Probab=91.24  E-value=0.099  Score=33.83  Aligned_cols=15  Identities=47%  Similarity=0.744  Sum_probs=12.2

Q ss_pred             EEEEEEEeCCCCCCc
Q psy104           28 KLRLTVVDTPGFGDS   42 (86)
Q Consensus        28 ~l~LtIidTpGfGd~   42 (86)
                      ...+++|||||+++.
T Consensus       100 ~~~~~lvDtPG~~~~  114 (168)
T PF00350_consen  100 LRNLTLVDTPGLNST  114 (168)
T ss_dssp             SCSEEEEEEEEBHSS
T ss_pred             ccceEEEeCCccccc
Confidence            356789999999873


No 16 
>PF01926 MMR_HSR1:  50S ribosome-binding GTPase;  InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has both prokaryote and eukaryote members [].; GO: 0005525 GTP binding, 0005622 intracellular; PDB: 2DWQ_B 2DBY_A 3CNN_A 3CNO_A 3CNL_A 3IBY_A 1PUI_B 1WXQ_A 1LNZ_A 3GEE_A ....
Probab=90.86  E-value=0.26  Score=30.20  Aligned_cols=14  Identities=43%  Similarity=0.778  Sum_probs=10.8

Q ss_pred             EEEEeCCCCCCccC
Q psy104           31 LTVVDTPGFGDSIN   44 (86)
Q Consensus        31 LtIidTpGfGd~i~   44 (86)
                      +.++|||||++...
T Consensus        49 ~~~vDtpG~~~~~~   62 (116)
T PF01926_consen   49 FILVDTPGINDGES   62 (116)
T ss_dssp             EEEEESSSCSSSSH
T ss_pred             EEEEeCCCCcccch
Confidence            36999999986544


No 17 
>COG0218 Predicted GTPase [General function prediction only]
Probab=90.48  E-value=0.29  Score=34.47  Aligned_cols=38  Identities=21%  Similarity=0.412  Sum_probs=22.9

Q ss_pred             EEEEeCCCCCCccCCccchhHHHHHHHHHHHHhhhhhcCCcc
Q psy104           31 LTVVDTPGFGDSINSEESWRACCSYIDDQFRQYFNDESGLNR   72 (86)
Q Consensus        31 LtIidTpGfGd~i~n~~~~~~i~~yI~~qf~~yl~eE~~i~R   72 (86)
                      +.+||-||||-.--..    ...+-...-..+||+....+.+
T Consensus        72 ~~lVDlPGYGyAkv~k----~~~e~w~~~i~~YL~~R~~L~~  109 (200)
T COG0218          72 LRLVDLPGYGYAKVPK----EVKEKWKKLIEEYLEKRANLKG  109 (200)
T ss_pred             EEEEeCCCcccccCCH----HHHHHHHHHHHHHHhhchhheE
Confidence            7799999999654332    2344444455556665444544


No 18 
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains. The long precursor of the 86K protein originally described is proposed to have three domains. The N-terminal A-domain is acidic, repetitive, weakly conserved, readily removed by proteolysis during chloroplast isolation, and not required for protein translocation. The other domains are designated G (GTPase) and M (membrane anchor); this family includes most of the G domain and all of M.
Probab=90.14  E-value=0.63  Score=38.50  Aligned_cols=15  Identities=40%  Similarity=0.840  Sum_probs=12.8

Q ss_pred             EEEEEEeCCCCCCcc
Q psy104           29 LRLTVVDTPGFGDSI   43 (86)
Q Consensus        29 l~LtIidTpGfGd~i   43 (86)
                      ..|+|||||||++..
T Consensus       166 ~~L~VIDTPGL~dt~  180 (763)
T TIGR00993       166 VKIRVIDTPGLKSSA  180 (763)
T ss_pred             ceEEEEECCCCCccc
Confidence            468999999999874


No 19 
>cd01855 YqeH YqeH.  YqeH is an essential GTP-binding protein. Depletion of YqeH induces an excess initiation of DNA replication, suggesting that it negatively controls initiation of chromosome replication. The YqeH subfamily is common in eukaryotes and sporadically present in bacteria with probable acquisition by plants from chloroplasts.  Proteins of the YqeH family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases.
Probab=89.36  E-value=0.44  Score=31.86  Aligned_cols=10  Identities=40%  Similarity=0.670  Sum_probs=8.8

Q ss_pred             EEEEEeCCCC
Q psy104           30 RLTVVDTPGF   39 (86)
Q Consensus        30 ~LtIidTpGf   39 (86)
                      .+.|+|||||
T Consensus       181 ~~~~~DtPG~  190 (190)
T cd01855         181 GKKLYDTPGI  190 (190)
T ss_pred             CCEEEeCcCC
Confidence            5789999997


No 20 
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily.  E. coli has an iron(II) transport system, known as feo, which may make an important contribution to the iron supply of the cell under anaerobic conditions.  FeoB has been identified as part of this transport system.  FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent.
Probab=85.98  E-value=1  Score=28.18  Aligned_cols=15  Identities=27%  Similarity=0.346  Sum_probs=11.9

Q ss_pred             EEEEEEeCCCCCCcc
Q psy104           29 LRLTVVDTPGFGDSI   43 (86)
Q Consensus        29 l~LtIidTpGfGd~i   43 (86)
                      ..+.++||||+.+..
T Consensus        43 ~~~~liDtpG~~~~~   57 (158)
T cd01879          43 KEIEIVDLPGTYSLS   57 (158)
T ss_pred             eEEEEEECCCccccC
Confidence            478999999987543


No 21 
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH. This family describes YqeH, a member of a larger family of GTPases involved in ribosome biogenesis. Like YqlF, it shows a cyclical permutation relative to GTPases EngA (in which the GTPase domain is duplicated), Era, and others. Members of this protein family are found in a relatively small number of bacterial species, including Bacillus subtilis but not Escherichia coli.
Probab=84.50  E-value=0.75  Score=34.47  Aligned_cols=34  Identities=24%  Similarity=0.464  Sum_probs=22.6

Q ss_pred             EEEEeCCCCCCccCCccchhHHHHHHHHHHHHhhhhhcCCc
Q psy104           31 LTVVDTPGFGDSINSEESWRACCSYIDDQFRQYFNDESGLN   71 (86)
Q Consensus        31 LtIidTpGfGd~i~n~~~~~~i~~yI~~qf~~yl~eE~~i~   71 (86)
                      +.++|||||+..       ..+.++++.+-..++.....++
T Consensus       206 ~~l~DtPG~~~~-------~~~~~~l~~~~l~~~~~~~~i~  239 (360)
T TIGR03597       206 HSLYDTPGIINS-------HQMAHYLDKKDLKYITPKKEIK  239 (360)
T ss_pred             CEEEECCCCCCh-------hHhhhhcCHHHHhhcCCCCccC
Confidence            469999999854       2346677766666665544444


No 22 
>PTZ00099 rab6; Provisional
Probab=83.54  E-value=5  Score=26.79  Aligned_cols=34  Identities=26%  Similarity=0.170  Sum_probs=22.5

Q ss_pred             CCCCcceEEEEEEEEEeecCeEEEEEEEeCCCCC
Q psy104            7 NRQGKTTTIEKKSMDIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus         7 ~~~~~t~~I~~~~~~l~e~~~~l~LtIidTpGfG   40 (86)
                      +...+|+.+.-+...+.-++-.++|.|.||||..
T Consensus         7 ~~~~~Tig~~~~~~~~~~~~~~v~l~iwDt~G~e   40 (176)
T PTZ00099          7 NNYQSTIGIDFLSKTLYLDEGPVRLQLWDTAGQE   40 (176)
T ss_pred             CCCCCccceEEEEEEEEECCEEEEEEEEECCChH
Confidence            3445566555544444445668999999999964


No 23 
>cd01861 Rab6 Rab6 subfamily.  Rab6 is involved in microtubule-dependent transport pathways through the Golgi and from endosomes to the Golgi. Rab6A of mammals is implicated in retrograde transport through the Golgi stack, and is also required for a slow, COPI-independent, retrograde transport pathway from the Golgi to the endoplasmic reticulum (ER). This pathway may allow Golgi residents to be recycled through the ER for scrutiny by ER quality-control systems. Yeast Ypt6p, the homolog of the mammalian Rab6 GTPase, is not essential for cell viability. Ypt6p acts in endosome-to-Golgi, in intra-Golgi retrograde transport, and possibly also in Golgi-to-ER trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate
Probab=83.05  E-value=5.5  Score=25.01  Aligned_cols=29  Identities=28%  Similarity=0.223  Sum_probs=19.1

Q ss_pred             ceEEEEEEEEEeecCeEEEEEEEeCCCCC
Q psy104           12 TTTIEKKSMDIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        12 t~~I~~~~~~l~e~~~~l~LtIidTpGfG   40 (86)
                      +.........+..++..++|.+.||||-.
T Consensus        32 ~~~~~~~~~~~~~~~~~~~l~~~D~~G~~   60 (161)
T cd01861          32 TIGIDFLSKTMYLEDKTVRLQLWDTAGQE   60 (161)
T ss_pred             ceeeeEEEEEEEECCEEEEEEEEECCCcH
Confidence            33333344445556677899999999954


No 24 
>COG4659 RnfG Predicted NADH:ubiquinone oxidoreductase, subunit RnfG [Energy production and conversion]
Probab=82.14  E-value=1.9  Score=30.35  Aligned_cols=28  Identities=43%  Similarity=0.812  Sum_probs=21.2

Q ss_pred             EeecCeEEEEEEE---eCCCCCCccCCccc-h
Q psy104           22 IEERGVKLRLTVV---DTPGFGDSINSEES-W   49 (86)
Q Consensus        22 l~e~~~~l~LtIi---dTpGfGd~i~n~~~-~   49 (86)
                      +..+|.-+.++|+   +|||+||.|+-+-| |
T Consensus       109 i~~~G~vlGvRVi~h~ETPGLGdKI~~~~s~W  140 (195)
T COG4659         109 IDFDGTVLGVRVIEHHETPGLGDKIELRISDW  140 (195)
T ss_pred             EcCCCeEEEEEEEeccCCCCchhhhcchhhcc
Confidence            4567766777777   59999999998643 5


No 25 
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes.  It controls modification of the uridine at the wobble position (U34) of tRNAs that read codons ending with A or G in the mixed codon family boxes.  TrmE contains a GTPase domain that forms a canonical Ras-like fold.  It functions a molecular switch GTPase, and apparently uses a conformational change associated with GTP hydrolysis to promote the tRNA modification reaction, in which the conserved cysteine in the C-terminal domain is thought to function as a catalytic residue.  In bacteria that are able to survive in extremely low pH conditions, TrmE regulates glutamate-dependent acid resistance.
Probab=81.83  E-value=1.3  Score=27.54  Aligned_cols=16  Identities=19%  Similarity=0.547  Sum_probs=12.6

Q ss_pred             EEEEEEeCCCCCCccC
Q psy104           29 LRLTVVDTPGFGDSIN   44 (86)
Q Consensus        29 l~LtIidTpGfGd~i~   44 (86)
                      .+++++||||+++...
T Consensus        49 ~~~~i~DtpG~~~~~~   64 (157)
T cd04164          49 IPVRLIDTAGIRETED   64 (157)
T ss_pred             EEEEEEECCCcCCCcc
Confidence            4678999999986543


No 26 
>cd01857 HSR1_MMR1 HSR1/MMR1.  Human HSR1, is localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has only eukaryote members. This subfamily shows a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with sequence NKXD) are relocated to the N terminus.
Probab=81.46  E-value=0.94  Score=28.95  Aligned_cols=11  Identities=36%  Similarity=0.727  Sum_probs=9.5

Q ss_pred             EEEEEeCCCCC
Q psy104           30 RLTVVDTPGFG   40 (86)
Q Consensus        30 ~LtIidTpGfG   40 (86)
                      .+.++|||||-
T Consensus       129 ~~~i~DtpG~~  139 (141)
T cd01857         129 TITLCDCPGLV  139 (141)
T ss_pred             CEEEEECCCcC
Confidence            57899999984


No 27 
>COG3596 Predicted GTPase [General function prediction only]
Probab=81.04  E-value=1.7  Score=32.31  Aligned_cols=18  Identities=39%  Similarity=0.717  Sum_probs=15.1

Q ss_pred             EEEEEEeCCCCCCccCCc
Q psy104           29 LRLTVVDTPGFGDSINSE   46 (86)
Q Consensus        29 l~LtIidTpGfGd~i~n~   46 (86)
                      =.|++-||||+||...-+
T Consensus        87 ~~l~lwDtPG~gdg~~~D  104 (296)
T COG3596          87 ENLVLWDTPGLGDGKDKD  104 (296)
T ss_pred             cceEEecCCCcccchhhh
Confidence            367899999999987765


No 28 
>cd04167 Snu114p Snu114p subfamily.  Snu114p is one of several proteins that make up the U5 small nuclear ribonucleoprotein (snRNP) particle.  U5 is a component of the spliceosome, which catalyzes the splicing of pre-mRNA to remove introns.  Snu114p is homologous to EF-2, but typically contains an additional N-terminal domain not found in Ef-2.  This protein is part of the GTP translation factor family and the Ras superfamily, characterized by five G-box motifs.
Probab=80.94  E-value=2.6  Score=28.71  Aligned_cols=18  Identities=28%  Similarity=0.586  Sum_probs=14.5

Q ss_pred             cCeEEEEEEEeCCCCCCc
Q psy104           25 RGVKLRLTVVDTPGFGDS   42 (86)
Q Consensus        25 ~~~~l~LtIidTpGfGd~   42 (86)
                      ++-.+.++++||||..+.
T Consensus        67 ~~~~~~i~iiDtpG~~~f   84 (213)
T cd04167          67 KGKSYLFNIIDTPGHVNF   84 (213)
T ss_pred             CCCEEEEEEEECCCCcch
Confidence            355789999999998754


No 29 
>cd01868 Rab11_like Rab11-like.  Rab11a, Rab11b, and Rab25 are closely related, evolutionary conserved Rab proteins that are differentially expressed. Rab11a is ubiquitously synthesized, Rab11b is enriched in brain and heart and Rab25 is only found in epithelia. Rab11/25 proteins seem to regulate recycling pathways from endosomes to the plasma membrane and to the trans-Golgi network. Furthermore, Rab11a is thought to function in the histamine-induced fusion of tubulovesicles containing H+, K+ ATPase with the plasma membrane in gastric parietal cells and in insulin-stimulated insertion of GLUT4 in the plasma membrane of cardiomyocytes. Overexpression of Rab25 has recently been observed in ovarian cancer and breast cancer, and has been correlated with worsened outcomes in both diseases. In addition, Rab25 overexpression has also been observed in prostate cancer, transitional cell carcinoma of the bladder, and invasive breast tumor cells. GTPase activating proteins (GAPs) interact with GTP
Probab=80.36  E-value=7.6  Score=24.58  Aligned_cols=30  Identities=23%  Similarity=0.306  Sum_probs=19.8

Q ss_pred             cceEEEEEEEEEeecCeEEEEEEEeCCCCC
Q psy104           11 KTTTIEKKSMDIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        11 ~t~~I~~~~~~l~e~~~~l~LtIidTpGfG   40 (86)
                      +|.........+.-++..+++.+.||||-.
T Consensus        34 ~t~~~~~~~~~~~~~~~~~~~~l~D~~g~~   63 (165)
T cd01868          34 STIGVEFATRSIQIDGKTIKAQIWDTAGQE   63 (165)
T ss_pred             CccceEEEEEEEEECCEEEEEEEEeCCChH
Confidence            344343344455556778899999999954


No 30 
>cd00154 Rab Rab family.  Rab GTPases form the largest family within the Ras superfamily.  There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways.  The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide di
Probab=80.23  E-value=6.6  Score=23.99  Aligned_cols=31  Identities=32%  Similarity=0.384  Sum_probs=22.1

Q ss_pred             CcceEEEEEEEEEeecCeEEEEEEEeCCCCC
Q psy104           10 GKTTTIEKKSMDIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        10 ~~t~~I~~~~~~l~e~~~~l~LtIidTpGfG   40 (86)
                      .+|.........+.-.+..+.++++|+||.-
T Consensus        30 ~~t~~~~~~~~~~~~~~~~~~~~l~D~~g~~   60 (159)
T cd00154          30 KSTIGVDFKSKTIEIDGKTVKLQIWDTAGQE   60 (159)
T ss_pred             CCceeeeeEEEEEEECCEEEEEEEEecCChH
Confidence            3455566665666656677899999999963


No 31 
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB. Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes.
Probab=80.11  E-value=3.4  Score=27.13  Aligned_cols=15  Identities=33%  Similarity=0.651  Sum_probs=12.2

Q ss_pred             EEEEEeCCCCCCccC
Q psy104           30 RLTVVDTPGFGDSIN   44 (86)
Q Consensus        30 ~LtIidTpGfGd~i~   44 (86)
                      .+.++||||||....
T Consensus        65 ~~~liDtpG~~~~~~   79 (179)
T TIGR03598        65 GFRLVDLPGYGYAKV   79 (179)
T ss_pred             cEEEEeCCCCccccC
Confidence            588999999987543


No 32 
>PRK00454 engB GTP-binding protein YsxC; Reviewed
Probab=79.98  E-value=3.7  Score=26.87  Aligned_cols=15  Identities=40%  Similarity=0.738  Sum_probs=12.5

Q ss_pred             EEEEEEeCCCCCCcc
Q psy104           29 LRLTVVDTPGFGDSI   43 (86)
Q Consensus        29 l~LtIidTpGfGd~i   43 (86)
                      ..|.++||||++...
T Consensus        70 ~~l~l~DtpG~~~~~   84 (196)
T PRK00454         70 DKLRLVDLPGYGYAK   84 (196)
T ss_pred             CeEEEeCCCCCCCcC
Confidence            679999999998643


No 33 
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans.  NOG1 is functionally linked to ribosome biogenesis and found in association with the nuclear pore complexes and identified in many preribosomal complexes.  Thus, defects in NOG1 can lead to defects in 60S biogenesis.  The S. cerevisiae NOG1 gene is essential for cell viability, and mutations in the predicted G motifs abrogate function.  It is a member of the ODN family of GTP-binding proteins that also includes the bacterial Obg and DRG proteins.
Probab=79.23  E-value=1.7  Score=27.71  Aligned_cols=14  Identities=57%  Similarity=0.859  Sum_probs=11.6

Q ss_pred             EEEEEEEeCCCCCC
Q psy104           28 KLRLTVVDTPGFGD   41 (86)
Q Consensus        28 ~l~LtIidTpGfGd   41 (86)
                      .++++++||||+.+
T Consensus        46 ~~~~~i~Dt~G~~~   59 (168)
T cd01897          46 YLRWQVIDTPGLLD   59 (168)
T ss_pred             ceEEEEEECCCcCC
Confidence            36899999999864


No 34 
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases. Ran GTPase is involved in diverse biological functions, such as nuclear transport, spindle formation during mitosis, DNA replication, and cell division.  Among the Ras superfamily, Ran is a unique small G protein.  It does not have a lipid modification motif at the C-terminus to bind to the membrane, which is often observed within the Ras superfamily.  Ran may therefore interact with a wide range of proteins in various intracellular locations.  Like other GTPases, Ran exists in GTP- and GDP-bound conformations that interact differently with effectors.  Conversion between these forms and the assembly or disassembly of effector complexes requires the interaction of regulator proteins.  The intrinsic GTPase activity of Ran is very low, but it is greatly stimulated by a GTPase-activating protein (RanGAP1) located in the cytoplasm. By contrast, RCC1, a guanine nucleotide exchange factor that generates RanGTP, is
Probab=78.39  E-value=8.9  Score=24.78  Aligned_cols=32  Identities=28%  Similarity=0.316  Sum_probs=23.4

Q ss_pred             CCcceEEEEEEEEEeecCeEEEEEEEeCCCCC
Q psy104            9 QGKTTTIEKKSMDIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus         9 ~~~t~~I~~~~~~l~e~~~~l~LtIidTpGfG   40 (86)
                      ..+|..+......+..++-.+.|.+.||||-.
T Consensus        29 ~~~t~~~~~~~~~~~~~~~~~~l~i~Dt~G~~   60 (166)
T cd00877          29 YVATLGVEVHPLDFHTNRGKIRFNVWDTAGQE   60 (166)
T ss_pred             CCCceeeEEEEEEEEECCEEEEEEEEECCCCh
Confidence            34566666666666667778999999999864


No 35 
>cd01864 Rab19 Rab19 subfamily.  Rab19 proteins are associated with Golgi stacks. Similarity analysis indicated that Rab41 is closely related to Rab19. However, the function of these Rabs is not yet chracterized. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=78.14  E-value=8.5  Score=24.46  Aligned_cols=19  Identities=32%  Similarity=0.566  Sum_probs=14.3

Q ss_pred             EEeecCeEEEEEEEeCCCC
Q psy104           21 DIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        21 ~l~e~~~~l~LtIidTpGf   39 (86)
                      .+.-++..+.|.+.||||.
T Consensus        44 ~~~~~~~~~~l~i~D~~G~   62 (165)
T cd01864          44 TLEIEGKRVKLQIWDTAGQ   62 (165)
T ss_pred             EEEECCEEEEEEEEECCCh
Confidence            3444566789999999995


No 36 
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily.  Rab1 is found in every eukaryote and is a key regulatory component for the transport of vesicles from the ER to the Golgi apparatus. Studies on mutations of Ypt1, the yeast homolog of Rab1, showed that this protein is necessary for the budding of vesicles of the ER as well as for their transport to, and fusion with, the Golgi apparatus. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to t
Probab=77.98  E-value=8.6  Score=24.41  Aligned_cols=20  Identities=35%  Similarity=0.504  Sum_probs=14.9

Q ss_pred             EEeecCeEEEEEEEeCCCCC
Q psy104           21 DIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        21 ~l~e~~~~l~LtIidTpGfG   40 (86)
                      .+.-++..+.+.++||||.-
T Consensus        43 ~~~~~~~~~~~~i~D~~G~~   62 (166)
T cd01869          43 TIELDGKTIKLQIWDTAGQE   62 (166)
T ss_pred             EEEECCEEEEEEEEECCCcH
Confidence            34445678899999999943


No 37 
>PRK04213 GTP-binding protein; Provisional
Probab=77.41  E-value=9.6  Score=25.21  Aligned_cols=15  Identities=33%  Similarity=0.596  Sum_probs=12.2

Q ss_pred             EEEEEeCCCCCCccC
Q psy104           30 RLTVVDTPGFGDSIN   44 (86)
Q Consensus        30 ~LtIidTpGfGd~i~   44 (86)
                      .++++||||+|+...
T Consensus        53 ~~~l~Dt~G~~~~~~   67 (201)
T PRK04213         53 DFILTDLPGFGFMSG   67 (201)
T ss_pred             ceEEEeCCccccccc
Confidence            588999999986544


No 38 
>cd04119 RJL RJL (RabJ-Like) subfamily.  RJLs are found in many protists and as chimeras with C-terminal DNAJ domains in deuterostome metazoa. They are not found in plants, fungi, and protostome metazoa, suggesting a horizontal gene transfer between protists and deuterostome metazoa.  RJLs lack any known membrane targeting signal and contain a degenerate phosphate/magnesium-binding 3 (PM3) motif, suggesting an impaired ability to hydrolyze GTP.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.
Probab=77.11  E-value=8.2  Score=24.12  Aligned_cols=20  Identities=20%  Similarity=0.405  Sum_probs=15.1

Q ss_pred             EEeecCeEEEEEEEeCCCCC
Q psy104           21 DIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        21 ~l~e~~~~l~LtIidTpGfG   40 (86)
                      .+.-++..+.|++.||||..
T Consensus        41 ~~~~~~~~~~l~i~Dt~G~~   60 (168)
T cd04119          41 KVSVRNKEVRVNFFDLSGHP   60 (168)
T ss_pred             EEEECCeEEEEEEEECCccH
Confidence            34444678999999999964


No 39 
>cd00880 Era_like Era (E. coli Ras-like protein)-like.  This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons.  FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control.  Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain.  EngA and its orthologs are composed of two GTPase domains and, since the se
Probab=77.08  E-value=1.8  Score=26.30  Aligned_cols=19  Identities=21%  Similarity=0.328  Sum_probs=14.9

Q ss_pred             EEEEEEEeCCCCCCccCCc
Q psy104           28 KLRLTVVDTPGFGDSINSE   46 (86)
Q Consensus        28 ~l~LtIidTpGfGd~i~n~   46 (86)
                      ...+.++||||+++.....
T Consensus        44 ~~~~~~~Dt~g~~~~~~~~   62 (163)
T cd00880          44 LGPVVLIDTPGIDEAGGLG   62 (163)
T ss_pred             CCcEEEEECCCCCccccch
Confidence            4688999999999765444


No 40 
>cd04142 RRP22 RRP22 subfamily.  RRP22 (Ras-related protein on chromosome 22) subfamily consists of proteins that inhibit cell growth and promote caspase-independent cell death.  Unlike most Ras proteins, RRP22 is down-regulated in many human tumor cells due to promoter methylation.  RRP22 localizes to the nucleolus in a GTP-dependent manner, suggesting a novel function in modulating transport of nucleolar components.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.  Like most Ras family proteins, RRP22 is farnesylated.
Probab=76.82  E-value=13  Score=25.19  Aligned_cols=20  Identities=20%  Similarity=0.375  Sum_probs=15.4

Q ss_pred             EEeecCeEEEEEEEeCCCCC
Q psy104           21 DIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        21 ~l~e~~~~l~LtIidTpGfG   40 (86)
                      .+.-++..++|.++||||..
T Consensus        41 ~i~~~~~~~~l~i~Dt~G~~   60 (198)
T cd04142          41 AVVLSGRVYDLHILDVPNMQ   60 (198)
T ss_pred             EEEECCEEEEEEEEeCCCcc
Confidence            34446778999999999965


No 41 
>cd04113 Rab4 Rab4 subfamily.  Rab4 has been implicated in numerous functions within the cell.  It helps regulate endocytosis through the sorting, recycling, and degradation of early endosomes. Mammalian Rab4 is involved in the regulation of many surface proteins including G-protein-coupled receptors, transferrin receptor, integrins, and surfactant protein A.  Experimental data implicate Rab4 in regulation of the recycling of internalized receptors back to the plasma membrane.  It is also believed to influence receptor-mediated antigen processing in B-lymphocytes, in calcium-dependent exocytosis in platelets, in alpha-amylase secretion in pancreatic cells, and in insulin-induced translocation of Glut4 from internal vesicles to the cell surface. Rab4 is known to share effector proteins with Rab5 and Rab11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to p
Probab=76.64  E-value=11  Score=23.69  Aligned_cols=30  Identities=30%  Similarity=0.329  Sum_probs=18.8

Q ss_pred             cceEEEEEEEEEeecCeEEEEEEEeCCCCC
Q psy104           11 KTTTIEKKSMDIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        11 ~t~~I~~~~~~l~e~~~~l~LtIidTpGfG   40 (86)
                      ++.........+.-++..++|.+.||||-.
T Consensus        31 ~~~~~~~~~~~~~~~~~~~~l~l~D~~G~~   60 (161)
T cd04113          31 HTIGVEFGSKIIRVGGKRVKLQIWDTAGQE   60 (161)
T ss_pred             CceeeeEEEEEEEECCEEEEEEEEECcchH
Confidence            344443333444444667899999999953


No 42 
>cd04168 TetM_like Tet(M)-like subfamily.  Tet(M), Tet(O), Tet(W), and OtrA are tetracycline resistance genes found in Gram-positive and Gram-negative bacteria.  Tetracyclines inhibit protein synthesis by preventing aminoacyl-tRNA from binding to the ribosomal acceptor site.  This subfamily contains tetracycline resistance proteins that function through ribosomal protection and are typically found on mobile genetic elements, such as transposons or plasmids, and are often conjugative.  Ribosomal protection proteins are homologous to the elongation factors EF-Tu and EF-G.  EF-G and Tet(M) compete for binding on the ribosomes.  Tet(M) has a higher affinity than EF-G, suggesting these two proteins may have overlapping binding sites and that Tet(M) must be released before EF-G can bind.  Tet(M) and Tet(O) have been shown to have ribosome-dependent GTPase activity.  These proteins are part of the GTP translation factor family, which includes EF-G, EF-Tu, EF2, LepA, and SelB.
Probab=76.51  E-value=4.8  Score=28.31  Aligned_cols=28  Identities=25%  Similarity=0.331  Sum_probs=18.2

Q ss_pred             eEEEEEEEEEeecCeEEEEEEEeCCCCCCc
Q psy104           13 TTIEKKSMDIEERGVKLRLTVVDTPGFGDS   42 (86)
Q Consensus        13 ~~I~~~~~~l~e~~~~l~LtIidTpGfGd~   42 (86)
                      .++......++.++  .+++++||||+.+.
T Consensus        50 ~ti~~~~~~~~~~~--~~i~liDTPG~~~f   77 (237)
T cd04168          50 ITIFSAVASFQWED--TKVNLIDTPGHMDF   77 (237)
T ss_pred             CceeeeeEEEEECC--EEEEEEeCCCccch
Confidence            34444444555444  56889999999764


No 43 
>TIGR00436 era GTP-binding protein Era. Era is an essential GTPase in Escherichia coli and many other bacteria. It plays a role in ribosome biogenesis. Few bacteria lack this protein.
Probab=76.31  E-value=11  Score=26.63  Aligned_cols=13  Identities=38%  Similarity=0.940  Sum_probs=10.8

Q ss_pred             EEEEEeCCCCCCc
Q psy104           30 RLTVVDTPGFGDS   42 (86)
Q Consensus        30 ~LtIidTpGfGd~   42 (86)
                      .+.++||||+...
T Consensus        49 qii~vDTPG~~~~   61 (270)
T TIGR00436        49 QIIFIDTPGFHEK   61 (270)
T ss_pred             EEEEEECcCCCCC
Confidence            5889999999754


No 44 
>cd04122 Rab14 Rab14 subfamily.  Rab14 GTPases are localized to biosynthetic compartments, including the rough ER, the Golgi complex, and the trans-Golgi network, and to endosomal compartments, including early endosomal vacuoles and associated vesicles.  Rab14 is believed to function in both the biosynthetic and recycling pathways between the Golgi and endosomal compartments.  Rab14 has also been identified on GLUT4 vesicles, and has been suggested to help regulate GLUT4 translocation.  In addition, Rab14 is believed to play a role in the regulation of phagocytosis.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GT
Probab=76.00  E-value=11  Score=24.10  Aligned_cols=18  Identities=44%  Similarity=0.663  Sum_probs=13.9

Q ss_pred             EeecCeEEEEEEEeCCCC
Q psy104           22 IEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        22 l~e~~~~l~LtIidTpGf   39 (86)
                      +.-++..++|.+.||||-
T Consensus        44 ~~~~~~~~~l~i~Dt~G~   61 (166)
T cd04122          44 IEVNGQKIKLQIWDTAGQ   61 (166)
T ss_pred             EEECCEEEEEEEEECCCc
Confidence            344566889999999984


No 45 
>cd04106 Rab23_lke Rab23-like subfamily.  Rab23 is a member of the Rab family of small GTPases. In mouse, Rab23 has been shown to function as a negative regulator in the sonic hedgehog (Shh) signalling pathway. Rab23 mediates the activity of Gli2 and Gli3, transcription factors that regulate Shh signaling in the spinal cord, primarily by preventing Gli2 activation in the absence of Shh ligand. Rab23 also regulates a step in the cytoplasmic signal transduction pathway that mediates the effect of Smoothened (one of two integral membrane proteins that are essential components of the Shh signaling pathway in vertebrates). In humans, Rab23 is expressed in the retina.  Mice contain an isoform that shares 93% sequence identity with the human Rab23 and an alternative splicing isoform that is specific to the brain. This isoform causes the murine open brain phenotype, indicating it may have a role in the development of the central nervous system.  GTPase activating proteins (GAPs) interact with G
Probab=75.84  E-value=7.1  Score=24.52  Aligned_cols=23  Identities=26%  Similarity=0.387  Sum_probs=16.5

Q ss_pred             EEEEEEeecCeEEEEEEEeCCCC
Q psy104           17 KKSMDIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        17 ~~~~~l~e~~~~l~LtIidTpGf   39 (86)
                      ...+.+...+..++|.+.||||-
T Consensus        39 ~~~~~~~~~~~~~~~~i~D~~G~   61 (162)
T cd04106          39 EKQIFLRQSDEDVRLMLWDTAGQ   61 (162)
T ss_pred             EEEEEEcCCCCEEEEEEeeCCch
Confidence            34445554467899999999993


No 46 
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily.  Rab34, found primarily in the Golgi, interacts with its effector, Rab-interacting lysosomal protein (RILP). This enables its participation in microtubular dynenin-dynactin-mediated repositioning of lysosomes from the cell periphery to the Golgi. A Rab34 (Rah) isoform that lacks the consensus GTP-binding region has been identified in mice.  This isoform is associated with membrane ruffles and promotes macropinosome formation.  Rab36 has been mapped to human chromosome 22q11.2, a region that is homozygously deleted in malignant rhabdoid tumors (MRTs). However, experimental assessments do not implicate Rab36 as a tumor suppressor that would enable tumor formation through a loss-of-function mechanism.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further re
Probab=75.76  E-value=12  Score=24.34  Aligned_cols=31  Identities=26%  Similarity=0.261  Sum_probs=19.4

Q ss_pred             CcceEEEEEEEEEeecCeEEEEEEEeCCCCC
Q psy104           10 GKTTTIEKKSMDIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        10 ~~t~~I~~~~~~l~e~~~~l~LtIidTpGfG   40 (86)
                      ..|.........+.-+|..++|.+.||||.-
T Consensus        30 ~~t~~~~~~~~~~~~~~~~~~l~i~Dt~G~~   60 (170)
T cd04108          30 KATIGVDFEMERFEILGVPFSLQLWDTAGQE   60 (170)
T ss_pred             CCceeeEEEEEEEEECCEEEEEEEEeCCChH
Confidence            3444333333334445778999999999954


No 47 
>cd04163 Era Era subfamily.  Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria.  It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA.  It also contacts several assembly elements of the 30S subunit.  Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism.  Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding.  Both domains are important for Era function.  Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA.
Probab=75.22  E-value=2.6  Score=26.03  Aligned_cols=16  Identities=31%  Similarity=0.549  Sum_probs=12.6

Q ss_pred             EEEEEEEeCCCCCCcc
Q psy104           28 KLRLTVVDTPGFGDSI   43 (86)
Q Consensus        28 ~l~LtIidTpGfGd~i   43 (86)
                      ...+.++||||+++..
T Consensus        50 ~~~~~liDtpG~~~~~   65 (168)
T cd04163          50 DAQIIFVDTPGIHKPK   65 (168)
T ss_pred             CeEEEEEECCCCCcch
Confidence            4678899999998543


No 48 
>cd01895 EngA2 EngA2 subfamily.  This CD represents the second GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family.  Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability. A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=74.91  E-value=5.7  Score=24.81  Aligned_cols=14  Identities=29%  Similarity=0.465  Sum_probs=11.2

Q ss_pred             EEEEEeCCCCCCcc
Q psy104           30 RLTVVDTPGFGDSI   43 (86)
Q Consensus        30 ~LtIidTpGfGd~i   43 (86)
                      .++++||||+++..
T Consensus        51 ~~~iiDtpG~~~~~   64 (174)
T cd01895          51 KYTLIDTAGIRRKG   64 (174)
T ss_pred             eEEEEECCCCcccc
Confidence            36799999998664


No 49 
>smart00175 RAB Rab subfamily of small GTPases. Rab GTPases are implicated in vesicle trafficking.
Probab=74.58  E-value=15  Score=22.95  Aligned_cols=29  Identities=31%  Similarity=0.463  Sum_probs=19.0

Q ss_pred             cceEEEEEEEEEeecCeEEEEEEEeCCCC
Q psy104           11 KTTTIEKKSMDIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        11 ~t~~I~~~~~~l~e~~~~l~LtIidTpGf   39 (86)
                      ++.........+.-++-.+++.++||||-
T Consensus        31 ~~~~~~~~~~~~~~~~~~~~~~l~D~~G~   59 (164)
T smart00175       31 STIGVDFKTKTIEVDGKRVKLQIWDTAGQ   59 (164)
T ss_pred             CceeeEEEEEEEEECCEEEEEEEEECCCh
Confidence            34444444444555666788999999995


No 50 
>cd04112 Rab26 Rab26 subfamily.  First identified in rat pancreatic acinar cells, Rab26 is believed to play a role in recruiting mature granules to the plasma membrane upon beta-adrenergic stimulation.  Rab26 belongs to the Rab functional group III, which are considered key regulators of intracellular vesicle transport during exocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=73.92  E-value=9.6  Score=25.21  Aligned_cols=17  Identities=41%  Similarity=0.728  Sum_probs=13.7

Q ss_pred             EeecCeEEEEEEEeCCC
Q psy104           22 IEERGVKLRLTVVDTPG   38 (86)
Q Consensus        22 l~e~~~~l~LtIidTpG   38 (86)
                      +.-++..+.|+|.||||
T Consensus        43 ~~~~~~~~~~~i~Dt~G   59 (191)
T cd04112          43 VTVDGVKVKLQIWDTAG   59 (191)
T ss_pred             EEECCEEEEEEEEeCCC
Confidence            44456789999999999


No 51 
>KOG0462|consensus
Probab=73.56  E-value=5  Score=32.74  Aligned_cols=30  Identities=33%  Similarity=0.509  Sum_probs=20.2

Q ss_pred             ceEEEEEEEEE-eecCeEEEEEEEeCCCCCC
Q psy104           12 TTTIEKKSMDI-EERGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        12 t~~I~~~~~~l-~e~~~~l~LtIidTpGfGd   41 (86)
                      .+.|...+..+ =.+|-...|++|||||=-|
T Consensus       107 GITIkaQtasify~~~~~ylLNLIDTPGHvD  137 (650)
T KOG0462|consen  107 GITIKAQTASIFYKDGQSYLLNLIDTPGHVD  137 (650)
T ss_pred             CcEEEeeeeEEEEEcCCceEEEeecCCCccc
Confidence            44555555533 2448889999999999543


No 52 
>PF03193 DUF258:  Protein of unknown function, DUF258;  InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis. RsgA is an unusual circulary permuted GTPase that catalyzes rapid hydrolysis of GTP with a slow catalytic turnover. It is dispensible for viability, but important for overall fitness. The intrinsic GTPase activity is stimulated by the presence of 30S (160-fold increase in kcat) or 70S (96 fold increase in kcat) ribosomes []. The GTPase is inhibited by aminoglycoside antibiotics such as neomycin and paromycin [] streptomycin and spectinomycin []. This inhibition is not due to competition for binding sites on the 30S or 70S ribosome []. ; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 2YKR_W 2YV5_A 1T9H_A 2RCN_A 4A2I_V 1U0L_B.
Probab=73.15  E-value=0.59  Score=31.72  Aligned_cols=11  Identities=45%  Similarity=0.890  Sum_probs=8.7

Q ss_pred             EEEeCCCCCCc
Q psy104           32 TVVDTPGFGDS   42 (86)
Q Consensus        32 tIidTpGfGd~   42 (86)
                      -|||||||.+.
T Consensus        90 ~iIDTPGf~~~  100 (161)
T PF03193_consen   90 YIIDTPGFRSF  100 (161)
T ss_dssp             EEECSHHHHT-
T ss_pred             EEEECCCCCcc
Confidence            59999999754


No 53 
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane]
Probab=72.90  E-value=5.8  Score=31.99  Aligned_cols=31  Identities=29%  Similarity=0.557  Sum_probs=22.4

Q ss_pred             cceEEEEEEEEEe---ecCeEEEEEEEeCCCCCC
Q psy104           11 KTTTIEKKSMDIE---ERGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        11 ~t~~I~~~~~~l~---e~~~~l~LtIidTpGfGd   41 (86)
                      ....|....+.+.   .+|-.+.|++|||||==|
T Consensus        55 RGITIKaq~v~l~Yk~~~g~~Y~lnlIDTPGHVD   88 (603)
T COG0481          55 RGITIKAQAVRLNYKAKDGETYVLNLIDTPGHVD   88 (603)
T ss_pred             cCceEEeeEEEEEEEeCCCCEEEEEEcCCCCccc
Confidence            3456666666553   677899999999999643


No 54 
>cd01866 Rab2 Rab2 subfamily.  Rab2 is localized on cis-Golgi membranes and interacts with Golgi matrix proteins. Rab2 is also implicated in the maturation of vesicular tubular clusters (VTCs), which are microtubule-associated intermediates in transport between the ER and Golgi apparatus. In plants, Rab2 regulates vesicle trafficking between the ER and the Golgi bodies and is important to pollen tube growth.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key featur
Probab=72.47  E-value=15  Score=23.59  Aligned_cols=20  Identities=30%  Similarity=0.403  Sum_probs=14.8

Q ss_pred             EEEeecCeEEEEEEEeCCCC
Q psy104           20 MDIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        20 ~~l~e~~~~l~LtIidTpGf   39 (86)
                      ..+.-++..+.+++.||||-
T Consensus        44 ~~~~~~~~~~~~~i~Dt~G~   63 (168)
T cd01866          44 RMITIDGKQIKLQIWDTAGQ   63 (168)
T ss_pred             EEEEECCEEEEEEEEECCCc
Confidence            34444566789999999993


No 55 
>cd01884 EF_Tu EF-Tu subfamily.  This subfamily includes orthologs of translation elongation factor EF-Tu in bacteria, mitochondria, and chloroplasts.  It is one of several GTP-binding translation factors found in the larger family of GTP-binding elongation factors.  The eukaryotic counterpart, eukaryotic translation elongation factor 1 (eEF-1 alpha), is excluded from this family.  EF-Tu is one of the most abundant proteins in bacteria, as well as, one of the most highly conserved, and in a number of species the gene is duplicated with identical function.  When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors.  Transfer RNA is carried to the ribosome in these complexes for protein translation.
Probab=72.39  E-value=4.8  Score=27.49  Aligned_cols=28  Identities=29%  Similarity=0.430  Sum_probs=17.2

Q ss_pred             ceEEEEEEEEEeecCeEEEEEEEeCCCCCC
Q psy104           12 TTTIEKKSMDIEERGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        12 t~~I~~~~~~l~e~~~~l~LtIidTpGfGd   41 (86)
                      ..++......++.++  -.++++||||+.+
T Consensus        50 g~Ti~~~~~~~~~~~--~~i~~iDtPG~~~   77 (195)
T cd01884          50 GITINTAHVEYETAN--RHYAHVDCPGHAD   77 (195)
T ss_pred             CccEEeeeeEecCCC--eEEEEEECcCHHH
Confidence            344444444454443  3678999999864


No 56 
>TIGR00231 small_GTP small GTP-binding protein domain. This model recognizes a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model.
Probab=72.20  E-value=13  Score=22.35  Aligned_cols=19  Identities=37%  Similarity=0.622  Sum_probs=14.2

Q ss_pred             EeecCeEEEEEEEeCCCCC
Q psy104           22 IEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        22 l~e~~~~l~LtIidTpGfG   40 (86)
                      +..++..+.+.++||||..
T Consensus        43 ~~~~~~~~~~~~~D~~G~~   61 (161)
T TIGR00231        43 IEEDGKTYKFNLLDTAGQE   61 (161)
T ss_pred             EEECCEEEEEEEEECCCcc
Confidence            4445556889999999954


No 57 
>cd01856 YlqF YlqF.  Proteins of the YlqF family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. The YlqF subfamily is represented in a phylogenetically diverse array of bacteria (including gram-positive bacteria, proteobacteria, Synechocystis, Borrelia, and Thermotoga) and in all eukaryotes.
Probab=71.57  E-value=2.7  Score=27.65  Aligned_cols=12  Identities=33%  Similarity=0.534  Sum_probs=9.9

Q ss_pred             EEEEEEeCCCCC
Q psy104           29 LRLTVVDTPGFG   40 (86)
Q Consensus        29 l~LtIidTpGfG   40 (86)
                      ..+.|+||||+.
T Consensus       160 ~~~~~iDtpG~~  171 (171)
T cd01856         160 PGIYLLDTPGIL  171 (171)
T ss_pred             CCEEEEECCCCC
Confidence            467899999983


No 58 
>cd04124 RabL2 RabL2 subfamily.  RabL2 (Rab-like2) subfamily.  RabL2s are novel Rab proteins identified recently which display features that are distinct from other Rabs, and have been termed Rab-like. RabL2 contains RabL2a and RabL2b, two very similar Rab proteins that share  98% sequence identity in humans. RabL2b maps to the subtelomeric region of chromosome 22q13.3 and RabL2a maps to 2q13, a region that suggests it is also a subtelomeric gene. Both genes are believed to be expressed ubiquitously, suggesting that RabL2s are the first example of duplicated genes in human proximal subtelomeric regions that are both expressed actively. Like other Rab-like proteins, RabL2s lack a prenylation site at the C-terminus. The specific functions of RabL2a and RabL2b remain unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-b
Probab=71.48  E-value=18  Score=23.00  Aligned_cols=29  Identities=17%  Similarity=0.154  Sum_probs=18.2

Q ss_pred             ceEEEEEEEEEeecCeEEEEEEEeCCCCC
Q psy104           12 TTTIEKKSMDIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        12 t~~I~~~~~~l~e~~~~l~LtIidTpGfG   40 (86)
                      +.....+...+.-++..+.|.+.||||.-
T Consensus        32 ~~~~~~~~~~~~~~~~~~~~~i~Dt~G~~   60 (161)
T cd04124          32 TYALTLYKHNAKFEGKTILVDFWDTAGQE   60 (161)
T ss_pred             ceeeEEEEEEEEECCEEEEEEEEeCCCch
Confidence            33333333333444667899999999953


No 59 
>cd01849 YlqF_related_GTPase YlqF-related GTPases.  These proteins are found in bacteria, eukaryotes, and archaea.  They all exhibit a circular permutation of the GTPase signature motifs so that the order of the conserved G box motifs is G4-G5-G1-G2-G3, with G4 and G5 being permuted from the C-terminal region of proteins in the Ras superfamily to the N-terminus of YlqF-related GTPases.
Probab=71.32  E-value=2.7  Score=27.18  Aligned_cols=10  Identities=40%  Similarity=1.052  Sum_probs=8.8

Q ss_pred             EEEEEeCCCC
Q psy104           30 RLTVVDTPGF   39 (86)
Q Consensus        30 ~LtIidTpGf   39 (86)
                      .+.++||||+
T Consensus       146 ~~~liDtPG~  155 (155)
T cd01849         146 KIKLLDTPGI  155 (155)
T ss_pred             CEEEEECCCC
Confidence            5789999997


No 60 
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA. This bacterial (and Arabidopsis) protein, termed TypA or BipA, a GTP-binding protein, is phosphorylated on a tyrosine residue under some cellular conditions. Mutants show altered regulation of some pathways, but the precise function is unknown.
Probab=71.02  E-value=4.6  Score=32.48  Aligned_cols=29  Identities=38%  Similarity=0.556  Sum_probs=19.8

Q ss_pred             ceEEEEEEEEEeecCeEEEEEEEeCCCCCCc
Q psy104           12 TTTIEKKSMDIEERGVKLRLTVVDTPGFGDS   42 (86)
Q Consensus        12 t~~I~~~~~~l~e~~~~l~LtIidTpGfGd~   42 (86)
                      ..+|......+.-++  .+++++||||..|.
T Consensus        49 GiTI~~~~~~v~~~~--~kinlIDTPGh~DF   77 (594)
T TIGR01394        49 GITILAKNTAIRYNG--TKINIVDTPGHADF   77 (594)
T ss_pred             CccEEeeeEEEEECC--EEEEEEECCCHHHH
Confidence            455555555555554  67889999998764


No 61 
>cd04116 Rab9 Rab9 subfamily.  Rab9 is found in late endosomes, together with mannose 6-phosphate receptors (MPRs) and the tail-interacting protein of 47 kD (TIP47).  Rab9 is a key mediator of vesicular transport from late endosomes to the trans-Golgi network (TGN) by redirecting the MPRs.  Rab9 has been identified as a key component for the replication of several viruses, including HIV1, Ebola, Marburg, and measles, making it a potential target for inhibiting a variety of viruses.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CX
Probab=70.88  E-value=18  Score=22.95  Aligned_cols=27  Identities=33%  Similarity=0.396  Sum_probs=17.6

Q ss_pred             ceEEEEEEEEEeecCeEEEEEEEeCCC
Q psy104           12 TTTIEKKSMDIEERGVKLRLTVVDTPG   38 (86)
Q Consensus        12 t~~I~~~~~~l~e~~~~l~LtIidTpG   38 (86)
                      +.........+.-++-.++|.+.||||
T Consensus        37 ~~~~~~~~~~~~~~~~~~~l~i~D~~G   63 (170)
T cd04116          37 TIGVEFLNKDLEVDGHFVTLQIWDTAG   63 (170)
T ss_pred             ceeeEEEEEEEEECCeEEEEEEEeCCC
Confidence            333333333444566788999999998


No 62 
>TIGR00157 ribosome small subunit-dependent GTPase A. The Aquifex aeolicus ortholog is split into consecutive open reading frames. Consequently, this model was build in fragment mode (-f option).
Probab=70.88  E-value=5.1  Score=28.37  Aligned_cols=10  Identities=50%  Similarity=1.112  Sum_probs=8.5

Q ss_pred             EEEeCCCCCC
Q psy104           32 TVVDTPGFGD   41 (86)
Q Consensus        32 tIidTpGfGd   41 (86)
                      -|+|||||-.
T Consensus       174 ~liDtPG~~~  183 (245)
T TIGR00157       174 LIADTPGFNE  183 (245)
T ss_pred             EEEeCCCccc
Confidence            5999999964


No 63 
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-like superfamily of small GTPases consists of several families with an extremely high degree of structural and functional similarity. The Ras superfamily is divided into at least four families in eukaryotes: the Ras, Rho, Rab, and Sar1/Arf families.  This superfamily also includes proteins like the GTP translation factors, Era-like GTPases, and G-alpha chain of the heterotrimeric G proteins.  Members of the Ras superfamily regulate a wide variety of cellular functions: the Ras family regulates gene expression, the Rho family regulates cytoskeletal reorganization and gene expression, the Rab and Sar1/Arf families regulate vesicle trafficking, and the Ran family regulates nucleocytoplasmic transport and microtubule organization. The GTP translation factor family regulate initiation, elongation, termination, and release in translation, and the Era-like GTPase family regulates cell division, sporulation, and DNA replication. Memb
Probab=70.56  E-value=9.1  Score=22.57  Aligned_cols=29  Identities=34%  Similarity=0.344  Sum_probs=20.8

Q ss_pred             EEEEEEEEeecCeEEEEEEEeCCCCCCcc
Q psy104           15 IEKKSMDIEERGVKLRLTVVDTPGFGDSI   43 (86)
Q Consensus        15 I~~~~~~l~e~~~~l~LtIidTpGfGd~i   43 (86)
                      +..........+....++++||||..+..
T Consensus        31 ~~~~~~~~~~~~~~~~~~l~D~~g~~~~~   59 (157)
T cd00882          31 IDFYSKTIEVDGKKVKLQIWDTAGQERFR   59 (157)
T ss_pred             hheeeEEEEECCEEEEEEEEecCChHHHH
Confidence            55555555655667899999999977544


No 64 
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases. Ran is involved in the active transport of proteins through nuclear pores.
Probab=70.21  E-value=19  Score=24.54  Aligned_cols=31  Identities=23%  Similarity=0.222  Sum_probs=21.1

Q ss_pred             CcceEEEEEEEEEeecCeEEEEEEEeCCCCC
Q psy104           10 GKTTTIEKKSMDIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        10 ~~t~~I~~~~~~l~e~~~~l~LtIidTpGfG   40 (86)
                      .+|+.+...+..+.-++-.++|.|.||+|-.
T Consensus        25 ~~Tig~~~~~~~~~~~~~~~~l~iwDt~G~e   55 (200)
T smart00176       25 VATLGVEVHPLVFHTNRGPIRFNVWDTAGQE   55 (200)
T ss_pred             CCceeEEEEEEEEEECCEEEEEEEEECCCch
Confidence            3455555555555545568999999999964


No 65 
>cd01886 EF-G Elongation factor G (EF-G) subfamily.  Translocation is mediated by EF-G (also called translocase).  The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA.  This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule.  EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit.  The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit.  To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it.  The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well.  The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site.  This group conta
Probab=70.14  E-value=9.1  Score=27.55  Aligned_cols=30  Identities=27%  Similarity=0.391  Sum_probs=19.2

Q ss_pred             cceEEEEEEEEEeecCeEEEEEEEeCCCCCCc
Q psy104           11 KTTTIEKKSMDIEERGVKLRLTVVDTPGFGDS   42 (86)
Q Consensus        11 ~t~~I~~~~~~l~e~~~~l~LtIidTpGfGd~   42 (86)
                      ...++......++-++  .+++++||||..+.
T Consensus        48 rgiti~~~~~~~~~~~--~~i~liDTPG~~df   77 (270)
T cd01886          48 RGITIQSAATTCFWKD--HRINIIDTPGHVDF   77 (270)
T ss_pred             CCcCeeccEEEEEECC--EEEEEEECCCcHHH
Confidence            3455555555555554  46778999998653


No 66 
>cd01890 LepA LepA subfamily.  LepA belongs to the GTPase family of and exhibits significant homology to the translation factors EF-G and EF-Tu, indicating its possible involvement in translation and association with the ribosome.  LepA is ubiquitous in bacteria and eukaryota (e.g. yeast GUF1p), but is missing from archaea.  This pattern of phyletic distribution suggests that LepA evolved through a duplication of the EF-G gene in bacteria, followed by early transfer into the eukaryotic lineage, most likely from the promitochondrial endosymbiont.  Yeast GUF1p is not essential and mutant cells did not reveal any marked phenotype.
Probab=69.83  E-value=9.7  Score=24.42  Aligned_cols=17  Identities=41%  Similarity=0.704  Sum_probs=13.3

Q ss_pred             cCeEEEEEEEeCCCCCC
Q psy104           25 RGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        25 ~~~~l~LtIidTpGfGd   41 (86)
                      ++-.+.|+++||||.-+
T Consensus        63 ~~~~~~~~l~Dt~G~~~   79 (179)
T cd01890          63 DGQEYLLNLIDTPGHVD   79 (179)
T ss_pred             CCCcEEEEEEECCCChh
Confidence            34467899999999864


No 67 
>PLN03071 GTP-binding nuclear protein Ran; Provisional
Probab=69.59  E-value=16  Score=25.12  Aligned_cols=32  Identities=25%  Similarity=0.255  Sum_probs=22.0

Q ss_pred             CcceEEEEEEEEEeecCeEEEEEEEeCCCCCC
Q psy104           10 GKTTTIEKKSMDIEERGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        10 ~~t~~I~~~~~~l~e~~~~l~LtIidTpGfGd   41 (86)
                      .+|+.+..+...+.-++-.++|.+.||||-..
T Consensus        43 ~~tig~~~~~~~~~~~~~~~~l~i~Dt~G~~~   74 (219)
T PLN03071         43 EPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEK   74 (219)
T ss_pred             CCccceeEEEEEEEECCeEEEEEEEECCCchh
Confidence            45555555555555555679999999999653


No 68 
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability.
Probab=69.12  E-value=8.2  Score=28.92  Aligned_cols=12  Identities=25%  Similarity=0.606  Sum_probs=10.2

Q ss_pred             EEEEEeCCCCCC
Q psy104           30 RLTVVDTPGFGD   41 (86)
Q Consensus        30 ~LtIidTpGfGd   41 (86)
                      .++++||||++.
T Consensus        48 ~~~liDTpG~~~   59 (429)
T TIGR03594        48 EFILIDTGGIEE   59 (429)
T ss_pred             EEEEEECCCCCC
Confidence            589999999963


No 69 
>PLN03118 Rab family protein; Provisional
Probab=68.94  E-value=18  Score=24.29  Aligned_cols=19  Identities=37%  Similarity=0.588  Sum_probs=14.1

Q ss_pred             EEeecCeEEEEEEEeCCCC
Q psy104           21 DIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        21 ~l~e~~~~l~LtIidTpGf   39 (86)
                      .+.-++..++|.++||||.
T Consensus        54 ~~~~~~~~~~l~l~Dt~G~   72 (211)
T PLN03118         54 QLTVGGKRLKLTIWDTAGQ   72 (211)
T ss_pred             EEEECCEEEEEEEEECCCc
Confidence            3344456788999999995


No 70 
>PRK00089 era GTPase Era; Reviewed
Probab=68.76  E-value=23  Score=25.17  Aligned_cols=15  Identities=33%  Similarity=0.574  Sum_probs=12.1

Q ss_pred             EEEEEEeCCCCCCcc
Q psy104           29 LRLTVVDTPGFGDSI   43 (86)
Q Consensus        29 l~LtIidTpGfGd~i   43 (86)
                      ..+.++||||+.+..
T Consensus        53 ~qi~~iDTPG~~~~~   67 (292)
T PRK00089         53 AQIIFVDTPGIHKPK   67 (292)
T ss_pred             ceEEEEECCCCCCch
Confidence            678999999997543


No 71 
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1.  Four of these groups (Obg, DRG, YyaF/YchF, and Ygr210) are characterized by a distinct glycine-rich motif immediately following the Walker B motif (G3 box).  Obg/CgtA is an essential gene that is involved in the initiation of sporulation and DNA replication in the bacteria Caulobacter and Bacillus, but its exact molecular role is unknown.  Furthermore, several OBG family members possess a C-terminal RNA-binding domain, the TGS domain, which is also present in threonyl-tRNA synthetase and in bacterial guanosine polyphosphatase SpoT.  Nog1 is a nucleolar protein that might function in ribosome assembly.  The DRG and Nog1 subfamilies are ubiquitous in archaea and eukaryotes, the Ygr210 subfamily is present in archaea and fungi, and the Obg and YyaF/YchF subfamilies are ubiquitous in bacteria and eukaryotes. The Obg/Nog1 and DRG subfamilies appear to 
Probab=68.53  E-value=3.3  Score=26.30  Aligned_cols=13  Identities=38%  Similarity=0.726  Sum_probs=10.5

Q ss_pred             EEEEEEeCCCCCC
Q psy104           29 LRLTVVDTPGFGD   41 (86)
Q Consensus        29 l~LtIidTpGfGd   41 (86)
                      ..+.++||||+.+
T Consensus        44 ~~~~i~DtpG~~~   56 (176)
T cd01881          44 ARIQVADIPGLIE   56 (176)
T ss_pred             CeEEEEeccccch
Confidence            4578999999964


No 72 
>cd04104 p47_IIGP_like p47 (47-kDa) family.  The p47 GTPase family consists of several highly homologous proteins, including IGTP, TGTP/Mg21, IRG-47, GTPI, LRG-47, and IIGP1.  They are found in higher eukaryotes where they play a role in immune resistance against intracellular pathogens.  p47 proteins exist at low resting levels in mouse cells, but are strongly induced by Type II interferon (IFN-gamma).  ITGP is critical for resistance to Toxoplasma gondii infection and in involved in inhibition of Coxsackievirus-B3-induced apoptosis.  TGTP was shown to limit vesicular stomatitis virus (VSV) infection of fibroblasts in vitro.  IRG-47 is involved in resistance to T. gondii infection.  LRG-47 has been implicated in resistance to T. gondii, Listeria monocytogenes, Leishmania, and mycobacterial infections.  IIGP1 has been shown to localize to the ER and to the Golgi membranes in IFN-induced cells and inflamed tissues.  In macrophages, IIGP1 interacts with hook3, a microtubule binding protei
Probab=68.52  E-value=2.7  Score=28.36  Aligned_cols=14  Identities=36%  Similarity=0.684  Sum_probs=11.9

Q ss_pred             EEEEEEeCCCCCCc
Q psy104           29 LRLTVVDTPGFGDS   42 (86)
Q Consensus        29 l~LtIidTpGfGd~   42 (86)
                      -.++++||||+|+.
T Consensus        52 ~~l~l~DtpG~~~~   65 (197)
T cd04104          52 PNVTLWDLPGIGST   65 (197)
T ss_pred             CCceEEeCCCCCcc
Confidence            37899999999964


No 73 
>cd01889 SelB_euk SelB subfamily.  SelB is an elongation factor needed for the co-translational incorporation of selenocysteine.  Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin.  In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu).  It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner.  This allows insertion of selenocysteine at in-frame UGA stop codons.  In E. coli SelB binds GTP, selenocysteyl-tRNAsec and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence).  The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation.  Archaeal and animal mechanisms of selenocysteine incorporation are more complex.  Although the SECIS elements have different secondary structures and conserved elements between archaea and euk
Probab=68.22  E-value=6.3  Score=26.14  Aligned_cols=13  Identities=46%  Similarity=0.912  Sum_probs=11.0

Q ss_pred             EEEEEEEeCCCCC
Q psy104           28 KLRLTVVDTPGFG   40 (86)
Q Consensus        28 ~l~LtIidTpGfG   40 (86)
                      ...++++||||..
T Consensus        67 ~~~~~i~DtpG~~   79 (192)
T cd01889          67 NLQITLVDCPGHA   79 (192)
T ss_pred             CceEEEEECCCcH
Confidence            5688999999974


No 74 
>PRK00093 GTP-binding protein Der; Reviewed
Probab=68.00  E-value=17  Score=27.33  Aligned_cols=13  Identities=23%  Similarity=0.416  Sum_probs=11.6

Q ss_pred             EEEEEEeCCCCCC
Q psy104           29 LRLTVVDTPGFGD   41 (86)
Q Consensus        29 l~LtIidTpGfGd   41 (86)
                      ..+.++||||+.+
T Consensus        49 ~~~~liDT~G~~~   61 (435)
T PRK00093         49 REFILIDTGGIEP   61 (435)
T ss_pred             cEEEEEECCCCCC
Confidence            6789999999986


No 75 
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis]
Probab=67.89  E-value=7.9  Score=31.97  Aligned_cols=32  Identities=28%  Similarity=0.459  Sum_probs=22.9

Q ss_pred             CcceEEEEEEEEEeecCeEEEEEEEeCCCCCCc
Q psy104           10 GKTTTIEKKSMDIEERGVKLRLTVVDTPGFGDS   42 (86)
Q Consensus        10 ~~t~~I~~~~~~l~e~~~~l~LtIidTpGfGd~   42 (86)
                      ....+|+.....+.=++ ..++++|||||-=|.
T Consensus        58 eRGITI~saa~s~~~~~-~~~iNlIDTPGHVDF   89 (697)
T COG0480          58 ERGITITSAATTLFWKG-DYRINLIDTPGHVDF   89 (697)
T ss_pred             hcCCEEeeeeeEEEEcC-ceEEEEeCCCCcccc
Confidence            44667777777665444 688999999997443


No 76 
>cd04130 Wrch_1 Wrch-1 subfamily.  Wrch-1 (Wnt-1 responsive Cdc42 homolog) is a Rho family GTPase that shares significant sequence and functional similarity with Cdc42.  Wrch-1 was first identified in mouse mammary epithelial cells, where its transcription is upregulated in Wnt-1 transformation.  Wrch-1 contains N- and C-terminal extensions relative to cdc42, suggesting potential differences in cellular localization and function.  The Wrch-1 N-terminal extension contains putative SH3 domain-binding motifs and has been shown to bind the SH3 domain-containing protein Grb2, which increases the level of active Wrch-1 in cells.  Unlike Cdc42, which localizes to the cytosol and perinuclear membranes, Wrch-1 localizes extensively with the plasma membrane and endosomes.  The membrane association, localization, and biological activity of Wrch-1 indicate an atypical model of regulation distinct from other Rho family GTPases.  Most Rho proteins contain a lipid modification site at the C-terminus, 
Probab=67.80  E-value=20  Score=23.07  Aligned_cols=21  Identities=29%  Similarity=0.398  Sum_probs=15.6

Q ss_pred             EEEeecCeEEEEEEEeCCCCC
Q psy104           20 MDIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        20 ~~l~e~~~~l~LtIidTpGfG   40 (86)
                      ..+.-++..+++.+.||||..
T Consensus        39 ~~~~~~~~~~~~~i~Dt~G~~   59 (173)
T cd04130          39 VVVLVDGKPVRLQLCDTAGQD   59 (173)
T ss_pred             EEEEECCEEEEEEEEECCCCh
Confidence            344445678999999999964


No 77 
>cd01862 Rab7 Rab7 subfamily.  Rab7 is a small Rab GTPase that regulates vesicular traffic from early to late endosomal stages of the endocytic pathway.  The yeast Ypt7 and mammalian Rab7 are both involved in transport to the vacuole/lysosome, whereas Ypt7 is also required for homotypic vacuole fusion.  Mammalian Rab7 is an essential participant in the autophagic pathway for sequestration and targeting of cytoplasmic components to the lytic compartment. Mammalian Rab7 is also proposed to function as a tumor suppressor. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-
Probab=67.74  E-value=22  Score=22.39  Aligned_cols=19  Identities=21%  Similarity=0.246  Sum_probs=14.3

Q ss_pred             EeecCeEEEEEEEeCCCCC
Q psy104           22 IEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        22 l~e~~~~l~LtIidTpGfG   40 (86)
                      +.-++..+.|+++||||..
T Consensus        42 ~~~~~~~~~~~~~D~~g~~   60 (172)
T cd01862          42 VTVDDKLVTLQIWDTAGQE   60 (172)
T ss_pred             EEECCEEEEEEEEeCCChH
Confidence            3444567899999999964


No 78 
>cd04118 Rab24 Rab24 subfamily.  Rab24 is distinct from other Rabs in several ways.  It exists primarily in the GTP-bound state, having a low intrinsic GTPase activity; it is not efficiently geranyl-geranylated at the C-terminus; it does not form a detectable complex with Rab GDP-dissociation inhibitors (GDIs); and it has recently been shown to undergo tyrosine phosphorylation when overexpressed in vitro. The specific function of Rab24 still remains unknown. It is found in a transport route between ER-cis-Golgi and late endocytic compartments.  It is putatively involved in an autophagic pathway, possibly directing misfolded proteins in the ER to degradative pathways.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilita
Probab=67.67  E-value=21  Score=23.29  Aligned_cols=20  Identities=20%  Similarity=0.142  Sum_probs=15.6

Q ss_pred             EEeecCeEEEEEEEeCCCCC
Q psy104           21 DIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        21 ~l~e~~~~l~LtIidTpGfG   40 (86)
                      .+.-++..++|.+.||||--
T Consensus        42 ~~~~~~~~~~l~i~D~~G~~   61 (193)
T cd04118          42 RMVVGERVVTLGIWDTAGSE   61 (193)
T ss_pred             EEEECCEEEEEEEEECCCch
Confidence            44556778999999999953


No 79 
>cd04169 RF3 RF3 subfamily.  Peptide chain release factor 3 (RF3) is a protein involved in the termination step of translation in bacteria.  Termination occurs when class I release factors (RF1 or RF2) recognize the stop codon at the A-site of the ribosome and activate the release of the nascent polypeptide.  The class II release factor RF3 then initiates the release of the class I RF from the ribosome.  RF3 binds to the RF/ribosome complex in the inactive (GDP-bound) state.  GDP/GTP exchange occurs, followed by the release of the class I RF.  Subsequent hydrolysis of GTP to GDP triggers the release of RF3 from the ribosome.  RF3 also enhances the efficiency of class I RFs at less preferred stop codons and at stop codons in weak contexts.
Probab=67.54  E-value=9  Score=27.50  Aligned_cols=28  Identities=29%  Similarity=0.507  Sum_probs=18.6

Q ss_pred             ceEEEEEEEEEeecCeEEEEEEEeCCCCCC
Q psy104           12 TTTIEKKSMDIEERGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        12 t~~I~~~~~~l~e~~~~l~LtIidTpGfGd   41 (86)
                      ..+|......++-++  .+++++||||..+
T Consensus        56 g~si~~~~~~~~~~~--~~i~liDTPG~~d   83 (267)
T cd04169          56 GISVTSSVMQFEYRD--CVINLLDTPGHED   83 (267)
T ss_pred             CCCeEEEEEEEeeCC--EEEEEEECCCchH
Confidence            445555555565554  5678899999764


No 80 
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily.  Rab33B is ubiquitously expressed in mouse tissues and cells, where it is localized to the medial Golgi cisternae. It colocalizes with alpha-mannose II.  Together with the other cisternal Rabs, Rab6A and Rab6A', it is believed to regulate the Golgi response to stress and is likely a molecular target in stress-activated signaling pathways. Rab33A (previously known as S10) is expressed primarily in the brain and immune system cells.  In humans, it is located on the X chromosome at Xq26 and its expression is down-regulated in tuberculosis patients. Experimental evidence suggests that Rab33A is a novel CD8+ T cell factor that likely plays a role in tuberculosis disease processes.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine 
Probab=67.44  E-value=24  Score=22.58  Aligned_cols=20  Identities=25%  Similarity=0.473  Sum_probs=14.8

Q ss_pred             EEeecCeEEEEEEEeCCCCC
Q psy104           21 DIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        21 ~l~e~~~~l~LtIidTpGfG   40 (86)
                      .+.-++..+.|.|+||||-.
T Consensus        43 ~~~~~~~~~~~~i~Dt~G~~   62 (170)
T cd04115          43 TVEIDGERIKVQLWDTAGQE   62 (170)
T ss_pred             EEEECCeEEEEEEEeCCChH
Confidence            34445667899999999954


No 81 
>cd01859 MJ1464 MJ1464.  This family represents archaeal GTPase typified by the protein MJ1464 from Methanococcus jannaschii. The members of this family show a circular permutation of the GTPase signature motifs so that C-terminal strands 5, 6, and 7 (strands 6 contain the NKxD motif) are relocated to the N terminus.
Probab=67.23  E-value=10  Score=24.20  Aligned_cols=10  Identities=40%  Similarity=0.956  Sum_probs=8.8

Q ss_pred             EEEEEeCCCC
Q psy104           30 RLTVVDTPGF   39 (86)
Q Consensus        30 ~LtIidTpGf   39 (86)
                      .+.++||||+
T Consensus       147 ~~~~~DtpGi  156 (156)
T cd01859         147 KIYLLDTPGV  156 (156)
T ss_pred             CEEEEECcCC
Confidence            5889999996


No 82 
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2.  Rab8/Sec4/Ypt2 are known or suspected to be involved in post-Golgi transport to the plasma membrane. It is likely that these Rabs have functions that are specific to the mammalian lineage and have no orthologs in plants. Rab8 modulates polarized membrane transport through reorganization of actin and microtubules, induces the formation of new surface extensions, and has an important role in directed membrane transport to cell surfaces. The Ypt2 gene of the fission yeast Schizosaccharomyces pombe encodes a member of the Ypt/Rab family of small GTP-binding proteins, related in sequence to Sec4p of Saccharomyces cerevisiae but closer to mammalian Rab8.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhi
Probab=66.79  E-value=19  Score=22.97  Aligned_cols=19  Identities=42%  Similarity=0.599  Sum_probs=14.4

Q ss_pred             EEeecCeEEEEEEEeCCCC
Q psy104           21 DIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        21 ~l~e~~~~l~LtIidTpGf   39 (86)
                      .+.-++..+.|.+.||||-
T Consensus        44 ~~~~~~~~~~l~l~D~~g~   62 (167)
T cd01867          44 TIELDGKKIKLQIWDTAGQ   62 (167)
T ss_pred             EEEECCEEEEEEEEeCCch
Confidence            3444566789999999993


No 83 
>PF04784 DUF547:  Protein of unknown function, DUF547;  InterPro: IPR006869 This is a conserved region found in uncharacterised proteins from Caenorhabditis elegans and Arabidopsis thaliana (Mouse-ear cress).
Probab=66.49  E-value=3.6  Score=26.09  Aligned_cols=19  Identities=32%  Similarity=0.282  Sum_probs=15.7

Q ss_pred             hcCCccCC---CCCCeeEEeec
Q psy104           67 ESGLNRKN---IVDNREVVDKS   85 (86)
Q Consensus        67 E~~i~R~~---~~D~RVH~Cl~   85 (86)
                      |.++-|.+   ..|.|||.+|+
T Consensus        65 e~~ILR~~~~~~~DprihFaL~   86 (117)
T PF04784_consen   65 EHGILRGNRPPWPDPRIHFALN   86 (117)
T ss_pred             HHhhccCCCCCCCCCceeeeee
Confidence            66777766   89999999986


No 84 
>cd04117 Rab15 Rab15 subfamily.  Rab15 colocalizes with the transferrin receptor in early endosome compartments, but not with late endosomal markers. It codistributes with Rab4 and Rab5 on early/sorting endosomes, and with Rab11 on pericentriolar recycling endosomes. It is believed to function as an inhibitory GTPase that regulates distinct steps in early endocytic trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to
Probab=66.37  E-value=26  Score=22.30  Aligned_cols=31  Identities=32%  Similarity=0.411  Sum_probs=20.6

Q ss_pred             CcceEEEEEEEEEeecCeEEEEEEEeCCCCC
Q psy104           10 GKTTTIEKKSMDIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        10 ~~t~~I~~~~~~l~e~~~~l~LtIidTpGfG   40 (86)
                      .+|.....+...+.-++..++|.+.||||-.
T Consensus        30 ~~t~~~~~~~~~~~~~~~~~~l~i~D~~g~~   60 (161)
T cd04117          30 ISTIGVDFKMKTIEVDGIKVRIQIWDTAGQE   60 (161)
T ss_pred             CCceeeEEEEEEEEECCEEEEEEEEeCCCcH
Confidence            3444444444455556778999999999854


No 85 
>cd00881 GTP_translation_factor GTP translation factor family.  This family consists primarily of translation initiation, elongation, and release factors, which play specific roles in protein translation.  In addition, the family includes Snu114p, a component of the U5 small nuclear riboprotein particle which is a component of the spliceosome and is involved in excision of introns, TetM, a tetracycline resistance gene that protects the ribosome from tetracycline binding, and the unusual subfamily CysN/ATPS, which has an unrelated function (ATP sulfurylase) acquired through lateral transfer of the EF1-alpha gene and development of a new function.
Probab=66.16  E-value=4.2  Score=26.07  Aligned_cols=14  Identities=43%  Similarity=0.802  Sum_probs=11.7

Q ss_pred             EEEEEEEeCCCCCC
Q psy104           28 KLRLTVVDTPGFGD   41 (86)
Q Consensus        28 ~l~LtIidTpGfGd   41 (86)
                      ...+.++||||+++
T Consensus        61 ~~~~~liDtpG~~~   74 (189)
T cd00881          61 DRRVNFIDTPGHED   74 (189)
T ss_pred             CEEEEEEeCCCcHH
Confidence            46789999999874


No 86 
>cd01863 Rab18 Rab18 subfamily.  Mammalian Rab18 is implicated in endocytic transport and is expressed most highly in polarized epithelial cells. However, trypanosomal Rab, TbRAB18, is upregulated in the BSF (Blood Stream Form) stage and localized predominantly to elements of the Golgi complex.  In human and mouse cells, Rab18 has been identified in lipid droplets, organelles that store neutral lipids. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of mos
Probab=65.86  E-value=21  Score=22.28  Aligned_cols=17  Identities=35%  Similarity=0.515  Sum_probs=13.2

Q ss_pred             ecCeEEEEEEEeCCCCC
Q psy104           24 ERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        24 e~~~~l~LtIidTpGfG   40 (86)
                      -++..++|.++||||..
T Consensus        44 ~~~~~~~~~l~D~~g~~   60 (161)
T cd01863          44 VDGKKVKLAIWDTAGQE   60 (161)
T ss_pred             ECCEEEEEEEEECCCch
Confidence            34567889999999953


No 87 
>cd01865 Rab3 Rab3 subfamily.  The Rab3 subfamily contains Rab3A, Rab3B, Rab3C, and Rab3D.  All four isoforms were found in mouse brain and endocrine tissues, with varying levels of expression.  Rab3A, Rab3B, and Rab3C localized to synaptic and secretory vesicles; Rab3D was expressed at high levels only in adipose tissue, exocrine glands, and the endocrine pituitary, where it is localized to cytoplasmic secretory granules.  Rab3 appears to control Ca2+-regulated exocytosis. The appropriate GDP/GTP exchange cycle of Rab3A is required for Ca2+-regulated exocytosis to occur, and interaction of the GTP-bound form of Rab3A with effector molecule(s) is widely believed to be essential for this process. Functionally, most studies point toward a role for Rab3 in the secretion of hormones and neurotransmitters. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promot
Probab=65.32  E-value=29  Score=22.03  Aligned_cols=20  Identities=20%  Similarity=0.346  Sum_probs=14.9

Q ss_pred             EEeecCeEEEEEEEeCCCCC
Q psy104           21 DIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        21 ~l~e~~~~l~LtIidTpGfG   40 (86)
                      .+.-++-.+.|.+.||||..
T Consensus        42 ~~~~~~~~~~~~l~Dt~g~~   61 (165)
T cd01865          42 TVFRNDKRVKLQIWDTAGQE   61 (165)
T ss_pred             EEEECCEEEEEEEEECCChH
Confidence            34445667899999999964


No 88 
>COG1162 Predicted GTPases [General function prediction only]
Probab=64.85  E-value=3.3  Score=30.93  Aligned_cols=9  Identities=56%  Similarity=1.114  Sum_probs=7.8

Q ss_pred             EEEeCCCCC
Q psy104           32 TVVDTPGFG   40 (86)
Q Consensus        32 tIidTpGfG   40 (86)
                      -|||||||.
T Consensus       219 ~iiDTPGf~  227 (301)
T COG1162         219 WIIDTPGFR  227 (301)
T ss_pred             EEEeCCCCC
Confidence            389999996


No 89 
>cd01860 Rab5_related Rab5-related subfamily.  This subfamily includes Rab5 and Rab22 of mammals, Ypt51/Ypt52/Ypt53 of yeast, and RabF of plants. The members of this subfamily are involved in endocytosis and endocytic-sorting pathways.  In mammals, Rab5 GTPases localize to early endosomes and regulate fusion of clathrin-coated vesicles to early endosomes and fusion between early endosomes. In yeast, Ypt51p family members similarly regulate membrane trafficking through prevacuolar compartments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence mo
Probab=64.75  E-value=24  Score=22.02  Aligned_cols=19  Identities=16%  Similarity=0.344  Sum_probs=14.1

Q ss_pred             EEeecCeEEEEEEEeCCCC
Q psy104           21 DIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        21 ~l~e~~~~l~LtIidTpGf   39 (86)
                      .+.-++..++|.++||||-
T Consensus        42 ~v~~~~~~~~~~i~D~~G~   60 (163)
T cd01860          42 TVNLDDTTVKFEIWDTAGQ   60 (163)
T ss_pred             EEEECCEEEEEEEEeCCch
Confidence            3344466789999999994


No 90 
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily.  Translocation is mediated by EF-G (also called translocase).  The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA.  This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule.  EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit.  The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G.  On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit.  To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it.  The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well.  The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site.  This group
Probab=64.64  E-value=6.1  Score=27.90  Aligned_cols=20  Identities=35%  Similarity=0.810  Sum_probs=13.7

Q ss_pred             EEeecCeEEEEEEEeCCCCCCc
Q psy104           21 DIEERGVKLRLTVVDTPGFGDS   42 (86)
Q Consensus        21 ~l~e~~~~l~LtIidTpGfGd~   42 (86)
                      .+.-++  .+++++||||+++.
T Consensus        58 ~~~~~~--~~i~liDtPG~~~f   77 (268)
T cd04170          58 PLEWKG--HKINLIDTPGYADF   77 (268)
T ss_pred             EEEECC--EEEEEEECcCHHHH
Confidence            444344  46788999999753


No 91 
>PRK10218 GTP-binding protein; Provisional
Probab=64.57  E-value=18  Score=29.36  Aligned_cols=30  Identities=37%  Similarity=0.443  Sum_probs=20.1

Q ss_pred             ceEEEEEEEEEeecCeEEEEEEEeCCCCCCcc
Q psy104           12 TTTIEKKSMDIEERGVKLRLTVVDTPGFGDSI   43 (86)
Q Consensus        12 t~~I~~~~~~l~e~~~~l~LtIidTpGfGd~i   43 (86)
                      ..++......++.++  .+++++||||..+..
T Consensus        53 GiTi~~~~~~i~~~~--~~inliDTPG~~df~   82 (607)
T PRK10218         53 GITILAKNTAIKWND--YRINIVDTPGHADFG   82 (607)
T ss_pred             ceEEEEEEEEEecCC--EEEEEEECCCcchhH
Confidence            455555555555544  678899999987653


No 92 
>cd01885 EF2 EF2 (for archaea and eukarya).  Translocation requires hydrolysis of a molecule of GTP and is mediated by EF-G in bacteria and by eEF2 in eukaryotes.  The eukaryotic elongation factor eEF2 is a GTPase involved in the translocation of the peptidyl-tRNA from the A site to the P site on the ribosome.  The 95-kDa protein is highly conserved, with 60% amino acid sequence identity between the human and yeast proteins.  Two major mechanisms are known to regulate protein elongation and both involve eEF2.  First, eEF2 can be modulated by reversible phosphorylation.  Increased levels of phosphorylated eEF2 reduce elongation rates presumably because phosphorylated eEF2 fails to bind the ribosomes.  Treatment of mammalian cells with agents that raise the cytoplasmic Ca2+ and cAMP levels reduce elongation rates by activating the kinase responsible for phosphorylating eEF2.  In contrast, treatment of cells with insulin increases elongation rates by promoting eEF2 dephosphorylation.  Seco
Probab=64.42  E-value=5.5  Score=27.95  Aligned_cols=17  Identities=29%  Similarity=0.598  Sum_probs=13.2

Q ss_pred             CeEEEEEEEeCCCCCCc
Q psy104           26 GVKLRLTVVDTPGFGDS   42 (86)
Q Consensus        26 ~~~l~LtIidTpGfGd~   42 (86)
                      +-...++++||||.-+.
T Consensus        70 ~~~~~i~iiDTPG~~~f   86 (222)
T cd01885          70 GNEYLINLIDSPGHVDF   86 (222)
T ss_pred             CCceEEEEECCCCcccc
Confidence            34688999999997543


No 93 
>cd04171 SelB SelB subfamily.  SelB is an elongation factor needed for the co-translational incorporation of selenocysteine.  Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin.  In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu).  It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner. This allows insertion of selenocysteine at in-frame UGA stop codons.  In E. coli SelB binds GTP, selenocysteyl-tRNAsec, and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence).  The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation.  Archaeal and animal mechanisms of selenocysteine incorporation are more complex.  Although the SECIS elements have different secondary structures and conserved elements between archaea and eukaryo
Probab=64.17  E-value=9.9  Score=23.69  Aligned_cols=12  Identities=42%  Similarity=0.742  Sum_probs=9.9

Q ss_pred             EEEEEEeCCCCC
Q psy104           29 LRLTVVDTPGFG   40 (86)
Q Consensus        29 l~LtIidTpGfG   40 (86)
                      ..++++||||..
T Consensus        51 ~~~~~~DtpG~~   62 (164)
T cd04171          51 KRLGFIDVPGHE   62 (164)
T ss_pred             cEEEEEECCChH
Confidence            478999999963


No 94 
>TIGR01631 Trypano_RHS trypanosome RHS (retrotransposon hot spot) family. This model describes full-length and part-length members of the RHS (retrotransposon hot spot) family in Trypanosoma brucei and Trypanosoma cruzi. Members of this family are frequently interrupted by non-LTR retrotransposons inserted at exactly the same relative position.
Probab=63.93  E-value=5.8  Score=33.14  Aligned_cols=37  Identities=24%  Similarity=0.372  Sum_probs=29.1

Q ss_pred             EEEEEEEeCCCCCCccCCccchhHHHHHHHHHHHHhhhhhcCCc
Q psy104           28 KLRLTVVDTPGFGDSINSEESWRACCSYIDDQFRQYFNDESGLN   71 (86)
Q Consensus        28 ~l~LtIidTpGfGd~i~n~~~~~~i~~yI~~qf~~yl~eE~~i~   71 (86)
                      |..--+|.|||+|.+.+-.       +|+--|+..|-.+..++-
T Consensus       279 p~~~vlIGTPGIGKS~~aG-------SyLLYqLLHydae~L~vV  315 (760)
T TIGR01631       279 PERRVLIGTPGIGKSFGVG-------SFLLYQLLHYDAEKLQVV  315 (760)
T ss_pred             CCCeEEECCCCccccccch-------HHHHHHHHhccHhhCcEE
Confidence            4444599999999998866       599999998887776653


No 95 
>PF07999 RHSP:  Retrotransposon hot spot protein;  InterPro: IPR006518 These sequences are full-length and part-length members of the RHS (retrotransposon hot spot) family in Trypanosoma brucei and Trypanosoma cruzi. Members of this family are frequently interrupted by non-LTR retrotransposons inserted at exactly the same relative position. 
Probab=63.46  E-value=5.3  Score=31.16  Aligned_cols=36  Identities=25%  Similarity=0.437  Sum_probs=26.8

Q ss_pred             EEEEEEEeCCCCCCccCCccchhHHHHHHHHHHHHhhhhhcCC
Q psy104           28 KLRLTVVDTPGFGDSINSEESWRACCSYIDDQFRQYFNDESGL   70 (86)
Q Consensus        28 ~l~LtIidTpGfGd~i~n~~~~~~i~~yI~~qf~~yl~eE~~i   70 (86)
                      +.-..+|.|||.|.+.+-.       +|+-.|...|=.+..++
T Consensus       124 ~~p~vlIGTPGIGKS~~~G-------S~LLyqLLHy~~~~L~v  159 (439)
T PF07999_consen  124 PRPFVLIGTPGIGKSFGTG-------SYLLYQLLHYDAEKLPV  159 (439)
T ss_pred             CCceEEEecCCcCccccch-------hhhhhhhhcCChhhccE
Confidence            3445899999999888765       48888887776665544


No 96 
>PTZ00209 retrotransposon hot spot protein; Provisional
Probab=63.38  E-value=5.9  Score=32.70  Aligned_cols=37  Identities=14%  Similarity=0.223  Sum_probs=29.7

Q ss_pred             EEEEEEEeCCCCCCccCCccchhHHHHHHHHHHHHhhhhhcCCc
Q psy104           28 KLRLTVVDTPGFGDSINSEESWRACCSYIDDQFRQYFNDESGLN   71 (86)
Q Consensus        28 ~l~LtIidTpGfGd~i~n~~~~~~i~~yI~~qf~~yl~eE~~i~   71 (86)
                      |..--+|.|||+|.+.+-.       +||--|+..|=.+..++-
T Consensus       172 P~~~vLIGTPGIGKSm~aG-------SyLLYqLLHyDae~L~vV  208 (693)
T PTZ00209        172 PPTHIVIGISGIGKSCGVG-------SFLLHSLLHFHEGMLDVV  208 (693)
T ss_pred             CCceEEECCCCccccccch-------HHHHHHHHccCHhHCcEE
Confidence            5556699999999998866       599999998877776653


No 97 
>cd01878 HflX HflX subfamily.  A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily.  The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual biological functions of these GTPases remain unclear.  HflX is widespread, but not universally represented in all three superkingdoms.
Probab=63.35  E-value=13  Score=24.66  Aligned_cols=13  Identities=31%  Similarity=0.447  Sum_probs=10.8

Q ss_pred             EEEEEeCCCCCCc
Q psy104           30 RLTVVDTPGFGDS   42 (86)
Q Consensus        30 ~LtIidTpGfGd~   42 (86)
                      .++++||||+.+.
T Consensus        90 ~~~i~Dt~G~~~~  102 (204)
T cd01878          90 EVLLTDTVGFIRD  102 (204)
T ss_pred             eEEEeCCCccccC
Confidence            6889999999654


No 98 
>cd01898 Obg Obg subfamily.  The Obg nucleotide binding protein subfamily has been implicated in stress response, chromosome partitioning, replication initiation, mycelium development, and sporulation.  Obg proteins are among a large group of GTP binding proteins conserved from bacteria to humans.  The E. coli homolog, ObgE is believed to function in ribosomal biogenesis.  Members of the subfamily contain two equally and highly conserved domains, a C-terminal GTP binding domain and an N-terminal glycine-rich domain.
Probab=63.28  E-value=5.7  Score=25.16  Aligned_cols=13  Identities=31%  Similarity=0.554  Sum_probs=10.8

Q ss_pred             EEEEEEeCCCCCC
Q psy104           29 LRLTVVDTPGFGD   41 (86)
Q Consensus        29 l~LtIidTpGfGd   41 (86)
                      ..++++||||+.+
T Consensus        48 ~~~~l~DtpG~~~   60 (170)
T cd01898          48 RSFVVADIPGLIE   60 (170)
T ss_pred             CeEEEEecCcccC
Confidence            4789999999854


No 99 
>PF12075 KN_motif:  KN motif;  InterPro: IPR021939  This small motif is found at the N terminus of Kank proteins and has been called the KN (for Kank N-terminal) motif. This protein is found in eukaryotes. Proteins in this family are typically between 413 to 1202 amino acids in length. This protein is found associated with PF00023 from PFAM. This protein has two conserved sequence motifs: TPYG and LDLDF. Kank1 was obtained by positional cloning of a tumor suppressor gene in renal cell carcinoma, while the other members were found by homology search. The family is involved in the regulation of actin polymerisation and cell motility through signaling pathways containing PI3K/Akt and/or unidentified modulators/effectors []. 
Probab=61.99  E-value=5.4  Score=21.10  Aligned_cols=19  Identities=37%  Similarity=0.810  Sum_probs=13.9

Q ss_pred             EeCCCCCCccCCccchhHHHHHHHH
Q psy104           34 VDTPGFGDSINSEESWRACCSYIDD   58 (86)
Q Consensus        34 idTpGfGd~i~n~~~~~~i~~yI~~   58 (86)
                      +.|| ||-++|..+     ++|+++
T Consensus         4 v~tP-YGyhiDLDF-----vkyve~   22 (39)
T PF12075_consen    4 VETP-YGYHIDLDF-----VKYVED   22 (39)
T ss_pred             ccCC-cceeecchH-----HHHHHH
Confidence            3564 888899887     777765


No 100
>cd04136 Rap_like Rap-like subfamily.  The Rap subfamily consists of the Rap1, Rap2, and RSR1.  Rap subfamily proteins perform different cellular functions, depending on the isoform and its subcellular localization. For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and microsomal membrane of the pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.   Rap1 localizes in the nucleus of human oropharyngeal squamous cell carcinomas (SCCs) and cell lines.  Rap1 plays a role in phagocytosis by controlling the binding of adhesion receptors (typically integrins) to their ligands.  In yeast, Rap1 has been implicated in multiple functions, including activation and silencing of transcription and maintenance of telomeres. 
Probab=61.95  E-value=19  Score=22.47  Aligned_cols=19  Identities=37%  Similarity=0.504  Sum_probs=14.7

Q ss_pred             EeecCeEEEEEEEeCCCCC
Q psy104           22 IEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        22 l~e~~~~l~LtIidTpGfG   40 (86)
                      +.-++..+.|.+.||||.-
T Consensus        42 ~~~~~~~~~l~i~Dt~G~~   60 (163)
T cd04136          42 IEVDGQQCMLEILDTAGTE   60 (163)
T ss_pred             EEECCEEEEEEEEECCCcc
Confidence            4445678899999999953


No 101
>PF00009 GTP_EFTU:  Elongation factor Tu GTP binding domain;  InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site. The proteins are all relatively similar in the vicinity of their C-termini, and are also highly similar to a range of proteins that includes the nodulation Q protein from Rhizobium meliloti (Sinorhizobium meliloti), bacterial tetracycline resistance proteins [] and the omnipotent suppressor protein 2 from yeast. In both prokaryotes and eukaryotes, there are three distinct types of elongation factors, EF-1alpha (EF-Tu), which binds GTP and an aminoacyl-tRNAand delivers the latter to the A site of ribosomes; EF-1beta (EF-Ts), which interacts with EF-1a/EF-Tu to displace GDP and thus allows the regeneration of GTP-EF-1a; and EF-2 (EF-G), which binds GTP and peptidyl-tRNA and translocates the latter from the A site to the P site. In EF-1-alpha, a specific region has been shown [] to be involved in a conformational change mediated by the hydrolysis of GTP to GDP. This region is conserved in both EF-1alpha/EF-Tu as well as EF-2/EF-G and thus seems typical for GTP-dependent proteins which bind non-initiator tRNAs to the ribosome. The GTP-binding protein synthesis factor family also includes the eukaryotic peptide chain release factor GTP-binding subunits [] and prokaryotic peptide chain release factor 3 (RF-3) []; the prokaryotic GTP-binding protein lepA and its homologue in yeast (GUF1) and Caenorhabditis elegans (ZK1236.1); yeast HBS1 []; rat statin S1 []; and the prokaryotic selenocysteine-specific elongation factor selB [].; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 3IZW_C 1DG1_G 2BVN_B 3IZV_C 3MMP_C 1OB2_A 1EFU_A 3FIH_Z 3TR5_A 1TUI_C ....
Probab=61.78  E-value=5.6  Score=26.38  Aligned_cols=14  Identities=43%  Similarity=0.873  Sum_probs=11.6

Q ss_pred             EEEEEEEeCCCCCC
Q psy104           28 KLRLTVVDTPGFGD   41 (86)
Q Consensus        28 ~l~LtIidTpGfGd   41 (86)
                      ...++++||||..+
T Consensus        69 ~~~i~~iDtPG~~~   82 (188)
T PF00009_consen   69 NRKITLIDTPGHED   82 (188)
T ss_dssp             SEEEEEEEESSSHH
T ss_pred             ccceeecccccccc
Confidence            57889999999854


No 102
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain. Guanylate-binding proteins (GBPs) define a group of proteins that are synthesized after activation of the cell by interferons.  The biochemical properties of GBPs are clearly different from those of Ras-like and heterotrimeric GTP-binding proteins.  They bind guanine nucleotides with low affinity (micromolar range), are stable in their absence and have a high turnover GTPase.  In addition to binding GDP/GTP, they have the unique ability to bind GMP with equal affinity and hydrolyze GTP not only to GDP, but also to GMP. Furthermore, two unique regions around the base and the phosphate-binding areas, the guanine and the phosphate caps, respectively, give the nucleotide-binding site a unique appearance not found in the canonical GTP-binding proteins.  The phosphate cap, which constitutes the region analogous to switch I, completely shields the phosphate-binding site from solvent such that a potential GTPase-activating protein
Probab=60.88  E-value=6.4  Score=27.44  Aligned_cols=17  Identities=18%  Similarity=0.227  Sum_probs=13.9

Q ss_pred             EEEEEEEeCCCCCCccC
Q psy104           28 KLRLTVVDTPGFGDSIN   44 (86)
Q Consensus        28 ~l~LtIidTpGfGd~i~   44 (86)
                      ...+-++||||+++.-.
T Consensus        59 ~~~v~~lDteG~~~~~~   75 (224)
T cd01851          59 EHAVLLLDTEGTDGRER   75 (224)
T ss_pred             cceEEEEecCCcCcccc
Confidence            36789999999997654


No 103
>cd01858 NGP_1 NGP-1.  Autoantigen NGP-1 (Nucleolar G-protein gene 1) has been shown to localize in the nucleolus and nucleolar organizers in all cell types analyzed, which is indicative of a function in ribosomal assembly. NGP-1 and its homologs show a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with NKXD motif) are relocated to the N terminus.
Probab=60.65  E-value=5.8  Score=25.60  Aligned_cols=9  Identities=33%  Similarity=0.899  Sum_probs=7.9

Q ss_pred             EEEEeCCCC
Q psy104           31 LTVVDTPGF   39 (86)
Q Consensus        31 LtIidTpGf   39 (86)
                      +.++||||+
T Consensus       149 ~~liDtPGi  157 (157)
T cd01858         149 IYLIDCPGV  157 (157)
T ss_pred             EEEEECcCC
Confidence            679999995


No 104
>cd04110 Rab35 Rab35 subfamily.  Rab35 is one of several Rab proteins to be found to participate in the regulation of osteoclast cells in rats. In addition, Rab35 has been identified as a protein that interacts with nucleophosmin-anaplastic lymphoma kinase (NPM-ALK) in human cells.  Overexpression of NPM-ALK is a key oncogenic event in some anaplastic large-cell lymphomas; since Rab35 interacts with N|PM-ALK, it may provide a target for cancer treatments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is 
Probab=60.62  E-value=29  Score=23.10  Aligned_cols=19  Identities=32%  Similarity=0.566  Sum_probs=14.1

Q ss_pred             EEeecCeEEEEEEEeCCCC
Q psy104           21 DIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        21 ~l~e~~~~l~LtIidTpGf   39 (86)
                      .+.-++..+.|.+.||||-
T Consensus        47 ~~~~~~~~~~l~l~D~~G~   65 (199)
T cd04110          47 TVEINGERVKLQIWDTAGQ   65 (199)
T ss_pred             EEEECCEEEEEEEEeCCCc
Confidence            3444566788999999994


No 105
>PLN03127 Elongation factor Tu; Provisional
Probab=60.28  E-value=9.3  Score=29.61  Aligned_cols=30  Identities=27%  Similarity=0.383  Sum_probs=18.9

Q ss_pred             cceEEEEEEEEEeecCeEEEEEEEeCCCCCCc
Q psy104           11 KTTTIEKKSMDIEERGVKLRLTVVDTPGFGDS   42 (86)
Q Consensus        11 ~t~~I~~~~~~l~e~~~~l~LtIidTpGfGd~   42 (86)
                      +...+......++.++  -.++++||||..+.
T Consensus       108 rGiTi~~~~~~~~~~~--~~i~~iDtPGh~~f  137 (447)
T PLN03127        108 RGITIATAHVEYETAK--RHYAHVDCPGHADY  137 (447)
T ss_pred             cCceeeeeEEEEcCCC--eEEEEEECCCccch
Confidence            4445555555555443  36789999998654


No 106
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability.
Probab=60.23  E-value=24  Score=26.45  Aligned_cols=23  Identities=22%  Similarity=0.364  Sum_probs=15.3

Q ss_pred             EEeecCeEEEEEEEeCCCCCCccCC
Q psy104           21 DIEERGVKLRLTVVDTPGFGDSINS   45 (86)
Q Consensus        21 ~l~e~~~~l~LtIidTpGfGd~i~n   45 (86)
                      .++.++.  .++++||||+......
T Consensus       214 ~~~~~~~--~~~liDT~G~~~~~~~  236 (429)
T TIGR03594       214 PFERNGK--KYLLIDTAGIRRKGKV  236 (429)
T ss_pred             EEEECCc--EEEEEECCCccccccc
Confidence            3443443  6789999999765543


No 107
>TIGR00503 prfC peptide chain release factor 3. This translation releasing factor, RF-3 (prfC) was originally described as stop codon-independent, in contrast to peptide chain release factor 1 (RF-1, prfA) and RF-2 (prfB). RF-1 and RF-2 are closely related to each other, while RF-3 is similar to elongation factors EF-Tu and EF-G; RF-1 is active at UAA and UAG and RF-2 is active at UAA and UGA. More recently, RF-3 was shown to be active primarily at UGA stop codons in E. coli. All bacteria and organelles have RF-1. The Mycoplasmas and organelles, which translate UGA as Trp rather than as a stop codon, lack RF-2. RF-3, in contrast, seems to be rare among bacteria and is found so far only in Escherichia coli and some other gamma subdivision Proteobacteria, in Synechocystis PCC6803, and in Staphylococcus aureus.
Probab=59.90  E-value=13  Score=29.56  Aligned_cols=29  Identities=28%  Similarity=0.407  Sum_probs=19.0

Q ss_pred             ceEEEEEEEEEeecCeEEEEEEEeCCCCCCc
Q psy104           12 TTTIEKKSMDIEERGVKLRLTVVDTPGFGDS   42 (86)
Q Consensus        12 t~~I~~~~~~l~e~~~~l~LtIidTpGfGd~   42 (86)
                      ..++......++-++  .+++++||||..+.
T Consensus        65 gisi~~~~~~~~~~~--~~inliDTPG~~df   93 (527)
T TIGR00503        65 GISITTSVMQFPYRD--CLVNLLDTPGHEDF   93 (527)
T ss_pred             CCcEEEEEEEEeeCC--eEEEEEECCChhhH
Confidence            445555555555554  56788999998643


No 108
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis]
Probab=59.69  E-value=6.8  Score=30.65  Aligned_cols=29  Identities=31%  Similarity=0.550  Sum_probs=17.3

Q ss_pred             eEEEEEEEEEeecCeEEEEEEEeCCCCCCcc
Q psy104           13 TTIEKKSMDIEERGVKLRLTVVDTPGFGDSI   43 (86)
Q Consensus        13 ~~I~~~~~~l~e~~~~l~LtIidTpGfGd~i   43 (86)
                      +.|......++-+  +..+||+|+||--|.+
T Consensus        71 vTi~~~~~~fet~--k~~~tIiDaPGHrdFv   99 (428)
T COG5256          71 VTIDVAHSKFETD--KYNFTIIDAPGHRDFV   99 (428)
T ss_pred             eEEEEEEEEeecC--CceEEEeeCCchHHHH
Confidence            4444444433322  4589999999965543


No 109
>PRK00741 prfC peptide chain release factor 3; Provisional
Probab=59.57  E-value=14  Score=29.36  Aligned_cols=29  Identities=24%  Similarity=0.408  Sum_probs=18.5

Q ss_pred             ceEEEEEEEEEeecCeEEEEEEEeCCCCCCc
Q psy104           12 TTTIEKKSMDIEERGVKLRLTVVDTPGFGDS   42 (86)
Q Consensus        12 t~~I~~~~~~l~e~~~~l~LtIidTpGfGd~   42 (86)
                      ..+|......+.-++  .+++++||||..|.
T Consensus        64 giSi~~~~~~~~~~~--~~inliDTPG~~df   92 (526)
T PRK00741         64 GISVTSSVMQFPYRD--CLINLLDTPGHEDF   92 (526)
T ss_pred             CCceeeeeEEEEECC--EEEEEEECCCchhh
Confidence            344555545555454  56789999998653


No 110
>TIGR03134 malonate_gamma malonate decarboxylase, gamma subunit. Members of this protein family are the gamma subunit of malonate decarboxylase. Malonate decarboxylase may be a soluble enzyme, or linked to membrane subunits and active as a sodium pump. In the malonate decarboxylase complex, the beta subunit appears to act as a malonyl-CoA decarboxylase, while the gamma subunit appears either to mediate subunit interaction or to act as a co-decarboxylase with the beta subunit. The beta and gamma subunits exhibit some local sequence similarity.
Probab=59.15  E-value=16  Score=26.28  Aligned_cols=37  Identities=14%  Similarity=0.090  Sum_probs=23.4

Q ss_pred             CeEEEEEEEeCCCCCCccCCccchhHHHHHHHHHHHHhhh
Q psy104           26 GVKLRLTVVDTPGFGDSINSEESWRACCSYIDDQFRQYFN   65 (86)
Q Consensus        26 ~~~l~LtIidTpGfGd~i~n~~~~~~i~~yI~~qf~~yl~   65 (86)
                      ++|| |++||||||--  ....-+.-+..++..-+..|..
T Consensus        66 ~~PI-v~lvDtpG~~~--g~~aE~~G~~~a~A~l~~a~a~  102 (238)
T TIGR03134        66 KRPI-VVLVDTPSQAY--GRREELLGINQALAHLAKALAL  102 (238)
T ss_pred             CCCE-EEEEeCCCCCC--CHHHHHHHHHHHHHHHHHHHHH
Confidence            4454 89999999973  3333345567777665555543


No 111
>cd01893 Miro1 Miro1 subfamily.  Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs.  Genes encoding Miro-like proteins were found in several eukaryotic organisms.  This CD represents the N-terminal GTPase domain of Miro proteins.  These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis.  Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.
Probab=58.82  E-value=15  Score=23.41  Aligned_cols=17  Identities=24%  Similarity=0.231  Sum_probs=13.9

Q ss_pred             cCeEEEEEEEeCCCCCC
Q psy104           25 RGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        25 ~~~~l~LtIidTpGfGd   41 (86)
                      ++..+++.++||||.+.
T Consensus        43 ~~~~~~~~i~Dt~G~~~   59 (166)
T cd01893          43 TPERVPTTIVDTSSRPQ   59 (166)
T ss_pred             cCCeEEEEEEeCCCchh
Confidence            45678999999999874


No 112
>cd04101 RabL4 RabL4 (Rab-like4) subfamily.  RabL4s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like.  As in other Rab-like proteins, RabL4 lacks a prenylation site at the C-terminus.  The specific function of RabL4 remains unknown.
Probab=58.64  E-value=35  Score=21.34  Aligned_cols=15  Identities=20%  Similarity=0.346  Sum_probs=12.4

Q ss_pred             cCeEEEEEEEeCCCC
Q psy104           25 RGVKLRLTVVDTPGF   39 (86)
Q Consensus        25 ~~~~l~LtIidTpGf   39 (86)
                      .+-.+.|.+.||||-
T Consensus        48 ~~~~~~l~i~Dt~G~   62 (164)
T cd04101          48 TDNTVELFIFDSAGQ   62 (164)
T ss_pred             CCCEEEEEEEECCCH
Confidence            456789999999983


No 113
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily.  This subfamily contains R-Ras2/TC21, M-Ras/R-Ras3, and related members of the Ras family. M-Ras is expressed in lympho-hematopoetic cells.  It interacts with some of the known Ras effectors, but appears to also have its own effectors.  Expression of mutated M-Ras leads to transformation of several types of cell lines, including hematopoietic cells, mammary epithelial cells, and fibroblasts.  Overexpression of M-Ras is observed in carcinomas from breast, uterus, thyroid, stomach, colon, kidney, lung, and rectum.  In addition, expression of a constitutively active M-Ras mutant in murine bone marrow induces a malignant mast cell leukemia that is distinct from the monocytic leukemia induced by H-Ras.  TC21, along with H-Ras, has been shown to regulate the branching morphogenesis of ureteric bud cell branching in mice.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an ali
Probab=58.49  E-value=25  Score=21.92  Aligned_cols=15  Identities=33%  Similarity=0.404  Sum_probs=12.4

Q ss_pred             cCeEEEEEEEeCCCC
Q psy104           25 RGVKLRLTVVDTPGF   39 (86)
Q Consensus        25 ~~~~l~LtIidTpGf   39 (86)
                      ++-.+++.++||||.
T Consensus        46 ~~~~~~~~i~Dt~G~   60 (164)
T cd04145          46 DGQWAILDILDTAGQ   60 (164)
T ss_pred             CCEEEEEEEEECCCC
Confidence            455789999999994


No 114
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily.  Rit (Ras-like protein in all tissues), Rin (Ras-like protein in neurons) and Ric (Ras-related protein which interacts with calmodulin) form a subfamily with several unique structural and functional characteristics.   These proteins all lack a the C-terminal CaaX lipid-binding motif typical of Ras family proteins, and Rin and Ric contain calmodulin-binding domains.  Rin, which is expressed only in neurons, induces neurite outgrowth in rat pheochromocytoma cells through its association with calmodulin and its activation of endogenous Rac/cdc42.  Rit, which is ubiquitously expressed in mammals, inhibits growth-factor withdrawl-mediated apoptosis and induces neurite extension in pheochromocytoma cells.  Rit and Rin are both able to form a ternary complex with PAR6, a cell polarity-regulating protein, and Rac/cdc42.  This ternary complex is proposed to have physiological function in processes such as tumorigenesis.  Activated Ric is likely to sign
Probab=58.46  E-value=31  Score=22.40  Aligned_cols=19  Identities=21%  Similarity=0.212  Sum_probs=14.7

Q ss_pred             EeecCeEEEEEEEeCCCCC
Q psy104           22 IEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        22 l~e~~~~l~LtIidTpGfG   40 (86)
                      +.-++-.+.|++.||||..
T Consensus        43 ~~~~~~~~~l~i~Dt~G~~   61 (172)
T cd04141          43 ARIDNEPALLDILDTAGQA   61 (172)
T ss_pred             EEECCEEEEEEEEeCCCch
Confidence            4445678899999999954


No 115
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily.  EF1 is responsible for the GTP-dependent binding of aminoacyl-tRNAs to the ribosomes.  EF1 is composed of four subunits: the alpha chain which binds GTP and aminoacyl-tRNAs, the gamma chain that probably plays a role in anchoring the complex to other cellular components and the beta and delta (or beta') chains.  This subfamily is the alpha subunit, and represents the counterpart of bacterial EF-Tu for the archaea (aEF1-alpha) and eukaryotes (eEF1-alpha).  eEF1-alpha interacts with the actin of the eukaryotic cytoskeleton and may thereby play a role in cellular transformation and apoptosis.  EF-Tu can have no such role in bacteria.  In humans, the isoform eEF1A2 is overexpressed in 2/3 of breast cancers and has been identified as a putative oncogene.  This subfamily also includes Hbs1, a G protein known to be important for efficient growth and protein synthesis under conditions of limiting translation initiation in
Probab=57.72  E-value=13  Score=25.47  Aligned_cols=26  Identities=31%  Similarity=0.519  Sum_probs=15.7

Q ss_pred             eEEEEEEEEEeecCeEEEEEEEeCCCCC
Q psy104           13 TTIEKKSMDIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        13 ~~I~~~~~~l~e~~~~l~LtIidTpGfG   40 (86)
                      ..+......++-++  .+++++||||..
T Consensus        63 ~T~d~~~~~~~~~~--~~i~liDtpG~~   88 (219)
T cd01883          63 VTIDVGLAKFETEK--YRFTILDAPGHR   88 (219)
T ss_pred             cCeecceEEEeeCC--eEEEEEECCChH
Confidence            33444334444444  578999999974


No 116
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily.  IF2/eIF5B contribute to ribosomal subunit joining and function as GTPases that are maximally activated by the presence of both ribosomal subunits.  As seen in other GTPases, IF2/IF5B undergoes conformational changes between its GTP- and GDP-bound states.  Eukaryotic IF2/eIF5Bs possess three characteristic segments, including a divergent N-terminal region followed by conserved central and C-terminal segments.  This core region is conserved among all known eukaryotic and archaeal IF2/eIF5Bs and eubacterial IF2s.
Probab=57.28  E-value=6.3  Score=24.85  Aligned_cols=13  Identities=38%  Similarity=0.606  Sum_probs=10.8

Q ss_pred             EEEEEEEeCCCCC
Q psy104           28 KLRLTVVDTPGFG   40 (86)
Q Consensus        28 ~l~LtIidTpGfG   40 (86)
                      ...++++||||..
T Consensus        49 ~~~~~iiDtpG~~   61 (168)
T cd01887          49 IPGITFIDTPGHE   61 (168)
T ss_pred             cceEEEEeCCCcH
Confidence            4678999999975


No 117
>PF00063 Myosin_head:  Myosin head (motor domain);  InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril. Myosin is a major component of thick filaments and exists as a hexamer of 2 heavy chains [], 2 alkali light chains, and 2 regulatory light chains. The heavy chain can be subdivided into the N-terminal globular head and the C-terminal coiled-coil rod-like tail, although some forms have a globular region in their C-terminal. There are many cell-specific isoforms of myosin heavy chains, coded for by a multi-gene family []. Myosin interacts with actin to convert chemical energy, in the form of ATP, to mechanical energy []. The 3-D structure of the head portion of myosin has been determined [] and a model for actin-myosin complex has been constructed []. The globular head is well conserved, some highly-conserved regions possibly relating to functional and structural domains []. The rod-like tail starts with an invariant proline residue, and contains many repeats of a 28 residue region, interrupted at 4 regularly-spaced points known as skip residues. Although the sequence of the tail is not well conserved, the chemical character is, hydrophobic, charged and skip residues occuring in a highly ordered and repeated fashion [].; GO: 0003774 motor activity, 0005524 ATP binding, 0016459 myosin complex; PDB: 1LKX_A 2V26_A 2BKI_A 3L9I_A 2BKH_A 2X51_A 2VB6_A 2VAS_A 1OE9_A 1W8J_A ....
Probab=57.12  E-value=15  Score=29.74  Aligned_cols=37  Identities=27%  Similarity=0.610  Sum_probs=23.0

Q ss_pred             eEEEEEEEeCCCCCCccCCccchh-HHHHHHHHHHHHhhh
Q psy104           27 VKLRLTVVDTPGFGDSINSEESWR-ACCSYIDDQFRQYFN   65 (86)
Q Consensus        27 ~~l~LtIidTpGfGd~i~n~~~~~-~i~~yI~~qf~~yl~   65 (86)
                      ..-.+.|+|.|||-..  ..++++ -.++|..++...|+.
T Consensus       362 ~~~~IgILDi~GFE~~--~~N~fEQLciNyanErLq~~f~  399 (689)
T PF00063_consen  362 NSSSIGILDIFGFENF--SVNSFEQLCINYANERLQQFFN  399 (689)
T ss_dssp             -SEEEEEEEEE-B-----SSB-HHHHHHHHHHHHHHHHHH
T ss_pred             ccccCcccCccccccc--cccccccceeeeccccccceee
Confidence            3456789999999866  444566 458999988877743


No 118
>PF00071 Ras:  Ras family;  InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases. This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including:  Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction; PDB: 1M7B_A 2V55_B 3EG5_C 3LAW_A 1YHN_A 1T91_B 1HE8_B 3SEA_B 3T5G_A 1XTS_A ....
Probab=56.64  E-value=30  Score=21.58  Aligned_cols=30  Identities=27%  Similarity=0.338  Sum_probs=21.7

Q ss_pred             cceEEEEEEEEEeecCeEEEEEEEeCCCCC
Q psy104           11 KTTTIEKKSMDIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        11 ~t~~I~~~~~~l~e~~~~l~LtIidTpGfG   40 (86)
                      +|..+..+...+.-++.++.|.+.||+|-.
T Consensus        30 ~t~~~~~~~~~~~~~~~~~~l~i~D~~g~~   59 (162)
T PF00071_consen   30 PTIGIDSYSKEVSIDGKPVNLEIWDTSGQE   59 (162)
T ss_dssp             TTSSEEEEEEEEEETTEEEEEEEEEETTSG
T ss_pred             cccccccccccccccccccccccccccccc
Confidence            344455555566666889999999999853


No 119
>cd04121 Rab40 Rab40 subfamily.  This subfamily contains Rab40a, Rab40b, and Rab40c, which are all highly homologous.  In rat, Rab40c is localized to the perinuclear recycling compartment (PRC), and is distributed in a tissue-specific manor, with high expression in brain, heart, kidney, and testis, low expression in lung and liver, and no expression in spleen and skeletal muscle.  Rab40c is highly expressed in differentiated oligodendrocytes but minimally expressed in oligodendrocyte progenitors, suggesting a role in the vesicular transport of myelin components.  Unlike most other Ras-superfamily proteins, Rab40c was shown to have a much lower affinity for GTP, and an affinity for GDP that is lower than for GTP. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide d
Probab=56.16  E-value=51  Score=22.15  Aligned_cols=20  Identities=35%  Similarity=0.523  Sum_probs=15.7

Q ss_pred             EEeecCeEEEEEEEeCCCCC
Q psy104           21 DIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        21 ~l~e~~~~l~LtIidTpGfG   40 (86)
                      .+.-++-.++|.+.||+|-.
T Consensus        47 ~i~~~~~~~~l~iwDt~G~~   66 (189)
T cd04121          47 TILLDGRRVKLQLWDTSGQG   66 (189)
T ss_pred             EEEECCEEEEEEEEeCCCcH
Confidence            34446678999999999965


No 120
>PRK12288 GTPase RsgA; Reviewed
Probab=56.07  E-value=17  Score=27.33  Aligned_cols=11  Identities=27%  Similarity=0.736  Sum_probs=8.7

Q ss_pred             EEEeCCCCCCc
Q psy104           32 TVVDTPGFGDS   42 (86)
Q Consensus        32 tIidTpGfGd~   42 (86)
                      .|||||||...
T Consensus       260 ~liDTPGir~~  270 (347)
T PRK12288        260 DLIDSPGVREF  270 (347)
T ss_pred             EEEECCCCCcc
Confidence            39999999643


No 121
>KOG0458|consensus
Probab=56.02  E-value=16  Score=29.80  Aligned_cols=20  Identities=30%  Similarity=0.423  Sum_probs=16.2

Q ss_pred             eEEEEEEEeCCCCCCccCCc
Q psy104           27 VKLRLTVVDTPGFGDSINSE   46 (86)
Q Consensus        27 ~~l~LtIidTpGfGd~i~n~   46 (86)
                      -+-.+|++|+||-+|.+.|-
T Consensus       253 ~~~~~tliDaPGhkdFi~nm  272 (603)
T KOG0458|consen  253 KSKIVTLIDAPGHKDFIPNM  272 (603)
T ss_pred             CceeEEEecCCCccccchhh
Confidence            36788999999988887664


No 122
>cd04123 Rab21 Rab21 subfamily.  The localization and function of Rab21 are not clearly defined, with conflicting data reported.  Rab21 has been reported to localize in the ER in human intestinal epithelial cells, with partial colocalization with alpha-glucosidase, a late endosomal/lysosomal marker.  More recently, Rab21 was shown to colocalize with and affect the morphology of early endosomes. In Dictyostelium, GTP-bound Rab21, together with two novel LIM domain proteins, LimF and ChLim, has been shown to regulate phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site
Probab=55.81  E-value=46  Score=20.45  Aligned_cols=14  Identities=36%  Similarity=0.674  Sum_probs=11.9

Q ss_pred             cCeEEEEEEEeCCC
Q psy104           25 RGVKLRLTVVDTPG   38 (86)
Q Consensus        25 ~~~~l~LtIidTpG   38 (86)
                      .+..+.+.+.||||
T Consensus        45 ~~~~~~~~~~D~~g   58 (162)
T cd04123          45 GGKRIDLAIWDTAG   58 (162)
T ss_pred             CCEEEEEEEEECCc
Confidence            35678999999999


No 123
>cd04175 Rap1 Rap1 subgroup.  The Rap1 subgroup is part of the Rap subfamily of the Ras family.  It can be further divided into the Rap1a and Rap1b isoforms.  In humans, Rap1a and Rap1b share 95% sequence homology, but are products of two different genes located on chromosomes 1 and 12, respectively.  Rap1a is sometimes called smg p21 or Krev1 in the older literature.  Rap1 proteins are believed to perform different cellular functions, depending on the isoform, its subcellular localization, and the effector proteins it binds.  For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and the microsomal membrane of pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.  High expression of Rap1 has been observed in the n
Probab=55.65  E-value=28  Score=21.91  Aligned_cols=19  Identities=32%  Similarity=0.518  Sum_probs=14.8

Q ss_pred             EEeecCeEEEEEEEeCCCC
Q psy104           21 DIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        21 ~l~e~~~~l~LtIidTpGf   39 (86)
                      .+.-++..+.|.+.||||.
T Consensus        41 ~~~~~~~~~~l~i~Dt~G~   59 (164)
T cd04175          41 QVEVDGQQCMLEILDTAGT   59 (164)
T ss_pred             EEEECCEEEEEEEEECCCc
Confidence            3444567899999999996


No 124
>cd04166 CysN_ATPS CysN_ATPS subfamily.  CysN, together with protein CysD, form the ATP sulfurylase (ATPS) complex in some bacteria and lower eukaryotes.  ATPS catalyzes the production of ATP sulfurylase (APS) and pyrophosphate (PPi) from ATP and sulfate.  CysD, which catalyzes ATP hydrolysis, is a member of the ATP pyrophosphatase (ATP PPase) family.  CysN hydrolysis of GTP is required for CysD hydrolysis of ATP; however, CysN hydrolysis of GTP is not dependent on CysD hydrolysis of ATP.  CysN is an example of lateral gene transfer followed by acquisition of new function.  In many organisms, an ATPS exists which is not GTP-dependent and shares no sequence or structural similarity to CysN.
Probab=55.41  E-value=14  Score=25.00  Aligned_cols=26  Identities=23%  Similarity=0.322  Sum_probs=14.8

Q ss_pred             eEEEEEEEEEeecCeEEEEEEEeCCCCC
Q psy104           13 TTIEKKSMDIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        13 ~~I~~~~~~l~e~~~~l~LtIidTpGfG   40 (86)
                      ..+......++-++.  +++++||||+-
T Consensus        63 ~T~~~~~~~~~~~~~--~~~liDTpG~~   88 (208)
T cd04166          63 ITIDVAYRYFSTPKR--KFIIADTPGHE   88 (208)
T ss_pred             cCeecceeEEecCCc--eEEEEECCcHH
Confidence            334433334443443  56789999974


No 125
>PLN03110 Rab GTPase; Provisional
Probab=55.27  E-value=50  Score=22.41  Aligned_cols=29  Identities=21%  Similarity=0.312  Sum_probs=18.5

Q ss_pred             cceEEEEEEEEEeecCeEEEEEEEeCCCC
Q psy104           11 KTTTIEKKSMDIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        11 ~t~~I~~~~~~l~e~~~~l~LtIidTpGf   39 (86)
                      .|..+......+.-++..+.|.+.||||-
T Consensus        43 ~t~g~~~~~~~v~~~~~~~~l~l~Dt~G~   71 (216)
T PLN03110         43 STIGVEFATRTLQVEGKTVKAQIWDTAGQ   71 (216)
T ss_pred             CceeEEEEEEEEEECCEEEEEEEEECCCc
Confidence            34444433334444567789999999995


No 126
>COG1159 Era GTPase [General function prediction only]
Probab=55.26  E-value=11  Score=28.10  Aligned_cols=15  Identities=33%  Similarity=0.638  Sum_probs=11.5

Q ss_pred             EEEEEEEeCCCCCCc
Q psy104           28 KLRLTVVDTPGFGDS   42 (86)
Q Consensus        28 ~l~LtIidTpGfGd~   42 (86)
                      .-.+..+|||||=..
T Consensus        53 ~~QiIfvDTPGih~p   67 (298)
T COG1159          53 NAQIIFVDTPGIHKP   67 (298)
T ss_pred             CceEEEEeCCCCCCc
Confidence            456789999999543


No 127
>cd04135 Tc10 TC10 subfamily.  TC10 is a Rho family protein that has been shown to induce microspike formation and neurite outgrowth in vitro.  Its expression changes dramatically after peripheral nerve injury, suggesting an important role in promoting axonal outgrowth and regeneration.  TC10 regulates translocation of insulin-stimulated GLUT4 in adipocytes and has also been shown to bind directly to Golgi COPI coat proteins.  GTP-bound TC10 in vitro can bind numerous potential effectors.  Depending on its subcellular localization and distinct functional domains, TC10 can differentially regulate two types of filamentous actin in adipocytes.  TC10 mRNAs are highly expressed in three types of mouse muscle tissues:  leg skeletal muscle, cardiac muscle, and uterus; they were also present in brain, with higher levels in adults than in newborns.  TC10 has also been shown to play a role in regulating the expression of cystic fibrosis transmembrane conductance regulator (CFTR) through interacti
Probab=55.01  E-value=38  Score=21.45  Aligned_cols=21  Identities=29%  Similarity=0.379  Sum_probs=15.8

Q ss_pred             EEeecCeEEEEEEEeCCCCCC
Q psy104           21 DIEERGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        21 ~l~e~~~~l~LtIidTpGfGd   41 (86)
                      .+.-++..+.++++||||-.+
T Consensus        40 ~~~~~~~~~~~~i~Dt~G~~~   60 (174)
T cd04135          40 SVTVGGKQYLLGLYDTAGQED   60 (174)
T ss_pred             EEEECCEEEEEEEEeCCCccc
Confidence            344456678899999999754


No 128
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily.  Rab32 and Rab38 are members of the Rab family of small GTPases.  Human Rab32 was first identified in platelets but it is expressed in a variety of cell types, where it functions as an A-kinase anchoring protein (AKAP). Rab38 has been shown to be melanocyte-specific.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=54.95  E-value=50  Score=21.89  Aligned_cols=14  Identities=29%  Similarity=0.401  Sum_probs=12.2

Q ss_pred             CeEEEEEEEeCCCC
Q psy104           26 GVKLRLTVVDTPGF   39 (86)
Q Consensus        26 ~~~l~LtIidTpGf   39 (86)
                      +..+.|.+.||||-
T Consensus        47 ~~~~~l~l~Dt~G~   60 (201)
T cd04107          47 NTVVRLQLWDIAGQ   60 (201)
T ss_pred             CCEEEEEEEECCCc
Confidence            56889999999995


No 129
>TIGR03156 GTP_HflX GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like).
Probab=54.91  E-value=18  Score=27.10  Aligned_cols=26  Identities=27%  Similarity=0.452  Sum_probs=17.0

Q ss_pred             cceEEEEEEEEEeecCeEEEEEEEeCCCC
Q psy104           11 KTTTIEKKSMDIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        11 ~t~~I~~~~~~l~e~~~~l~LtIidTpGf   39 (86)
                      .|.......+.+. ++.  .+.++|||||
T Consensus       222 tT~d~~~~~i~~~-~~~--~i~l~DT~G~  247 (351)
T TIGR03156       222 ATLDPTTRRLDLP-DGG--EVLLTDTVGF  247 (351)
T ss_pred             cccCCEEEEEEeC-CCc--eEEEEecCcc
Confidence            4555555655553 333  6788999999


No 130
>cd04114 Rab30 Rab30 subfamily.  Rab30 appears to be associated with the Golgi stack. It is expressed in a wide variety of tissue types and in humans maps to chromosome 11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=54.64  E-value=51  Score=20.66  Aligned_cols=19  Identities=37%  Similarity=0.620  Sum_probs=14.0

Q ss_pred             EeecCeEEEEEEEeCCCCC
Q psy104           22 IEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        22 l~e~~~~l~LtIidTpGfG   40 (86)
                      +.-++.++++.+.||||..
T Consensus        49 ~~~~~~~~~~~~~D~~g~~   67 (169)
T cd04114          49 VEIKGEKIKLQIWDTAGQE   67 (169)
T ss_pred             EEECCEEEEEEEEECCCcH
Confidence            3344667889999999853


No 131
>cd04178 Nucleostemin_like Nucleostemin-like.  Nucleostemin (NS) is a nucleolar protein that functions as a regulator of cell growth and proliferation in stem cells and in several types of cancer cells, but is not expressed in the differentiated cells of most mammalian adult tissues.  NS shuttles between the nucleolus and nucleoplasm bidirectionally at a rate that is fast and independent of cell type.  Lowering GTP levels decreases the nucleolar retention of NS, and expression of NS is abruptly down-regulated during differentiation prior to terminal cell division.  Found only in eukaryotes, NS consists of an N-terminal basic domain, a coiled-coil domain, a GTP-binding domain, an intermediate domain, and a C-terminal acidic domain.  Experimental evidence indicates that NS uses its GTP-binding property as a molecular switch to control the transition between the nucleolus and nucleoplasm, and this process involves interaction between the basic, GTP-binding, and intermediate domains of the 
Probab=54.06  E-value=7.6  Score=26.08  Aligned_cols=10  Identities=30%  Similarity=0.986  Sum_probs=8.5

Q ss_pred             EEEEEeCCCC
Q psy104           30 RLTVVDTPGF   39 (86)
Q Consensus        30 ~LtIidTpGf   39 (86)
                      .+.++||||+
T Consensus       163 ~~~l~DtPGi  172 (172)
T cd04178         163 KVKLLDSPGI  172 (172)
T ss_pred             CEEEEECcCC
Confidence            4779999996


No 132
>cd04120 Rab12 Rab12 subfamily.  Rab12 was first identified in canine cells, where it was localized to the Golgi complex.  The specific function of Rab12 remains unknown, and inconsistent results about its cellular localization have been reported.  More recent studies have identified Rab12 associated with post-Golgi vesicles, or with other small vesicle-like structures but not with the Golgi complex.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic
Probab=53.42  E-value=53  Score=22.37  Aligned_cols=29  Identities=34%  Similarity=0.468  Sum_probs=18.1

Q ss_pred             cceEEEEEEEEEeecCeEEEEEEEeCCCC
Q psy104           11 KTTTIEKKSMDIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        11 ~t~~I~~~~~~l~e~~~~l~LtIidTpGf   39 (86)
                      .|..+.-+.-.+.-++-.++|.+.||+|-
T Consensus        31 ~Ti~~~~~~~~i~~~~~~v~l~iwDtaGq   59 (202)
T cd04120          31 SGVGVDFKIKTVELRGKKIRLQIWDTAGQ   59 (202)
T ss_pred             CcceeEEEEEEEEECCEEEEEEEEeCCCc
Confidence            34433333233444567899999999984


No 133
>cd04176 Rap2 Rap2 subgroup.  The Rap2 subgroup is part of the Rap subfamily of the Ras family.  It consists of Rap2a, Rap2b, and Rap2c.  Both isoform 3 of the human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4) and Traf2- and Nck-interacting kinase (TNIK) are putative effectors of Rap2 in mediating the activation of c-Jun N-terminal kinase (JNK) to regulate the actin cytoskeleton.  In human platelets, Rap2 was shown to interact with the cytoskeleton by binding the actin filaments.  In embryonic Xenopus development, Rap2 is necessary for the Wnt/beta-catenin signaling pathway.  The Rap2 interacting protein 9 (RPIP9) is highly expressed in human breast carcinomas and correlates with a poor prognosis, suggesting a role for Rap2 in breast cancer oncogenesis.  Rap2b, but not Rap2a, Rap2c, Rap1a, or Rap1b, is expressed in human red blood cells, where it is believed to be involved in vesiculation.  A number of additional effector proteins for Rap2 have been identified, incl
Probab=53.41  E-value=30  Score=21.68  Aligned_cols=18  Identities=33%  Similarity=0.386  Sum_probs=14.0

Q ss_pred             EeecCeEEEEEEEeCCCC
Q psy104           22 IEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        22 l~e~~~~l~LtIidTpGf   39 (86)
                      +.-++.++.|.+.||||.
T Consensus        42 ~~~~~~~~~l~i~Dt~G~   59 (163)
T cd04176          42 IEVDSSPSVLEILDTAGT   59 (163)
T ss_pred             EEECCEEEEEEEEECCCc
Confidence            334567889999999995


No 134
>smart00173 RAS Ras subfamily of RAS small GTPases. Similar in fold and function to the bacterial EF-Tu GTPase. p21Ras couples receptor Tyr kinases and G protein receptors  to protein kinase cascades
Probab=53.20  E-value=31  Score=21.58  Aligned_cols=19  Identities=37%  Similarity=0.413  Sum_probs=14.2

Q ss_pred             EeecCeEEEEEEEeCCCCC
Q psy104           22 IEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        22 l~e~~~~l~LtIidTpGfG   40 (86)
                      +.-++-.+.|.++||||--
T Consensus        41 ~~~~~~~~~l~i~Dt~g~~   59 (164)
T smart00173       41 IEIDGEVCLLDILDTAGQE   59 (164)
T ss_pred             EEECCEEEEEEEEECCCcc
Confidence            3344568999999999953


No 135
>PLN00043 elongation factor 1-alpha; Provisional
Probab=52.98  E-value=8.7  Score=29.75  Aligned_cols=31  Identities=29%  Similarity=0.362  Sum_probs=19.7

Q ss_pred             CcceEEEEEEEEEeecCeEEEEEEEeCCCCCCc
Q psy104           10 GKTTTIEKKSMDIEERGVKLRLTVVDTPGFGDS   42 (86)
Q Consensus        10 ~~t~~I~~~~~~l~e~~~~l~LtIidTpGfGd~   42 (86)
                      .+...|......++.++  .+++++||||..+.
T Consensus        68 ~rGiTi~~~~~~~~~~~--~~i~liDtPGh~df   98 (447)
T PLN00043         68 ERGITIDIALWKFETTK--YYCTVIDAPGHRDF   98 (447)
T ss_pred             hcCceEEEEEEEecCCC--EEEEEEECCCHHHH
Confidence            44555555545555443  57889999997544


No 136
>TIGR01393 lepA GTP-binding protein LepA. LepA (GUF1 in Saccaromyces) is a GTP-binding membrane protein related to EF-G and EF-Tu. Two types of phylogenetic tree, rooted by other GTP-binding proteins, suggest that eukaryotic homologs (including GUF1 of yeast) originated within the bacterial LepA family. The function is unknown.
Probab=52.78  E-value=21  Score=28.71  Aligned_cols=31  Identities=29%  Similarity=0.498  Sum_probs=20.2

Q ss_pred             ceEEEEEEEEEe---ecCeEEEEEEEeCCCCCCc
Q psy104           12 TTTIEKKSMDIE---ERGVKLRLTVVDTPGFGDS   42 (86)
Q Consensus        12 t~~I~~~~~~l~---e~~~~l~LtIidTpGfGd~   42 (86)
                      ...|....+.+.   .++-.+.|+++||||.-+.
T Consensus        50 GiTi~~~~v~~~~~~~~g~~~~l~liDTPG~~dF   83 (595)
T TIGR01393        50 GITIKAQAVRLNYKAKDGETYVLNLIDTPGHVDF   83 (595)
T ss_pred             CCCeeeeEEEEEEEcCCCCEEEEEEEECCCcHHH
Confidence            344554444442   1455789999999999764


No 137
>cd04132 Rho4_like Rho4-like subfamily.  Rho4 is a GTPase that controls septum degradation by regulating secretion of Eng1 or Agn1 during cytokinesis.  Rho4 also plays a role in cell morphogenesis.  Rho4 regulates septation and cell morphology by controlling the actin cytoskeleton and cytoplasmic microtubules.  The localization of Rho4 is modulated by Rdi1, which may function as a GDI, and by Rga9, which is believed to function as a GAP.  In S. pombe, both Rho4 deletion and Rho4 overexpression result in a defective cell wall, suggesting a role for Rho4 in maintaining cell wall integrity.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.
Probab=52.63  E-value=50  Score=21.30  Aligned_cols=15  Identities=33%  Similarity=0.481  Sum_probs=12.7

Q ss_pred             cCeEEEEEEEeCCCC
Q psy104           25 RGVKLRLTVVDTPGF   39 (86)
Q Consensus        25 ~~~~l~LtIidTpGf   39 (86)
                      ++..+.|.+.||||-
T Consensus        45 ~~~~~~l~i~Dt~G~   59 (187)
T cd04132          45 NGKIIELALWDTAGQ   59 (187)
T ss_pred             CCcEEEEEEEECCCc
Confidence            367889999999994


No 138
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily.  RERG (Ras-related and Estrogen- Regulated Growth inhibitor) and Ras-like 11 are members of a novel subfamily of Ras that were identified based on their behavior in breast and prostate tumors, respectively.  RERG expression was decreased or lost in a significant fraction of primary human breast tumors that lack estrogen receptor and are correlated with poor clinical prognosis.  Elevated RERG expression correlated with favorable patient outcome in a breast tumor subtype that is positive for estrogen receptor expression.  In contrast to most Ras proteins, RERG overexpression inhibited the growth of breast tumor cells in vitro and in vivo.  RasL11 was found to be ubiquitously expressed in human tissue, but down-regulated in prostate tumors.  Both RERG and RasL11 lack the C-terminal CaaX prenylation motif, where a = an aliphatic amino acid and X = any amino acid, and are localized primarily in the cytoplasm.  Both are believed to have tu
Probab=52.52  E-value=30  Score=21.86  Aligned_cols=17  Identities=29%  Similarity=0.544  Sum_probs=13.9

Q ss_pred             cCeEEEEEEEeCCCCCC
Q psy104           25 RGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        25 ~~~~l~LtIidTpGfGd   41 (86)
                      ++-.+++.++||||...
T Consensus        43 ~~~~~~~~i~D~~g~~~   59 (165)
T cd04146          43 DGEQVSLEILDTAGQQQ   59 (165)
T ss_pred             CCEEEEEEEEECCCCcc
Confidence            45678999999999873


No 139
>TIGR02034 CysN sulfate adenylyltransferase, large subunit. Homologous to this E.coli activation pathway are nodPQH gene products found among members of the Rhizobiaceae family. These gene products have been shown to exhibit ATP sulfurase and APS kinase activity, yet are involved in Nod factor sulfation, and sulfation of other macromolecules. With members of the Rhizobiaceae family, nodQ often appears as a fusion of cysN (large subunit of ATP sulfurase) and cysC (APS kinase).
Probab=52.46  E-value=18  Score=27.52  Aligned_cols=28  Identities=25%  Similarity=0.305  Sum_probs=17.2

Q ss_pred             ceEEEEEEEEEeecCeEEEEEEEeCCCCCC
Q psy104           12 TTTIEKKSMDIEERGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        12 t~~I~~~~~~l~e~~~~l~LtIidTpGfGd   41 (86)
                      .+++......++-++  .+++++||||..+
T Consensus        65 giTid~~~~~~~~~~--~~~~liDtPGh~~   92 (406)
T TIGR02034        65 GITIDVAYRYFSTDK--RKFIVADTPGHEQ   92 (406)
T ss_pred             CcCeEeeeEEEccCC--eEEEEEeCCCHHH
Confidence            444555444554444  3678999999543


No 140
>COG1084 Predicted GTPase [General function prediction only]
Probab=52.24  E-value=13  Score=28.38  Aligned_cols=28  Identities=43%  Similarity=0.744  Sum_probs=16.2

Q ss_pred             eEEEEEEEEEe--ecCeEEEEEEEeCCCCCC
Q psy104           13 TTIEKKSMDIE--ERGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        13 ~~I~~~~~~l~--e~~~~l~LtIidTpGfGd   41 (86)
                      ..++++.+.+-  |.+ -++..||||||+=|
T Consensus       198 YPFTTK~i~vGhfe~~-~~R~QvIDTPGlLD  227 (346)
T COG1084         198 YPFTTKGIHVGHFERG-YLRIQVIDTPGLLD  227 (346)
T ss_pred             CCccccceeEeeeecC-CceEEEecCCcccC
Confidence            34455555442  211 24677999999954


No 141
>cd04125 RabA_like RabA-like subfamily.  RabA was first identified in D. discoideum, where its expression levels were compared to other Rabs in growing and developing cells.  The RabA mRNA levels were below the level of detection by Northern blot analysis, suggesting a very low level of expression.  The function of RabA remains unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=51.96  E-value=55  Score=21.27  Aligned_cols=17  Identities=24%  Similarity=0.319  Sum_probs=13.4

Q ss_pred             cCeEEEEEEEeCCCCCC
Q psy104           25 RGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        25 ~~~~l~LtIidTpGfGd   41 (86)
                      ++-.+.|.+.||||...
T Consensus        45 ~~~~~~~~i~Dt~g~~~   61 (188)
T cd04125          45 ENKIIKLQIWDTNGQER   61 (188)
T ss_pred             CCEEEEEEEEECCCcHH
Confidence            44578999999999753


No 142
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases. Members of this subfamily of Ras-like small GTPases include Cdc42 and Rac, as well as Rho isoforms.
Probab=51.90  E-value=49  Score=20.92  Aligned_cols=19  Identities=37%  Similarity=0.515  Sum_probs=14.6

Q ss_pred             EEeecCeEEEEEEEeCCCC
Q psy104           21 DIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        21 ~l~e~~~~l~LtIidTpGf   39 (86)
                      .+.-++-.+.|.+.||||-
T Consensus        38 ~~~~~~~~~~~~i~Dt~G~   56 (174)
T smart00174       38 DVEVDGKPVELGLWDTAGQ   56 (174)
T ss_pred             EEEECCEEEEEEEEECCCC
Confidence            3444567889999999994


No 143
>PRK12289 GTPase RsgA; Reviewed
Probab=50.90  E-value=7.8  Score=29.23  Aligned_cols=10  Identities=50%  Similarity=1.009  Sum_probs=8.3

Q ss_pred             EEEeCCCCCC
Q psy104           32 TVVDTPGFGD   41 (86)
Q Consensus        32 tIidTpGfGd   41 (86)
                      -++|||||-.
T Consensus       227 ~liDTPG~~~  236 (352)
T PRK12289        227 LLADTPGFNQ  236 (352)
T ss_pred             EEEeCCCccc
Confidence            4999999963


No 144
>TIGR00485 EF-Tu translation elongation factor TU. This alignment models orthologs of translation elongation factor EF-Tu in bacteria, mitochondria, and chloroplasts, one of several GTP-binding translation factors found by the more general pfam model GTP_EFTU. The eukaryotic conterpart, eukaryotic translation elongation factor 1 (eEF-1 alpha), is excluded from this model. EF-Tu is one of the most abundant proteins in bacteria, as well as one of the most highly conserved, and in a number of species the gene is duplicated with identical function. When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors. Transfer RNA is carried to the ribosome in these complexes for protein translation.
Probab=50.08  E-value=18  Score=27.24  Aligned_cols=29  Identities=28%  Similarity=0.457  Sum_probs=17.8

Q ss_pred             cceEEEEEEEEEeecCeEEEEEEEeCCCCCC
Q psy104           11 KTTTIEKKSMDIEERGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        11 ~t~~I~~~~~~l~e~~~~l~LtIidTpGfGd   41 (86)
                      +...+......++.++  .+++++||||.-+
T Consensus        59 rG~Ti~~~~~~~~~~~--~~~~liDtpGh~~   87 (394)
T TIGR00485        59 RGITINTAHVEYETEN--RHYAHVDCPGHAD   87 (394)
T ss_pred             cCcceeeEEEEEcCCC--EEEEEEECCchHH
Confidence            3444555444554443  4678999999753


No 145
>TIGR01938 nqrC NADH:ubiquinone oxidoreductase, Na(+)-translocating, C subunit. This model represents the NqrC subunit of the six-protein, Na(+)-pumping NADH-quinone reductase of a number of marine and pathogenic Gram-negative bacteria. This oxidoreductase complex functions primarily as a sodium ion pump.
Probab=49.81  E-value=8.3  Score=28.01  Aligned_cols=20  Identities=35%  Similarity=0.627  Sum_probs=14.4

Q ss_pred             eEEEEEEE---eCCCCCCccCCc
Q psy104           27 VKLRLTVV---DTPGFGDSINSE   46 (86)
Q Consensus        27 ~~l~LtIi---dTpGfGd~i~n~   46 (86)
                      .-.-+.+.   +|||+|..+.+.
T Consensus       162 tI~Gi~~~~h~ETPGLG~~I~~~  184 (251)
T TIGR01938       162 TVLGITYYQQGETPGLGAEIENP  184 (251)
T ss_pred             EEEEEEEeecCcCCCCccccCCH
Confidence            34445555   899999999765


No 146
>PTZ00141 elongation factor 1- alpha; Provisional
Probab=49.66  E-value=13  Score=28.79  Aligned_cols=29  Identities=28%  Similarity=0.393  Sum_probs=18.0

Q ss_pred             ceEEEEEEEEEeecCeEEEEEEEeCCCCCCc
Q psy104           12 TTTIEKKSMDIEERGVKLRLTVVDTPGFGDS   42 (86)
Q Consensus        12 t~~I~~~~~~l~e~~~~l~LtIidTpGfGd~   42 (86)
                      ..++......++.++  .++++|||||.-+.
T Consensus        70 GiTid~~~~~~~~~~--~~i~lIDtPGh~~f   98 (446)
T PTZ00141         70 GITIDIALWKFETPK--YYFTIIDAPGHRDF   98 (446)
T ss_pred             CEeEEeeeEEEccCC--eEEEEEECCChHHH
Confidence            444544444555443  57889999996544


No 147
>cd04160 Arfrp1 Arfrp1 subfamily.  Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif.  Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes.  It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network.  Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D.  Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development.
Probab=49.14  E-value=28  Score=21.86  Aligned_cols=14  Identities=29%  Similarity=0.273  Sum_probs=11.2

Q ss_pred             EEEEEEEeCCCCCC
Q psy104           28 KLRLTVVDTPGFGD   41 (86)
Q Consensus        28 ~l~LtIidTpGfGd   41 (86)
                      ...+.++||||...
T Consensus        49 ~~~~~l~Dt~G~~~   62 (167)
T cd04160          49 NARLKFWDLGGQES   62 (167)
T ss_pred             CEEEEEEECCCChh
Confidence            46889999999653


No 148
>cd04128 Spg1 Spg1p.  Spg1p (septum-promoting GTPase) was first identified in the fission yeast S. pombe, where it regulates septum formation in the septation initiation network (SIN) through the cdc7 protein kinase.  Spg1p is an essential gene that localizes to the spindle pole bodies.  When GTP-bound, it binds cdc7 and causes it to translocate to spindle poles. Sid4p (septation initiation defective) is required for localization of Spg1p to the spindle pole body, and the ability of Spg1p to promote septum formation from any point in the cell cycle depends on Sid4p.  Spg1p is negatively regulated by Byr4 and cdc16, which form a two-component GTPase activating protein (GAP) for Spg1p.  The existence of a SIN-related pathway in plants has been proposed.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP.  Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are
Probab=48.63  E-value=71  Score=21.05  Aligned_cols=30  Identities=20%  Similarity=0.242  Sum_probs=19.2

Q ss_pred             CcceEEEEEEEEEeecCeEEEEEEEeCCCC
Q psy104           10 GKTTTIEKKSMDIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        10 ~~t~~I~~~~~~l~e~~~~l~LtIidTpGf   39 (86)
                      .+|.....+...+.-++.++.|.|.||+|-
T Consensus        30 ~~T~g~~~~~~~i~~~~~~~~l~iwDt~G~   59 (182)
T cd04128          30 IQTLGVNFMEKTISIRGTEITFSIWDLGGQ   59 (182)
T ss_pred             CCccceEEEEEEEEECCEEEEEEEEeCCCc
Confidence            445544433333444567899999999984


No 149
>cd01854 YjeQ_engC YjeQ/EngC.  YjeQ (YloQ in Bacillus subtilis) represents a protein family whose members are broadly conserved in bacteria and have been shown to be essential to the growth of E. coli and B. subtilis. Proteins of the YjeQ family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. All YjeQ family proteins display a unique domain architecture, which includes an N-terminal OB-fold RNA-binding domain, the central permuted GTPase domain, and a zinc knuckle-like C-terminal cysteine domain. This domain architecture suggests a role for YjeQ as a regulator of translation.
Probab=48.46  E-value=28  Score=25.18  Aligned_cols=10  Identities=50%  Similarity=1.122  Sum_probs=8.4

Q ss_pred             EEEeCCCCCC
Q psy104           32 TVVDTPGFGD   41 (86)
Q Consensus        32 tIidTpGfGd   41 (86)
                      .++|||||..
T Consensus       216 ~liDtPG~~~  225 (287)
T cd01854         216 LLIDTPGFRE  225 (287)
T ss_pred             EEEECCCCCc
Confidence            4999999954


No 150
>PF02421 FeoB_N:  Ferrous iron transport protein B;  InterPro: IPR011619  Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions. FeoB has been identified as part of this transport system and may play a role in the transport of ferrous iron. FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent [].; GO: 0005525 GTP binding, 0015093 ferrous iron transmembrane transporter activity, 0015684 ferrous iron transport, 0016021 integral to membrane; PDB: 3TAH_B 3B1X_A 3SS8_A 3B1W_C 3B1V_A 3LX5_A 3B1Y_A 3LX8_A 3B1Z_A 3K53_B ....
Probab=48.41  E-value=65  Score=21.52  Aligned_cols=27  Identities=22%  Similarity=0.398  Sum_probs=13.1

Q ss_pred             CcceEEEEEEEEEeecCeEEEEEEEeCCCCC
Q psy104           10 GKTTTIEKKSMDIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        10 ~~t~~I~~~~~~l~e~~~~l~LtIidTpGfG   40 (86)
                      ..|++.....+.+.  +  -.+.++|+||.=
T Consensus        32 G~Tv~~~~g~~~~~--~--~~~~lvDlPG~y   58 (156)
T PF02421_consen   32 GTTVEKKEGIFKLG--D--QQVELVDLPGIY   58 (156)
T ss_dssp             TSSSEEEEEEEEET--T--EEEEEEE----S
T ss_pred             CCCeeeeeEEEEec--C--ceEEEEECCCcc
Confidence            34555555444443  3  567899999963


No 151
>cd04144 Ras2 Ras2 subfamily.  The Ras2 subfamily, found exclusively in fungi, was first identified in Ustilago maydis.  In U. maydis, Ras2 is regulated by Sql2, a protein that is homologous to GEFs (guanine nucleotide exchange factors) of the CDC25 family.  Ras2 has been shown to induce filamentous growth, but the signaling cascade through which Ras2 and Sql2 regulate cell morphology is not known.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Probab=48.30  E-value=39  Score=22.23  Aligned_cols=18  Identities=33%  Similarity=0.316  Sum_probs=13.8

Q ss_pred             eecCeEEEEEEEeCCCCC
Q psy104           23 EERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        23 ~e~~~~l~LtIidTpGfG   40 (86)
                      .-++..+.|.+.||||.-
T Consensus        41 ~~~~~~~~l~i~Dt~G~~   58 (190)
T cd04144          41 VVDGQPCMLEVLDTAGQE   58 (190)
T ss_pred             EECCEEEEEEEEECCCch
Confidence            345667899999999953


No 152
>cd04111 Rab39 Rab39 subfamily.  Found in eukaryotes, Rab39 is mainly found in epithelial cell lines, but is distributed widely in various human tissues and cell lines.  It is believed to be a novel Rab protein involved in regulating Golgi-associated vesicular transport during cellular endocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.   Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=47.87  E-value=58  Score=22.06  Aligned_cols=15  Identities=40%  Similarity=0.711  Sum_probs=12.6

Q ss_pred             cCeEEEEEEEeCCCC
Q psy104           25 RGVKLRLTVVDTPGF   39 (86)
Q Consensus        25 ~~~~l~LtIidTpGf   39 (86)
                      ++..++|.+.||||-
T Consensus        48 ~~~~~~l~i~Dt~G~   62 (211)
T cd04111          48 PGVRIKLQLWDTAGQ   62 (211)
T ss_pred             CCCEEEEEEEeCCcc
Confidence            467889999999993


No 153
>TIGR00484 EF-G translation elongation factor EF-G. After peptide bond formation, this elongation factor of bacteria and organelles catalyzes the translocation of the tRNA-mRNA complex, with its attached nascent polypeptide chain, from the A-site to the P-site of the ribosome. Every completed bacterial genome has at least one copy, but some species have additional EF-G-like proteins. The closest homolog to canonical (e.g. E. coli) EF-G in the spirochetes clusters as if it is derived from mitochondrial forms, while a more distant second copy is also present. Synechocystis PCC6803 has a few proteins more closely related to EF-G than to any other characterized protein. Two of these resemble E. coli EF-G more closely than does the best match from the spirochetes; it may be that both function as authentic EF-G.
Probab=47.86  E-value=26  Score=28.45  Aligned_cols=29  Identities=31%  Similarity=0.481  Sum_probs=18.3

Q ss_pred             eEEEEEEEEEeecCeEEEEEEEeCCCCCCcc
Q psy104           13 TTIEKKSMDIEERGVKLRLTVVDTPGFGDSI   43 (86)
Q Consensus        13 ~~I~~~~~~l~e~~~~l~LtIidTpGfGd~i   43 (86)
                      ..+......++-++  .+++++||||..+..
T Consensus        61 iti~~~~~~~~~~~--~~i~liDTPG~~~~~   89 (689)
T TIGR00484        61 ITITSAATTVFWKG--HRINIIDTPGHVDFT   89 (689)
T ss_pred             CCEecceEEEEECC--eEEEEEECCCCcchh
Confidence            34444444454444  467899999997643


No 154
>cd04127 Rab27A Rab27a subfamily.  The Rab27a subfamily consists of Rab27a and its highly homologous isoform, Rab27b.  Unlike most Rab proteins whose functions remain poorly defined, Rab27a has many known functions.  Rab27a has multiple effector proteins, and depending on which effector it binds, Rab27a has different functions as well as tissue distribution and/or cellular localization. Putative functions have been assigned to Rab27a when associated with the effector proteins Slp1, Slp2, Slp3, Slp4, Slp5, DmSlp, rabphilin, Dm/Ce-rabphilin, Slac2-a, Slac2-b, Slac2-c, Noc2, JFC1, and Munc13-4. Rab27a has been associated with several human diseases, including hemophagocytic syndrome (Griscelli syndrome or GS), Hermansky-Pudlak syndrome, and choroidermia. In the case of GS, a rare, autosomal recessive disease, a Rab27a mutation is directly responsible for the disorder.  When Rab27a is localized to the secretory granules of pancreatic beta cells, it is believed to mediate glucose-stimulated 
Probab=47.52  E-value=72  Score=20.29  Aligned_cols=14  Identities=36%  Similarity=0.617  Sum_probs=11.9

Q ss_pred             CeEEEEEEEeCCCC
Q psy104           26 GVKLRLTVVDTPGF   39 (86)
Q Consensus        26 ~~~l~LtIidTpGf   39 (86)
                      +..+.|.+.||||-
T Consensus        60 ~~~~~~~i~Dt~G~   73 (180)
T cd04127          60 GQRIHLQLWDTAGQ   73 (180)
T ss_pred             CCEEEEEEEeCCCh
Confidence            56789999999993


No 155
>cd00157 Rho Rho (Ras homology) family.  Members of the Rho family include RhoA, Cdc42, Rac, Rnd, Wrch1, RhoBTB, and Rop.  There are 22 human Rho family members identified currently.  These proteins are all involved in the reorganization of the actin cytoskeleton in response to external stimuli.  They also have roles in cell transformation by Ras in cytokinesis, in focal adhesion formation and in the stimulation of stress-activated kinase.  These various functions are controlled through distinct effector proteins and mediated through a GTP-binding/GTPase cycle involving three classes of regulating proteins: GAPs (GTPase-activating proteins), GEFs (guanine nucleotide exchange factors), and GDIs (guanine nucleotide dissociation inhibitors).  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho protein
Probab=47.31  E-value=62  Score=20.22  Aligned_cols=20  Identities=25%  Similarity=0.415  Sum_probs=15.3

Q ss_pred             EeecCeEEEEEEEeCCCCCC
Q psy104           22 IEERGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        22 l~e~~~~l~LtIidTpGfGd   41 (86)
                      +.-.+..+.|.++||||...
T Consensus        41 ~~~~~~~~~l~~~D~~g~~~   60 (171)
T cd00157          41 VTVDGKQVNLGLWDTAGQEE   60 (171)
T ss_pred             EEECCEEEEEEEEeCCCccc
Confidence            34456788999999999763


No 156
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE, also called MnmE and previously designated ThdF (thiophene and furan oxidation protein), is a GTPase involved in tRNA modification to create 5-methylaminomethyl-2-thiouridine in the wobble position of some tRNAs. This protein and GidA form an alpha2/beta2 heterotetramer.
Probab=47.30  E-value=46  Score=25.77  Aligned_cols=16  Identities=25%  Similarity=0.646  Sum_probs=11.8

Q ss_pred             cCeEEEEEEEeCCCCCCc
Q psy104           25 RGVKLRLTVVDTPGFGDS   42 (86)
Q Consensus        25 ~~~~l~LtIidTpGfGd~   42 (86)
                      +|.+  ++++||||+.+.
T Consensus       249 ~g~~--v~l~DTaG~~~~  264 (442)
T TIGR00450       249 NGIL--IKLLDTAGIREH  264 (442)
T ss_pred             CCEE--EEEeeCCCcccc
Confidence            4544  589999999754


No 157
>cd04109 Rab28 Rab28 subfamily.  First identified in maize, Rab28 has been shown to be a late embryogenesis-abundant (Lea) protein that is regulated by the plant hormone abcisic acid (ABA).  In Arabidopsis, Rab28 is expressed during embryo development and is generally restricted to provascular tissues in mature embryos.  Unlike maize Rab28, it is not ABA-inducible. Characterization of the human Rab28 homolog revealed two isoforms, which differ by a 95-base pair insertion, producing an alternative sequence for the 30 amino acids at the C-terminus.  The two human isoforms are presumbly the result of alternative splicing.  Since they differ at the C-terminus but not in the GTP-binding region, they are predicted to be targeted to different cellular locations.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs 
Probab=46.68  E-value=78  Score=21.30  Aligned_cols=30  Identities=20%  Similarity=0.202  Sum_probs=18.3

Q ss_pred             CcceEEEEEEEEEe-ecCeEEEEEEEeCCCC
Q psy104           10 GKTTTIEKKSMDIE-ERGVKLRLTVVDTPGF   39 (86)
Q Consensus        10 ~~t~~I~~~~~~l~-e~~~~l~LtIidTpGf   39 (86)
                      .+|..+..+...+. .++..++|.|.||||-
T Consensus        30 ~~T~~~d~~~~~i~~~~~~~~~~~i~Dt~G~   60 (215)
T cd04109          30 KQTIGLDFFSKRVTLPGNLNVTLQVWDIGGQ   60 (215)
T ss_pred             CCceeEEEEEEEEEeCCCCEEEEEEEECCCc
Confidence            44554444333333 2336789999999994


No 158
>CHL00189 infB translation initiation factor 2; Provisional
Probab=46.61  E-value=24  Score=29.44  Aligned_cols=27  Identities=22%  Similarity=0.431  Sum_probs=16.7

Q ss_pred             EEEEEEEEeecCeEEEEEEEeCCCCCC
Q psy104           15 IEKKSMDIEERGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        15 I~~~~~~l~e~~~~l~LtIidTpGfGd   41 (86)
                      +..+.+.+.-++-...++++||||..+
T Consensus       281 i~~~~v~~~~~~~~~kItfiDTPGhe~  307 (742)
T CHL00189        281 IGAYEVEFEYKDENQKIVFLDTPGHEA  307 (742)
T ss_pred             cceEEEEEEecCCceEEEEEECCcHHH
Confidence            334444443333357899999999753


No 159
>PF00448 SRP54:  SRP54-type protein, GTPase domain;  InterPro: IPR000897  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. This entry represents the GTPase domain of the 54 kDa SRP54 component, a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 of the signal recognition particle has a three-domain structure: an N-terminal helical bundle domain, a GTPase domain, and the M-domain that binds the 7s RNA and also binds the signal sequence. The extreme C-terminal region is glycine-rich and lower in complexity and poorly conserved between species. The GTPase domain is evolutionary related to P-loop NTPase domains found in a variety of other proteins []. These proteins include Escherichia coli and Bacillus subtilis ffh protein (P48), which seems to be the prokaryotic counterpart of SRP54; signal recognition particle receptor alpha subunit (docking protein), an integral membrane GTP-binding protein which ensures, in conjunction with SRP, the correct targeting of nascent secretory proteins to the endoplasmic reticulum membrane; bacterial FtsY protein, which is believed to play a similar role to that of the docking protein in eukaryotes; the pilA protein from Neisseria gonorrhoeae, the homologue of ftsY; and bacterial flagellar biosynthesis protein flhF.; GO: 0005525 GTP binding, 0006614 SRP-dependent cotranslational protein targeting to membrane; PDB: 2OG2_A 3B9Q_A 3DM9_B 3DMD_B 3E70_C 3DM5_B 2XXA_C 2J28_9 1ZU5_B 1ZU4_A ....
Probab=46.55  E-value=36  Score=23.28  Aligned_cols=12  Identities=33%  Similarity=0.553  Sum_probs=8.7

Q ss_pred             EEEEEEeCCCCC
Q psy104           29 LRLTVVDTPGFG   40 (86)
Q Consensus        29 l~LtIidTpGfG   40 (86)
                      ..+-+|||||..
T Consensus        84 ~D~vlIDT~Gr~   95 (196)
T PF00448_consen   84 YDLVLIDTAGRS   95 (196)
T ss_dssp             SSEEEEEE-SSS
T ss_pred             CCEEEEecCCcc
Confidence            346799999986


No 160
>PLN03108 Rab family protein; Provisional
Probab=45.96  E-value=57  Score=21.99  Aligned_cols=18  Identities=28%  Similarity=0.381  Sum_probs=13.5

Q ss_pred             EeecCeEEEEEEEeCCCC
Q psy104           22 IEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        22 l~e~~~~l~LtIidTpGf   39 (86)
                      +.-++..+.|++.||||-
T Consensus        48 i~~~~~~i~l~l~Dt~G~   65 (210)
T PLN03108         48 ITIDNKPIKLQIWDTAGQ   65 (210)
T ss_pred             EEECCEEEEEEEEeCCCc
Confidence            333456789999999984


No 161
>KOG2486|consensus
Probab=45.10  E-value=43  Score=25.30  Aligned_cols=28  Identities=29%  Similarity=0.258  Sum_probs=18.8

Q ss_pred             EEeecCeEEEEEEEeCCCCCCccCCccc
Q psy104           21 DIEERGVKLRLTVVDTPGFGDSINSEES   48 (86)
Q Consensus        21 ~l~e~~~~l~LtIidTpGfGd~i~n~~~   48 (86)
                      .|+-..+..++.++|-||||..--+...
T Consensus       175 ~in~f~v~~~~~~vDlPG~~~a~y~~~~  202 (320)
T KOG2486|consen  175 AINHFHVGKSWYEVDLPGYGRAGYGFEL  202 (320)
T ss_pred             eeeeeeccceEEEEecCCcccccCCccC
Confidence            3444556778999999997755444433


No 162
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms]
Probab=44.99  E-value=31  Score=27.97  Aligned_cols=30  Identities=37%  Similarity=0.585  Sum_probs=19.8

Q ss_pred             cceEEEEEEEEEeecCeEEEEEEEeCCCCCCc
Q psy104           11 KTTTIEKKSMDIEERGVKLRLTVVDTPGFGDS   42 (86)
Q Consensus        11 ~t~~I~~~~~~l~e~~~~l~LtIidTpGfGd~   42 (86)
                      ....|-.+..-+.=++  .+++|+||||=.|.
T Consensus        52 RGITILaKnTav~~~~--~~INIvDTPGHADF   81 (603)
T COG1217          52 RGITILAKNTAVNYNG--TRINIVDTPGHADF   81 (603)
T ss_pred             cCcEEEeccceeecCC--eEEEEecCCCcCCc
Confidence            3455555555555454  67889999996654


No 163
>PRK12317 elongation factor 1-alpha; Reviewed
Probab=44.70  E-value=26  Score=26.56  Aligned_cols=27  Identities=33%  Similarity=0.493  Sum_probs=16.2

Q ss_pred             eEEEEEEEEEeecCeEEEEEEEeCCCCCC
Q psy104           13 TTIEKKSMDIEERGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        13 ~~I~~~~~~l~e~~~~l~LtIidTpGfGd   41 (86)
                      ..+......++.++  .+++++||||.-+
T Consensus        70 ~T~d~~~~~~~~~~--~~i~liDtpG~~~   96 (425)
T PRK12317         70 VTIDLAHKKFETDK--YYFTIVDCPGHRD   96 (425)
T ss_pred             ccceeeeEEEecCC--eEEEEEECCCccc
Confidence            33444334444443  5789999999643


No 164
>TIGR00490 aEF-2 translation elongation factor aEF-2. This model represents archaeal elongation factor 2, a protein more similar to eukaryotic EF-2 than to bacterial EF-G, both in sequence similarity and in sharing with eukaryotes the property of having a diphthamide (modified His) residue at a conserved position. The diphthamide can be ADP-ribosylated by diphtheria toxin in the presence of NAD.
Probab=44.62  E-value=23  Score=29.05  Aligned_cols=14  Identities=36%  Similarity=0.712  Sum_probs=12.0

Q ss_pred             EEEEEEEeCCCCCC
Q psy104           28 KLRLTVVDTPGFGD   41 (86)
Q Consensus        28 ~l~LtIidTpGfGd   41 (86)
                      ...++++||||+-+
T Consensus        85 ~~~i~liDTPG~~~   98 (720)
T TIGR00490        85 EYLINLIDTPGHVD   98 (720)
T ss_pred             ceEEEEEeCCCccc
Confidence            57889999999865


No 165
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2).  eIF2 is a heterotrimeric translation initiation factor that consists of alpha, beta, and gamma subunits.  The GTP-bound gamma subunit also binds initiator methionyl-tRNA and delivers it to the 40S ribosomal subunit.  Following hydrolysis of GTP to GDP, eIF2:GDP is released from the ribosome.  The gamma subunit has no intrinsic GTPase activity, but is stimulated by the GTPase activating protein (GAP) eIF5, and GDP/GTP exchange is stimulated by the guanine nucleotide exchange factor (GEF) eIF2B.  eIF2B is a heteropentamer, and the epsilon chain binds eIF2.  Both eIF5 and eIF2B-epsilon are known to bind strongly to eIF2-beta, but have also been shown to bind directly to eIF2-gamma.  It is possible that eIF2-beta serves simply as a high-affinity docking site for eIF5 and eIF2B-epsilon, or that eIF2-beta serves a regulatory role.  eIF2-gamma is found only in eukaryotes and archaea.  It is closely related to SelB, the sel
Probab=44.47  E-value=16  Score=24.72  Aligned_cols=12  Identities=33%  Similarity=0.631  Sum_probs=10.2

Q ss_pred             EEEEEEeCCCCC
Q psy104           29 LRLTVVDTPGFG   40 (86)
Q Consensus        29 l~LtIidTpGfG   40 (86)
                      .+++++||||..
T Consensus        83 ~~i~~iDtPG~~   94 (203)
T cd01888          83 RHVSFVDCPGHE   94 (203)
T ss_pred             cEEEEEECCChH
Confidence            678999999954


No 166
>PLN03126 Elongation factor Tu; Provisional
Probab=44.42  E-value=37  Score=26.65  Aligned_cols=29  Identities=28%  Similarity=0.477  Sum_probs=17.3

Q ss_pred             cceEEEEEEEEEeecCeEEEEEEEeCCCCCC
Q psy104           11 KTTTIEKKSMDIEERGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        11 ~t~~I~~~~~~l~e~~~~l~LtIidTpGfGd   41 (86)
                      +...+......++.++  .+++++||||.-+
T Consensus       128 rGiTi~~~~~~~~~~~--~~i~liDtPGh~~  156 (478)
T PLN03126        128 RGITINTATVEYETEN--RHYAHVDCPGHAD  156 (478)
T ss_pred             CCeeEEEEEEEEecCC--cEEEEEECCCHHH
Confidence            3444554444444343  3678999999643


No 167
>PRK05433 GTP-binding protein LepA; Provisional
Probab=44.22  E-value=23  Score=28.57  Aligned_cols=18  Identities=39%  Similarity=0.582  Sum_probs=14.2

Q ss_pred             cCeEEEEEEEeCCCCCCc
Q psy104           25 RGVKLRLTVVDTPGFGDS   42 (86)
Q Consensus        25 ~~~~l~LtIidTpGfGd~   42 (86)
                      ++-.++|+++||||.-+.
T Consensus        70 dg~~~~lnLiDTPGh~dF   87 (600)
T PRK05433         70 DGETYILNLIDTPGHVDF   87 (600)
T ss_pred             CCCcEEEEEEECCCcHHH
Confidence            344688999999998764


No 168
>cd04154 Arl2 Arl2 subfamily.  Arl2 (Arf-like 2) GTPases are members of the Arf family that bind GDP and GTP with very low affinity.  Unlike most Arf family proteins, Arl2 is not myristoylated at its N-terminal helix.  The protein PDE-delta, first identified in photoreceptor rod cells, binds specifically to Arl2 and is structurally very similar to RhoGDI.  Despite the high structural similarity between Arl2 and Rho proteins and between PDE-delta and RhoGDI, the interactions between the GTPases and their effectors are very different.  In its GTP bound form, Arl2 interacts with the protein Binder of Arl2 (BART), and the complex is believed to play a role in mitochondrial adenine nucleotide transport.  In its GDP bound form, Arl2 interacts with tubulin- folding Cofactor D; this interaction is believed to play a role in regulation of microtubule dynamics that impact the cytoskeleton, cell division, and cytokinesis.
Probab=44.20  E-value=34  Score=21.95  Aligned_cols=13  Identities=23%  Similarity=0.325  Sum_probs=10.5

Q ss_pred             EEEEEEEeCCCCC
Q psy104           28 KLRLTVVDTPGFG   40 (86)
Q Consensus        28 ~l~LtIidTpGfG   40 (86)
                      .+.|.++||||-.
T Consensus        57 ~~~l~l~D~~G~~   69 (173)
T cd04154          57 GYKLNIWDVGGQK   69 (173)
T ss_pred             CEEEEEEECCCCH
Confidence            3678999999954


No 169
>cd04148 RGK RGK subfamily.  The RGK (Rem, Rem2, Rad, Gem/Kir) subfamily of Ras GTPases are expressed in a tissue-specific manner and are dynamically regulated by transcriptional and posttranscriptional mechanisms in response to environmental cues.   RGK proteins bind to the beta subunit of L-type calcium channels, causing functional down-regulation of these voltage-dependent calcium channels, and either termination of calcium-dependent secretion or modulation of electrical conduction and contractile function.  Inhibition of L-type calcium channels by Rem2 may provide a mechanism for modulating calcium-triggered exocytosis in hormone-secreting cells, and has been proposed to influence the secretion of insulin in pancreatic beta cells.  RGK proteins also interact with and inhibit the Rho/Rho kinase pathway to modulate remodeling of the cytoskeleton.  Two characteristics of RGK proteins cited in the literature are N-terminal and C-terminal extensions beyond the GTPase domain typical of Ra
Probab=44.19  E-value=57  Score=22.31  Aligned_cols=16  Identities=25%  Similarity=0.189  Sum_probs=13.2

Q ss_pred             cCeEEEEEEEeCCCCC
Q psy104           25 RGVKLRLTVVDTPGFG   40 (86)
Q Consensus        25 ~~~~l~LtIidTpGfG   40 (86)
                      ++....|.++||||..
T Consensus        46 ~~~~~~l~i~Dt~G~~   61 (221)
T cd04148          46 DGEESTLVVIDHWEQE   61 (221)
T ss_pred             CCEEEEEEEEeCCCcc
Confidence            3457889999999986


No 170
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins. Myosin IX is a processive single-headed motor, which might play a role in signalling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the hea
Probab=44.15  E-value=38  Score=27.91  Aligned_cols=36  Identities=31%  Similarity=0.575  Sum_probs=25.5

Q ss_pred             EEEEEEEeCCCCCCccCCccchhHH-HHHHHHHHHHhh
Q psy104           28 KLRLTVVDTPGFGDSINSEESWRAC-CSYIDDQFRQYF   64 (86)
Q Consensus        28 ~l~LtIidTpGfGd~i~n~~~~~~i-~~yI~~qf~~yl   64 (86)
                      ...+.|.|.+||=. ..+.++++.+ ++|..++...++
T Consensus       375 ~~~IgiLDI~GFE~-f~~~NsfEQLcINyaNEkLQ~~f  411 (692)
T cd01385         375 GLSIGVLDIFGFED-FGRCNSFEQLCINYANEQLQYYF  411 (692)
T ss_pred             ceEEEEEecCcccc-CCCCCCHHHHhhHHHHHHHHHHH
Confidence            35688999999943 3333566744 889888877764


No 171
>cd01871 Rac1_like Rac1-like subfamily.  The Rac1-like subfamily consists of Rac1, Rac2, and Rac3 proteins, plus the splice variant Rac1b that contains a 19-residue insertion near switch II relative to Rac1.  While Rac1 is ubiquitously expressed, Rac2 and Rac3 are largely restricted to hematopoietic and neural tissues respectively.  Rac1 stimulates the formation of actin lamellipodia and membrane ruffles.  It also plays a role in cell-matrix adhesion and cell anoikis.  In intestinal epithelial cells, Rac1 is an important regulator of migration and mediates apoptosis.  Rac1 is also essential for RhoA-regulated actin stress fiber and focal adhesion complex formation.  In leukocytes, Rac1 and Rac2 have distinct roles in regulating cell morphology, migration, and invasion, but are not essential for macrophage migration or chemotaxis.  Rac3 has biochemical properties that are closely related to Rac1, such as effector interaction, nucleotide binding, and hydrolysis; Rac2 has a slower nucleoti
Probab=43.97  E-value=53  Score=21.37  Aligned_cols=20  Identities=25%  Similarity=0.340  Sum_probs=15.1

Q ss_pred             EEeecCeEEEEEEEeCCCCC
Q psy104           21 DIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        21 ~l~e~~~~l~LtIidTpGfG   40 (86)
                      .+.-++-.++|.+.||||-.
T Consensus        41 ~~~~~~~~~~l~i~Dt~G~~   60 (174)
T cd01871          41 NVMVDGKPVNLGLWDTAGQE   60 (174)
T ss_pred             EEEECCEEEEEEEEECCCch
Confidence            33445678999999999854


No 172
>PRK03003 GTP-binding protein Der; Reviewed
Probab=43.63  E-value=1.5e+02  Score=22.88  Aligned_cols=11  Identities=64%  Similarity=0.939  Sum_probs=9.3

Q ss_pred             EEEEEeCCCCC
Q psy104           30 RLTVVDTPGFG   40 (86)
Q Consensus        30 ~LtIidTpGfG   40 (86)
                      .+.++||||+.
T Consensus        87 ~~~l~DT~G~~   97 (472)
T PRK03003         87 RFTVVDTGGWE   97 (472)
T ss_pred             EEEEEeCCCcC
Confidence            47789999986


No 173
>cd04147 Ras_dva Ras-dva subfamily.  Ras-dva (Ras - dorsal-ventral anterior localization) subfamily consists of a set of proteins characterized only in Xenopus leavis, to date.  In Xenopus Ras-dva expression is activated by the transcription factor Otx2 and begins during gastrulation throughout the anterior ectoderm.  Ras-dva expression is inhibited in the anterior neural plate by factor Xanf1.  Downregulation of Ras-dva results in head development abnormalities through the inhibition of several regulators of the anterior neural plate and folds patterning, including Otx2, BF-1, Xag2, Pax6, Slug, and Sox9.  Downregulation of Ras-dva also interferes with the FGF-8a signaling within the anterior ectoderm.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Probab=43.59  E-value=48  Score=21.97  Aligned_cols=17  Identities=47%  Similarity=0.685  Sum_probs=13.4

Q ss_pred             eecCeEEEEEEEeCCCC
Q psy104           23 EERGVKLRLTVVDTPGF   39 (86)
Q Consensus        23 ~e~~~~l~LtIidTpGf   39 (86)
                      .-++..++|+++||||.
T Consensus        41 ~~~~~~~~l~i~D~~G~   57 (198)
T cd04147          41 EVGGVSLTLDILDTSGS   57 (198)
T ss_pred             EECCEEEEEEEEECCCc
Confidence            33456789999999995


No 174
>cd01870 RhoA_like RhoA-like subfamily.  The RhoA subfamily consists of RhoA, RhoB, and RhoC.  RhoA promotes the formation of stress fibers and focal adhesions, regulating cell shape, attachment, and motility.  RhoA can bind to multiple effector proteins, thereby triggering different downstream responses.  In many cell types, RhoA mediates local assembly of the contractile ring, which is necessary for cytokinesis.  RhoA is vital for muscle contraction; in vascular smooth muscle cells, RhoA plays a key role in cell contraction, differentiation, migration, and proliferation.  RhoA activities appear to be elaborately regulated in a time- and space-dependent manner to control cytoskeletal changes.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  RhoA and RhoC are observed only in geranyl
Probab=43.46  E-value=54  Score=20.77  Aligned_cols=18  Identities=39%  Similarity=0.543  Sum_probs=13.6

Q ss_pred             EeecCeEEEEEEEeCCCC
Q psy104           22 IEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        22 l~e~~~~l~LtIidTpGf   39 (86)
                      +.-++-.+.|.+.||||-
T Consensus        42 ~~~~~~~~~l~i~Dt~G~   59 (175)
T cd01870          42 IEVDGKQVELALWDTAGQ   59 (175)
T ss_pred             EEECCEEEEEEEEeCCCc
Confidence            343456789999999994


No 175
>cd04157 Arl6 Arl6 subfamily.  Arl6 (Arf-like 6) forms a subfamily of the Arf family of small GTPases.  Arl6 expression is limited to the brain and kidney in adult mice, but it is expressed in the neural plate and somites during embryogenesis, suggesting a possible role for Arl6 in early development.  Arl6 is also believed to have a role in cilia or flagella function.  Several proteins have been identified that bind Arl6, including Arl6 interacting protein (Arl6ip), and SEC61beta, a subunit of the heterotrimeric conducting channel SEC61p.  Based on Arl6 binding to these effectors, Arl6 is also proposed to play a role in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation.  At least three specific homozygous Arl6 mutations in humans have been found to cause Bardet-Biedl syndrome, a disorder characterized by obesity, retinopathy, polydactyly, renal and cardiac malformations, learning disabilities, and hypogenitalism.  Older literature suggests that A
Probab=43.26  E-value=20  Score=22.36  Aligned_cols=13  Identities=38%  Similarity=0.626  Sum_probs=11.0

Q ss_pred             EEEEEEEeCCCCC
Q psy104           28 KLRLTVVDTPGFG   40 (86)
Q Consensus        28 ~l~LtIidTpGfG   40 (86)
                      .++++++||||..
T Consensus        44 ~~~~~l~Dt~G~~   56 (162)
T cd04157          44 NLSFTAFDMSGQG   56 (162)
T ss_pred             CEEEEEEECCCCH
Confidence            5778999999975


No 176
>cd00876 Ras Ras family.  The Ras family of the Ras superfamily includes classical N-Ras, H-Ras, and K-Ras, as well as R-Ras, Rap, Ral, Rheb, Rhes, ARHI, RERG, Rin/Rit, RSR1, RRP22, Ras2, Ras-dva, and RGK proteins.  Ras proteins regulate cell growth, proliferation and differentiation.  Ras is activated by guanine nucleotide exchange factors (GEFs) that release GDP and allow GTP binding.  Many RasGEFs have been identified.  These are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active GTP-bound Ras interacts with several effector proteins: among the best characterized are the Raf kinases, phosphatidylinositol 3-kinase (PI3K), RalGEFs and NORE/MST1.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of m
Probab=43.24  E-value=63  Score=19.76  Aligned_cols=18  Identities=28%  Similarity=0.374  Sum_probs=13.6

Q ss_pred             eecCeEEEEEEEeCCCCC
Q psy104           23 EERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        23 ~e~~~~l~LtIidTpGfG   40 (86)
                      .-++..+++.++|+||-.
T Consensus        41 ~~~~~~~~~~l~D~~g~~   58 (160)
T cd00876          41 VVDGETYTLDILDTAGQE   58 (160)
T ss_pred             EECCEEEEEEEEECCChH
Confidence            344567889999999954


No 177
>cd01874 Cdc42 Cdc42 subfamily.  Cdc42 is an essential GTPase that belongs to the Rho family of Ras-like GTPases.  These proteins act as molecular switches by responding to exogenous and/or endogenous signals and relaying those signals to activate downstream components of a biological pathway.  Cdc42 transduces signals to the actin cytoskeleton to initiate and maintain polarized growth and to mitogen-activated protein morphogenesis. In the budding yeast Saccharomyces cerevisiae, Cdc42 plays an important role in multiple actin-dependent morphogenetic events such as bud emergence, mating-projection formation, and pseudohyphal growth.  In mammalian cells, Cdc42 regulates a variety of actin-dependent events and induces the JNK/SAPK protein kinase cascade, which leads to the activation of transcription factors within the nucleus.  Cdc42 mediates these processes through interactions with a myriad of downstream effectors, whose number and regulation we are just starting to understand.  In addi
Probab=42.78  E-value=56  Score=21.26  Aligned_cols=20  Identities=25%  Similarity=0.282  Sum_probs=15.2

Q ss_pred             EEeecCeEEEEEEEeCCCCC
Q psy104           21 DIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        21 ~l~e~~~~l~LtIidTpGfG   40 (86)
                      .+.-++-+++|.|.||+|-.
T Consensus        41 ~~~~~~~~~~l~i~Dt~G~~   60 (175)
T cd01874          41 TVMIGGEPYTLGLFDTAGQE   60 (175)
T ss_pred             EEEECCEEEEEEEEECCCcc
Confidence            34445678999999999864


No 178
>CHL00071 tufA elongation factor Tu
Probab=42.68  E-value=43  Score=25.42  Aligned_cols=29  Identities=28%  Similarity=0.457  Sum_probs=17.0

Q ss_pred             cceEEEEEEEEEeecCeEEEEEEEeCCCCCC
Q psy104           11 KTTTIEKKSMDIEERGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        11 ~t~~I~~~~~~l~e~~~~l~LtIidTpGfGd   41 (86)
                      +...+......++.++  .+++++||||..+
T Consensus        59 rg~T~~~~~~~~~~~~--~~~~~iDtPGh~~   87 (409)
T CHL00071         59 RGITINTAHVEYETEN--RHYAHVDCPGHAD   87 (409)
T ss_pred             CCEeEEccEEEEccCC--eEEEEEECCChHH
Confidence            3444554444444333  3567999999653


No 179
>PRK13796 GTPase YqeH; Provisional
Probab=42.63  E-value=25  Score=26.36  Aligned_cols=28  Identities=18%  Similarity=0.292  Sum_probs=16.8

Q ss_pred             EEEeCCCCCCccCCccchhHHHHHHHHHHHHhhhh
Q psy104           32 TVVDTPGFGDSINSEESWRACCSYIDDQFRQYFND   66 (86)
Q Consensus        32 tIidTpGfGd~i~n~~~~~~i~~yI~~qf~~yl~e   66 (86)
                      .++||||+-.    ..   .+.+|++.+-...+..
T Consensus       213 ~l~DTPGi~~----~~---~~~~~l~~~~l~~~~p  240 (365)
T PRK13796        213 FLYDTPGIIH----RH---QMAHYLSAKDLKIISP  240 (365)
T ss_pred             EEEECCCccc----cc---hhhhcCCHHHHhhcCC
Confidence            6999999941    11   2456666555544433


No 180
>cd04140 ARHI_like ARHI subfamily.  ARHI (A Ras homolog member I) is a member of the Ras family with several unique structural and functional properties.  ARHI is expressed in normal human ovarian and breast tissue, but its expression is decreased or eliminated in breast and ovarian cancer.  ARHI contains an N-terminal extension of 34 residues (human) that is required to retain its tumor suppressive activity.   Unlike most other Ras family members, ARHI is maintained in the constitutively active (GTP-bound) state in resting cells and has modest GTPase activity.  ARHI inhibits STAT3 (signal transducers and activators of transcription 3), a latent transcription factor whose abnormal activation plays a critical role in oncogenesis.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.  Due to
Probab=42.63  E-value=59  Score=20.56  Aligned_cols=19  Identities=26%  Similarity=0.190  Sum_probs=14.2

Q ss_pred             EeecCeEEEEEEEeCCCCC
Q psy104           22 IEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        22 l~e~~~~l~LtIidTpGfG   40 (86)
                      +.-++-.+.|.+.||||.-
T Consensus        42 ~~~~~~~~~l~i~Dt~G~~   60 (165)
T cd04140          42 ISCSKNICTLQITDTTGSH   60 (165)
T ss_pred             EEECCEEEEEEEEECCCCC
Confidence            3334457899999999964


No 181
>PTZ00369 Ras-like protein; Provisional
Probab=42.46  E-value=60  Score=21.28  Aligned_cols=17  Identities=24%  Similarity=0.309  Sum_probs=13.2

Q ss_pred             cCeEEEEEEEeCCCCCC
Q psy104           25 RGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        25 ~~~~l~LtIidTpGfGd   41 (86)
                      ++-.+.|.+.||||.-+
T Consensus        49 ~~~~~~l~i~Dt~G~~~   65 (189)
T PTZ00369         49 DEETCLLDILDTAGQEE   65 (189)
T ss_pred             CCEEEEEEEEeCCCCcc
Confidence            45578899999999543


No 182
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed
Probab=42.42  E-value=44  Score=25.81  Aligned_cols=26  Identities=23%  Similarity=0.595  Sum_probs=16.1

Q ss_pred             ceEEEEEEEEEeecCeEEEEEEEeCCCCCC
Q psy104           12 TTTIEKKSMDIEERGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        12 t~~I~~~~~~l~e~~~~l~LtIidTpGfGd   41 (86)
                      |..+....+.+  +|.  .++++||||+.+
T Consensus       250 T~d~~~~~i~~--~g~--~i~l~DT~G~~~  275 (449)
T PRK05291        250 TRDVIEEHINL--DGI--PLRLIDTAGIRE  275 (449)
T ss_pred             ccccEEEEEEE--CCe--EEEEEeCCCCCC
Confidence            44444444444  444  468999999964


No 183
>PRK00049 elongation factor Tu; Reviewed
Probab=42.25  E-value=35  Score=25.78  Aligned_cols=29  Identities=24%  Similarity=0.392  Sum_probs=17.4

Q ss_pred             CcceEEEEEEEEEeecCeEEEEEEEeCCCCC
Q psy104           10 GKTTTIEKKSMDIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        10 ~~t~~I~~~~~~l~e~~~~l~LtIidTpGfG   40 (86)
                      .....+......++.++  ..++++||||..
T Consensus        58 ~rg~Ti~~~~~~~~~~~--~~i~~iDtPG~~   86 (396)
T PRK00049         58 ARGITINTAHVEYETEK--RHYAHVDCPGHA   86 (396)
T ss_pred             hcCeEEeeeEEEEcCCC--eEEEEEECCCHH
Confidence            34445555444554443  356899999974


No 184
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily.  BipA is a protein belonging to the ribosome-binding family of GTPases and is widely distributed in bacteria and plants.  BipA was originally described as a protein that is induced in Salmonella typhimurium after exposure to bactericidal/permeability-inducing protein (a cationic antimicrobial protein produced by neutrophils), and has since been identified in E. coli as well.  The properties thus far described for BipA are related to its role in the process of pathogenesis by enteropathogenic E. coli.  It appears to be involved in the regulation of several processes important for infection, including rearrangements of the cytoskeleton of the host, bacterial resistance to host defense peptides, flagellum-mediated cell motility, and expression of K5 capsular genes.  It has been proposed that BipA may utilize a novel mechanism to regulate the expression of target genes.  In addition, BipA from enteropathogenic E. co
Probab=42.03  E-value=20  Score=23.67  Aligned_cols=14  Identities=43%  Similarity=0.909  Sum_probs=11.2

Q ss_pred             EEEEEEEeCCCCCC
Q psy104           28 KLRLTVVDTPGFGD   41 (86)
Q Consensus        28 ~l~LtIidTpGfGd   41 (86)
                      ..+++++||||..+
T Consensus        64 ~~~~~l~DtpG~~~   77 (194)
T cd01891          64 DTKINIVDTPGHAD   77 (194)
T ss_pred             CEEEEEEECCCcHH
Confidence            36789999999754


No 185
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily.  Rheb was initially identified in rat brain, where its expression is elevated by seizures or by long-term potentiation.  It is expressed ubiquitously, with elevated levels in muscle and brain.  Rheb functions as an important mediator between the tuberous sclerosis complex proteins, TSC1 and TSC2, and the mammalian target of rapamycin (TOR) kinase to stimulate cell growth.  TOR kinase regulates cell growth by controlling nutrient availability, growth factors, and the energy status of the cell.  TSC1 and TSC2 form a dimeric complex that has tumor suppressor activity, and TSC2 is a GTPase activating protein (GAP) for Rheb.  The TSC1/TSC2 complex inhibits the activation of TOR kinase through Rheb.  Rheb has also been shown to induce the formation of large cytoplasmic vacuoles in a process that is dependent on the GTPase cycle of Rheb, but independent of the TOR kinase, suggesting Rheb plays a role in endocytic trafficking that le
Probab=41.83  E-value=57  Score=20.83  Aligned_cols=19  Identities=37%  Similarity=0.573  Sum_probs=14.3

Q ss_pred             EeecCeEEEEEEEeCCCCC
Q psy104           22 IEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        22 l~e~~~~l~LtIidTpGfG   40 (86)
                      +.-++..+.+.++||||..
T Consensus        42 ~~~~~~~~~~~l~D~~g~~   60 (180)
T cd04137          42 IRYKGQDYHLEIVDTAGQD   60 (180)
T ss_pred             EEECCEEEEEEEEECCChH
Confidence            3444567889999999964


No 186
>cd01875 RhoG RhoG subfamily.  RhoG is a GTPase with high sequence similarity to members of the Rac subfamily, including the regions involved in effector recognition and binding.  However, RhoG does not bind to known Rac1 and Cdc42 effectors, including proteins containing a Cdc42/Rac interacting binding (CRIB) motif.  Instead, RhoG interacts directly with Elmo, an upstream regulator of Rac1, in a GTP-dependent manner and forms a ternary complex with Dock180 to induce activation of Rac1.  The RhoG-Elmo-Dock180 pathway is required for activation of Rac1 and cell spreading mediated by integrin, as well as for neurite outgrowth induced by nerve growth factor.  Thus RhoG activates Rac1 through Elmo and Dock180 to control cell morphology.  RhoG has also been shown to play a role in caveolar trafficking and has a novel role in signaling the neutrophil respiratory burst stimulated by G protein-coupled receptor (GPCR) agonists.  Most Rho proteins contain a lipid modification site at the C-termin
Probab=41.74  E-value=1e+02  Score=20.33  Aligned_cols=18  Identities=28%  Similarity=0.348  Sum_probs=13.9

Q ss_pred             EeecCeEEEEEEEeCCCC
Q psy104           22 IEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        22 l~e~~~~l~LtIidTpGf   39 (86)
                      +.-++-.++|.|.||+|-
T Consensus        44 ~~~~~~~~~l~i~Dt~G~   61 (191)
T cd01875          44 TAVDGRTVSLNLWDTAGQ   61 (191)
T ss_pred             EEECCEEEEEEEEECCCc
Confidence            333567899999999983


No 187
>TIGR02584 cas_NE0113 CRISPR-associated protein, NE0113 family. Members of this minor CRISPR-associated (Cas) protein family are found in cas gene clusters in Vibrio vulnificus YJ016, Nitrosomonas europaea ATCC 19718, Mannheimia succiniciproducens MBEL55E, and Verrucomicrobium spinosum.
Probab=41.41  E-value=17  Score=25.82  Aligned_cols=11  Identities=9%  Similarity=-0.000  Sum_probs=9.1

Q ss_pred             CCCCeeEEeec
Q psy104           75 IVDNREVVDKS   85 (86)
Q Consensus        75 ~~D~RVH~Cl~   85 (86)
                      -+|.|+|+||+
T Consensus       116 d~~~~lH~sIA  126 (209)
T TIGR02584       116 AQDHQLHASIA  126 (209)
T ss_pred             CCCCEEEEEec
Confidence            35789999997


No 188
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed
Probab=41.32  E-value=1.7e+02  Score=24.07  Aligned_cols=13  Identities=31%  Similarity=0.524  Sum_probs=10.5

Q ss_pred             EEEEEEeCCCCCC
Q psy104           29 LRLTVVDTPGFGD   41 (86)
Q Consensus        29 l~LtIidTpGfGd   41 (86)
                      ..++++||||+..
T Consensus       323 ~~~~liDT~G~~~  335 (712)
T PRK09518        323 TDFKLVDTGGWEA  335 (712)
T ss_pred             EEEEEEeCCCcCC
Confidence            3577899999974


No 189
>smart00242 MYSc Myosin. Large ATPases. ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin.
Probab=41.25  E-value=47  Score=27.20  Aligned_cols=36  Identities=22%  Similarity=0.390  Sum_probs=26.3

Q ss_pred             eEEEEEEEeCCCCCCccCCccchhHH-HHHHHHHHHHhh
Q psy104           27 VKLRLTVVDTPGFGDSINSEESWRAC-CSYIDDQFRQYF   64 (86)
Q Consensus        27 ~~l~LtIidTpGfGd~i~n~~~~~~i-~~yI~~qf~~yl   64 (86)
                      ....+.|+|.|||=..-.  ++|+.+ ++|..+++..++
T Consensus       367 ~~~~IgiLDifGFE~f~~--NsfEQLcINyaNEkLq~~f  403 (677)
T smart00242      367 STYFIGVLDIYGFEIFEV--NSFEQLCINYANEKLQQFF  403 (677)
T ss_pred             CceEEEEEeccccccccc--CCHHHHHhHhhHHHHHHHH
Confidence            456789999999954433  467754 899998887764


No 190
>PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated
Probab=41.17  E-value=17  Score=27.35  Aligned_cols=15  Identities=40%  Similarity=0.689  Sum_probs=11.4

Q ss_pred             cCeEEEEEEEeCCCCC
Q psy104           25 RGVKLRLTVVDTPGFG   40 (86)
Q Consensus        25 ~~~~l~LtIidTpGfG   40 (86)
                      .++|+ ++++|||||-
T Consensus       150 f~lPI-VtlvDTpGa~  164 (319)
T PRK05724        150 FGLPI-ITFIDTPGAY  164 (319)
T ss_pred             cCCCE-EEEEeCCCCC
Confidence            34554 8999999995


No 191
>PF12508 DUF3714:  Protein of unknown function (DUF3714) ;  InterPro: IPR022187  Proteins in this entry are designated TraM and are found in a proposed transfer region of a class of conjugative transposon found in the Bacteroides lineage. 
Probab=40.99  E-value=57  Score=22.93  Aligned_cols=29  Identities=21%  Similarity=0.240  Sum_probs=22.9

Q ss_pred             cceEEEEEEEEEeecCeEEEEEEEeCCCC
Q psy104           11 KTTTIEKKSMDIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        11 ~t~~I~~~~~~l~e~~~~l~LtIidTpGf   39 (86)
                      +-+.|...++.+..+=+|+.|++.|+.|.
T Consensus       101 ~Rl~i~I~SI~~~~~IipV~L~vYD~DG~  129 (200)
T PF12508_consen  101 QRLLITITSIEYGGNIIPVELSVYDLDGQ  129 (200)
T ss_pred             cEEEEEEEEEEECCEEEEEEEEEECCCCC
Confidence            34667777777766668999999999875


No 192
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional
Probab=40.86  E-value=34  Score=26.73  Aligned_cols=27  Identities=22%  Similarity=0.310  Sum_probs=16.1

Q ss_pred             ceEEEEEEEEEeecCeEEEEEEEeCCCCC
Q psy104           12 TTTIEKKSMDIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        12 t~~I~~~~~~l~e~~~~l~LtIidTpGfG   40 (86)
                      .++|......++.++  ..++++||||.-
T Consensus        92 giTid~~~~~~~~~~--~~i~~iDTPGh~  118 (474)
T PRK05124         92 GITIDVAYRYFSTEK--RKFIIADTPGHE  118 (474)
T ss_pred             CCCeEeeEEEeccCC--cEEEEEECCCcH
Confidence            344554444444443  367899999953


No 193
>PTZ00132 GTP-binding nuclear protein Ran; Provisional
Probab=40.80  E-value=98  Score=20.69  Aligned_cols=30  Identities=20%  Similarity=0.139  Sum_probs=20.3

Q ss_pred             CcceEEEEEEEEEeecCeEEEEEEEeCCCC
Q psy104           10 GKTTTIEKKSMDIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        10 ~~t~~I~~~~~~l~e~~~~l~LtIidTpGf   39 (86)
                      ..|+.+..+...+..++-.+.+.+.||||-
T Consensus        39 ~~t~~~~~~~~~~~~~~~~i~i~~~Dt~g~   68 (215)
T PTZ00132         39 IPTLGVEVHPLKFYTNCGPICFNVWDTAGQ   68 (215)
T ss_pred             CCccceEEEEEEEEECCeEEEEEEEECCCc
Confidence            345555555555555566789999999984


No 194
>PRK12736 elongation factor Tu; Reviewed
Probab=40.76  E-value=33  Score=25.92  Aligned_cols=27  Identities=26%  Similarity=0.409  Sum_probs=16.1

Q ss_pred             cceEEEEEEEEEeecCeEEEEEEEeCCCC
Q psy104           11 KTTTIEKKSMDIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        11 ~t~~I~~~~~~l~e~~~~l~LtIidTpGf   39 (86)
                      +..++......++.++  -.++++||||.
T Consensus        59 rg~T~~~~~~~~~~~~--~~i~~iDtPGh   85 (394)
T PRK12736         59 RGITINTAHVEYETEK--RHYAHVDCPGH   85 (394)
T ss_pred             cCccEEEEeeEecCCC--cEEEEEECCCH
Confidence            3444544444444433  35689999995


No 195
>cd04139 RalA_RalB RalA/RalB subfamily.  The Ral (Ras-like) subfamily consists of the highly homologous RalA and RalB.  Ral proteins are believed to play a crucial role in tumorigenesis, metastasis, endocytosis, and actin cytoskeleton dynamics.  Despite their high sequence similarity (80% sequence identity), nonoverlapping and opposing functions have been assigned to RalA and RalBs in tumor migration.  In human bladder and prostate cancer cells, RalB promotes migration while RalA inhibits it.  A Ral-specific set of GEFs has been identified that are activated by Ras binding.  This RalGEF activity is enhanced by Ras binding to another of its target proteins, phosphatidylinositol 3-kinase (PI3K).   Ral effectors include RLIP76/RalBP1, a Rac/cdc42 GAP, and the exocyst (Sec6/8) complex, a heterooctomeric protein complex that is involved in tethering vesicles to specific sites on the plasma membrane prior to exocytosis.  In rat kidney cells, RalB is required for functional assembly of the exo
Probab=40.74  E-value=64  Score=19.88  Aligned_cols=17  Identities=29%  Similarity=0.479  Sum_probs=13.3

Q ss_pred             eecCeEEEEEEEeCCCC
Q psy104           23 EERGVKLRLTVVDTPGF   39 (86)
Q Consensus        23 ~e~~~~l~LtIidTpGf   39 (86)
                      .-++-.+.+.++||||.
T Consensus        42 ~~~~~~~~~~i~D~~g~   58 (164)
T cd04139          42 VLDGEDVQLNILDTAGQ   58 (164)
T ss_pred             EECCEEEEEEEEECCCh
Confidence            34556788999999994


No 196
>TIGR02836 spore_IV_A stage IV sporulation protein A. A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is designated stage IV sporulation protein A. It acts in the mother cell compartment and plays a role in spore coat morphogenesis.
Probab=40.47  E-value=19  Score=28.65  Aligned_cols=26  Identities=23%  Similarity=0.511  Sum_probs=19.4

Q ss_pred             EEEEEe-ecCeEEEEEEEeCCCCCCcc
Q psy104           18 KSMDIE-ERGVKLRLTVVDTPGFGDSI   43 (86)
Q Consensus        18 ~~~~l~-e~~~~l~LtIidTpGfGd~i   43 (86)
                      ..++|. .+++..++.+|||+||.+.-
T Consensus        79 kAvEI~~~~~~~~~VrlIDcvG~~v~G  105 (492)
T TIGR02836        79 EAVEININEGTKFKVRLVDCVGYTVKG  105 (492)
T ss_pred             cceEEeccCCCcccEEEEECCCcccCC
Confidence            334553 45788999999999998753


No 197
>cd04177 RSR1 RSR1 subgroup.  RSR1/Bud1p is a member of the Rap subfamily of the Ras family that is found in fungi.  In budding yeasts, RSR1 is involved in selecting a site for bud growth on the cell cortex, which directs the establishment of cell polarization.  The Rho family GTPase cdc42 and its GEF, cdc24, then establish an axis of polarized growth by organizing the actin cytoskeleton and secretory apparatus at the bud site.  It is believed that cdc42 interacts directly with RSR1 in vivo.  In filamentous fungi, polar growth occurs at the tips of hypha and at novel growth sites along the extending hypha.  In Ashbya gossypii, RSR1 is a key regulator of hyphal growth, localizing at the tip region and regulating in apical polarization of the actin cytoskeleton.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key featu
Probab=40.44  E-value=63  Score=20.49  Aligned_cols=17  Identities=29%  Similarity=0.417  Sum_probs=13.2

Q ss_pred             ecCeEEEEEEEeCCCCC
Q psy104           24 ERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        24 e~~~~l~LtIidTpGfG   40 (86)
                      -++..+++.++||||.-
T Consensus        44 ~~~~~~~~~i~Dt~G~~   60 (168)
T cd04177          44 IDGRQCDLEILDTAGTE   60 (168)
T ss_pred             ECCEEEEEEEEeCCCcc
Confidence            34566899999999954


No 198
>PRK07560 elongation factor EF-2; Reviewed
Probab=40.25  E-value=29  Score=28.47  Aligned_cols=15  Identities=33%  Similarity=0.627  Sum_probs=12.1

Q ss_pred             eEEEEEEEeCCCCCC
Q psy104           27 VKLRLTVVDTPGFGD   41 (86)
Q Consensus        27 ~~l~LtIidTpGfGd   41 (86)
                      -...+++|||||+-+
T Consensus        85 ~~~~i~liDtPG~~d   99 (731)
T PRK07560         85 KEYLINLIDTPGHVD   99 (731)
T ss_pred             CcEEEEEEcCCCccC
Confidence            357889999999765


No 199
>PRK09563 rbgA GTPase YlqF; Reviewed
Probab=39.93  E-value=17  Score=26.16  Aligned_cols=13  Identities=38%  Similarity=0.506  Sum_probs=10.2

Q ss_pred             EEEEEeCCCCCCc
Q psy104           30 RLTVVDTPGFGDS   42 (86)
Q Consensus        30 ~LtIidTpGfGd~   42 (86)
                      .+.++||||+-..
T Consensus       167 ~~~l~DtPGi~~~  179 (287)
T PRK09563        167 GLELLDTPGILWP  179 (287)
T ss_pred             cEEEEECCCcCCC
Confidence            4679999999644


No 200
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha. This model represents the counterpart of bacterial EF-Tu for the Archaea (aEF-1 alpha) and Eukaryotes (eEF-1 alpha). The trusted cutoff is set fairly high so that incomplete sequences will score between suggested and trusted cutoff levels.
Probab=39.78  E-value=44  Score=25.37  Aligned_cols=26  Identities=31%  Similarity=0.487  Sum_probs=16.4

Q ss_pred             ceEEEEEEEEEeecCeEEEEEEEeCCCC
Q psy104           12 TTTIEKKSMDIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        12 t~~I~~~~~~l~e~~~~l~LtIidTpGf   39 (86)
                      +..+......+..++  ..++++||||.
T Consensus        70 g~Tid~~~~~~~~~~--~~i~iiDtpGh   95 (426)
T TIGR00483        70 GVTIDVAHWKFETDK--YEVTIVDCPGH   95 (426)
T ss_pred             CceEEEEEEEEccCC--eEEEEEECCCH
Confidence            444444444454443  57899999995


No 201
>PRK05346 Na(+)-translocating NADH-quinone reductase subunit C; Provisional
Probab=39.70  E-value=13  Score=26.97  Aligned_cols=20  Identities=35%  Similarity=0.572  Sum_probs=14.4

Q ss_pred             eEEEEEEE---eCCCCCCccCCc
Q psy104           27 VKLRLTVV---DTPGFGDSINSE   46 (86)
Q Consensus        27 ~~l~LtIi---dTpGfGd~i~n~   46 (86)
                      .-.-+.+.   +|||+|+.+.+.
T Consensus       160 tI~gi~v~~h~ETPGLG~~i~~~  182 (256)
T PRK05346        160 TVKGLTFYEHGETPGLGGEIENP  182 (256)
T ss_pred             EEEEEEeeccCCCccccccccCh
Confidence            44455555   899999998765


No 202
>cd04165 GTPBP1_like GTPBP1-like.  Mammalian GTP binding protein 1 (GTPBP1), GTPBP2, and nematode homologs AGP-1 and CGP-1 are GTPases whose specific functions remain unknown.  In mouse, GTPBP1 is expressed in macrophages, in smooth muscle cells of various tissues and in some neurons of the cerebral cortex; GTPBP2 tissue distribution appears to overlap that of GTPBP1.  In human leukemia and macrophage cell lines, expression of both GTPBP1 and GTPBP2 is enhanced by interferon-gamma (IFN-gamma).  The chromosomal location of both genes has been identified in humans, with GTPBP1 located in chromosome 22q12-13.1 and GTPBP2 located in chromosome 6p21-12.  Human glioblastoma multiforme (GBM), a highly-malignant astrocytic glioma and the most common cancer in the central nervous system, has been linked to chromosomal deletions and a translocation on chromosome 6.  The GBM translocation results in a fusion of GTPBP2 and PTPRZ1, a protein involved in oligodendrocyte differentiation, recovery, and
Probab=39.52  E-value=21  Score=24.93  Aligned_cols=11  Identities=27%  Similarity=0.407  Sum_probs=9.2

Q ss_pred             EEEEEEeCCCC
Q psy104           29 LRLTVVDTPGF   39 (86)
Q Consensus        29 l~LtIidTpGf   39 (86)
                      -.++++||||.
T Consensus        84 ~~i~liDtpG~   94 (224)
T cd04165          84 KLVTFIDLAGH   94 (224)
T ss_pred             cEEEEEECCCc
Confidence            46889999995


No 203
>PRK00098 GTPase RsgA; Reviewed
Probab=39.44  E-value=32  Score=24.99  Aligned_cols=9  Identities=56%  Similarity=1.198  Sum_probs=8.1

Q ss_pred             EEEeCCCCC
Q psy104           32 TVVDTPGFG   40 (86)
Q Consensus        32 tIidTpGfG   40 (86)
                      .|+|||||-
T Consensus       219 ~~~DtpG~~  227 (298)
T PRK00098        219 LLIDTPGFS  227 (298)
T ss_pred             EEEECCCcC
Confidence            699999996


No 204
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily.  Arl2l1 (Arl2-like protein 1) and Arl13 form a subfamily of the Arf family of small GTPases.  Arl2l1 was identified in human cells during a search for the gene(s) responsible for Bardet-Biedl syndrome (BBS).  Like Arl6, the identified BBS gene, Arl2l1 is proposed to have cilia-specific functions.  Arl13 is found on the X chromosome, but its expression has not been confirmed; it may be a pseudogene.
Probab=39.35  E-value=53  Score=21.08  Aligned_cols=12  Identities=25%  Similarity=0.315  Sum_probs=10.0

Q ss_pred             EEEEEEEeCCCC
Q psy104           28 KLRLTVVDTPGF   39 (86)
Q Consensus        28 ~l~LtIidTpGf   39 (86)
                      .++++++||||-
T Consensus        42 ~~~~~i~D~~G~   53 (167)
T cd04161          42 KYEVCIFDLGGG   53 (167)
T ss_pred             CEEEEEEECCCc
Confidence            477899999994


No 205
>cd04133 Rop_like Rop subfamily.  The Rop (Rho-related protein from plants) subfamily plays a role in diverse cellular processes, including cytoskeletal organization, pollen and vegetative cell growth, hormone responses, stress responses, and pathogen resistance.  Rops are able to regulate several downstream pathways to amplify a specific signal by acting as master switches early in the signaling cascade.  They transmit a variety of extracellular and intracellular signals.  Rops are involved in establishing cell polarity in root-hair development, root-hair elongation, pollen-tube growth, cell-shape formation, responses to hormones such as abscisic acid (ABA) and auxin, responses to abiotic stresses such as oxygen deprivation, and disease resistance and disease susceptibility.  An individual Rop can have a unique function or an overlapping function shared with other Rop proteins; in addition, a given Rop-regulated function can be controlled by one or multiple Rop proteins.  For example, 
Probab=38.93  E-value=66  Score=21.29  Aligned_cols=20  Identities=25%  Similarity=0.380  Sum_probs=15.3

Q ss_pred             EEeecCeEEEEEEEeCCCCC
Q psy104           21 DIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        21 ~l~e~~~~l~LtIidTpGfG   40 (86)
                      .+.-++-.++|.|.||+|-.
T Consensus        41 ~~~~~~~~v~l~i~Dt~G~~   60 (176)
T cd04133          41 NVSVDGNTVNLGLWDTAGQE   60 (176)
T ss_pred             EEEECCEEEEEEEEECCCCc
Confidence            34446778999999999843


No 206
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily.  Arl4 (Arf-like 4) is highly expressed in testicular germ cells, and is found in the nucleus and nucleolus.  In mice, Arl4 is developmentally expressed during embryogenesis, and a role in somite formation and central nervous system differentiation has been proposed.  Arl7 has been identified as the only Arf/Arl protein to be induced by agonists of liver X-receptor and retinoid X-receptor and by cholesterol loading in human macrophages.  Arl7 is proposed to play a role in transport between a perinuclear compartment and the plasma membrane, apparently linked to the ABCA1-mediated cholesterol secretion pathway.  Older literature suggests that Arl6 is a part of the Arl4/Arl7 subfamily, but analyses based on more recent sequence data place Arl6 in its own subfamily.
Probab=38.84  E-value=46  Score=21.78  Aligned_cols=16  Identities=13%  Similarity=0.127  Sum_probs=12.4

Q ss_pred             cCeEEEEEEEeCCCCC
Q psy104           25 RGVKLRLTVVDTPGFG   40 (86)
Q Consensus        25 ~~~~l~LtIidTpGfG   40 (86)
                      ++-.+.|.+.||||-.
T Consensus        48 ~~~~~~l~l~Dt~G~~   63 (183)
T cd04152          48 NSKGITFHFWDVGGQE   63 (183)
T ss_pred             CCCceEEEEEECCCcH
Confidence            3456889999999963


No 207
>TIGR00475 selB selenocysteine-specific elongation factor SelB. In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor. 3-prime or 5-prime non-coding elements of mRNA have been found as probable structures for directing selenocysteine incorporation. This model describes the elongation factor SelB, a close homolog rf EF-Tu. It may function by replacing EF-Tu. A C-terminal domain not found in EF-Tu is in all SelB sequences in the seed alignment except that from Methanococcus jannaschii. This model does not find an equivalent protein for eukaryotes.
Probab=38.74  E-value=61  Score=26.00  Aligned_cols=12  Identities=42%  Similarity=0.800  Sum_probs=10.2

Q ss_pred             EEEEEEeCCCCC
Q psy104           29 LRLTVVDTPGFG   40 (86)
Q Consensus        29 l~LtIidTpGfG   40 (86)
                      ..++++||||.-
T Consensus        50 ~~v~~iDtPGhe   61 (581)
T TIGR00475        50 YRLGFIDVPGHE   61 (581)
T ss_pred             EEEEEEECCCHH
Confidence            788999999953


No 208
>PRK12740 elongation factor G; Reviewed
Probab=38.32  E-value=41  Score=27.09  Aligned_cols=27  Identities=30%  Similarity=0.547  Sum_probs=16.9

Q ss_pred             eEEEEEEEEEeecCeEEEEEEEeCCCCCC
Q psy104           13 TTIEKKSMDIEERGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        13 ~~I~~~~~~l~e~~~~l~LtIidTpGfGd   41 (86)
                      ..+......+.-++  ..++++||||..+
T Consensus        46 iTi~~~~~~~~~~~--~~i~liDtPG~~~   72 (668)
T PRK12740         46 ISITSAATTCEWKG--HKINLIDTPGHVD   72 (668)
T ss_pred             CCeeeceEEEEECC--EEEEEEECCCcHH
Confidence            33444434444444  6788999999865


No 209
>PRK12735 elongation factor Tu; Reviewed
Probab=38.12  E-value=43  Score=25.29  Aligned_cols=27  Identities=26%  Similarity=0.394  Sum_probs=15.8

Q ss_pred             ceEEEEEEEEEeecCeEEEEEEEeCCCCC
Q psy104           12 TTTIEKKSMDIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        12 t~~I~~~~~~l~e~~~~l~LtIidTpGfG   40 (86)
                      ...+......++.++  -.++++||||.-
T Consensus        60 GiT~~~~~~~~~~~~--~~i~~iDtPGh~   86 (396)
T PRK12735         60 GITINTSHVEYETAN--RHYAHVDCPGHA   86 (396)
T ss_pred             CceEEEeeeEEcCCC--cEEEEEECCCHH
Confidence            344444444444333  356899999974


No 210
>PRK00007 elongation factor G; Reviewed
Probab=37.95  E-value=43  Score=27.37  Aligned_cols=28  Identities=29%  Similarity=0.399  Sum_probs=17.1

Q ss_pred             ceEEEEEEEEEeecCeEEEEEEEeCCCCCC
Q psy104           12 TTTIEKKSMDIEERGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        12 t~~I~~~~~~l~e~~~~l~LtIidTpGfGd   41 (86)
                      ..++......+.-++  .++++|||||+-+
T Consensus        60 g~ti~~~~~~~~~~~--~~~~liDTPG~~~   87 (693)
T PRK00007         60 GITITSAATTCFWKD--HRINIIDTPGHVD   87 (693)
T ss_pred             CCCEeccEEEEEECC--eEEEEEeCCCcHH
Confidence            344544444444443  4788899999743


No 211
>PF09140 MipZ:  ATPase MipZ;  InterPro: IPR015223 Cell division in bacteria is facilitated by a polymeric ring structure, the Z ring, composed of tubulin-like FtsZ protofilaments. Correct positioning of the division plane is a prerequisite for the generation of daughter cells with a normal chromosome complement. In Caulobacter crescentus MipZ, an essential protein, coordinates and regulates the assembly of the FtsZ cytokinetic ring during cell division. MipZ, forms a complex with the partitioning protein ParB near the origin of replication and localizes with the duplicated origin regions to the cell poles. MipZ also directly interferes with FtsZ polymerisation, thereby restricting FtsZ ring formation to mid-cell, the region of lowest MipZ concentration.   In eukaryotes members of this entry belong to the Mrp/NBP35 ATP-binding protein family, and specifically the NUBP2/CFD1 subfamily. This includes the cytosolic Fe-S cluster assembly factor Cfd1, which is a component of the cytosolic iron-sulphur (Fe/S) protein assembly machinery. This protein is required for maturation of extra-mitochondrial Fe/S proteins. It may bind and transfer a labile 4Fe-4S cluster to target apoproteins. Cfd1 is also required for biogenesis and export of both ribosomal subunits, suggesting a role in assembly of the Fe/S clusters in RLI1, a protein which performs rRNA processing and ribosome export. ; PDB: 2XIT_B 2XJ4_A 2XJ9_A.
Probab=37.50  E-value=15  Score=26.97  Aligned_cols=14  Identities=50%  Similarity=0.826  Sum_probs=8.7

Q ss_pred             EEEEEEeCCCCCCc
Q psy104           29 LRLTVVDTPGFGDS   42 (86)
Q Consensus        29 l~LtIidTpGfGd~   42 (86)
                      +-+-||||||.++.
T Consensus        99 ~DfLVID~PGtd~~  112 (261)
T PF09140_consen   99 LDFLVIDTPGTDDR  112 (261)
T ss_dssp             -SEEEEEE-SSS-H
T ss_pred             CCEEEEeCCCCCcH
Confidence            44569999998764


No 212
>KOG1030|consensus
Probab=37.25  E-value=95  Score=21.38  Aligned_cols=52  Identities=17%  Similarity=0.199  Sum_probs=36.0

Q ss_pred             EEEEEEeecCeEEEEEEEeCCCCCCccCCccchhHHHHHHHHHHHHhhhhhc
Q psy104           17 KKSMDIEERGVKLRLTVVDTPGFGDSINSEESWRACCSYIDDQFRQYFNDES   68 (86)
Q Consensus        17 ~~~~~l~e~~~~l~LtIidTpGfGd~i~n~~~~~~i~~yI~~qf~~yl~eE~   68 (86)
                      ..++.+.+...+++|+|-|-..|-..---...=-+|..|++.+...||..|.
T Consensus        56 ~ltf~v~d~~~~lkv~VyD~D~fs~dD~mG~A~I~l~p~~~~~~~~~l~~~~  107 (168)
T KOG1030|consen   56 ELTFTVKDPNTPLKVTVYDKDTFSSDDFMGEATIPLKPLLEAQKMDYLKLEL  107 (168)
T ss_pred             eEEEEecCCCceEEEEEEeCCCCCcccccceeeeccHHHHHHhhhhcccccc
Confidence            3455667778899999999988853322222335778899998888866443


No 213
>cd04134 Rho3 Rho3 subfamily.  Rho3 is a member of the Rho family found only in fungi.  Rho3 is believed to regulate cell polarity by interacting with the diaphanous/formin family protein For3 to control both the actin cytoskeleton and microtubules.  Rho3 is also believed to have a direct role in exocytosis that is independent of its role in regulating actin polarity.  The function in exocytosis may be two-pronged: first, in the transport of post-Golgi vesicles from the mother cell to the bud, mediated by myosin (Myo2); second, in the docking and fusion of vesicles to the plasma membrane, mediated by an exocyst (Exo70) protein.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.
Probab=37.13  E-value=81  Score=20.69  Aligned_cols=18  Identities=33%  Similarity=0.488  Sum_probs=14.1

Q ss_pred             EeecCeEEEEEEEeCCCC
Q psy104           22 IEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        22 l~e~~~~l~LtIidTpGf   39 (86)
                      +.-++..+.|.+.||||-
T Consensus        41 i~~~~~~~~l~i~Dt~G~   58 (189)
T cd04134          41 IFVDGLHIELSLWDTAGQ   58 (189)
T ss_pred             EEECCEEEEEEEEECCCC
Confidence            344567789999999985


No 214
>KOG0465|consensus
Probab=36.92  E-value=39  Score=28.12  Aligned_cols=27  Identities=33%  Similarity=0.540  Sum_probs=16.3

Q ss_pred             eEEEEEEEEEeecCeEEEEEEEeCCCCCC
Q psy104           13 TTIEKKSMDIEERGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        13 ~~I~~~~~~l~e~~~~l~LtIidTpGfGd   41 (86)
                      +.|+..-....-.  ..++++|||||==|
T Consensus        90 ITiqSAAt~~~w~--~~~iNiIDTPGHvD  116 (721)
T KOG0465|consen   90 ITIQSAATYFTWR--DYRINIIDTPGHVD  116 (721)
T ss_pred             ceeeeceeeeeec--cceeEEecCCCcee
Confidence            4444443333322  67889999999643


No 215
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily.  Rnd1/Rho6 is a member of the novel Rho subfamily Rnd, together with Rnd2/Rho7 and Rnd3/RhoE/Rho8.  Rnd1/Rho6 binds GTP but does not hydrolyze it to GDP, indicating that it is constitutively active.  In rat, Rnd1/Rho6 is highly expressed in the cerebral cortex and hippocampus during synapse formation, and plays a role in spine formation.  Rnd1/Rho6 is also expressed in the liver and in endothelial cells, and is upregulated in uterine myometrial cells during pregnancy.  Like Rnd3/RhoE/Rho8, Rnd1/Rho6 is believed to function as an antagonist to RhoA.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=36.52  E-value=1.2e+02  Score=21.30  Aligned_cols=20  Identities=25%  Similarity=0.415  Sum_probs=15.7

Q ss_pred             EEEeecCeEEEEEEEeCCCC
Q psy104           20 MDIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        20 ~~l~e~~~~l~LtIidTpGf   39 (86)
                      ..+.-++..++|.|.||+|-
T Consensus        52 ~~i~~~~~~v~l~iwDTaG~   71 (232)
T cd04174          52 AGLETEEQRVELSLWDTSGS   71 (232)
T ss_pred             EEEEECCEEEEEEEEeCCCc
Confidence            34555677899999999984


No 216
>TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the alpha chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=36.38  E-value=22  Score=26.67  Aligned_cols=14  Identities=36%  Similarity=0.627  Sum_probs=10.9

Q ss_pred             CeEEEEEEEeCCCCC
Q psy104           26 GVKLRLTVVDTPGFG   40 (86)
Q Consensus        26 ~~~l~LtIidTpGfG   40 (86)
                      ++|+ ++++|||||-
T Consensus       151 ~iPv-VtlvDTpGa~  164 (316)
T TIGR00513       151 KMPI-ITFIDTPGAY  164 (316)
T ss_pred             CCCE-EEEEECCCCC
Confidence            4443 8999999985


No 217
>TIGR00487 IF-2 translation initiation factor IF-2. This model discriminates eubacterial (and mitochondrial) translation initiation factor 2 (IF-2), encoded by the infB gene in bacteria, from similar proteins in the Archaea and Eukaryotes. In the bacteria and in organelles, the initiator tRNA is charged with N-formyl-Met instead of Met. This translation factor acts in delivering the initator tRNA to the ribosome. It is one of a number of GTP-binding translation factors recognized by the pfam model GTP_EFTU.
Probab=36.15  E-value=48  Score=26.75  Aligned_cols=11  Identities=45%  Similarity=0.788  Sum_probs=9.5

Q ss_pred             EEEEEeCCCCC
Q psy104           30 RLTVVDTPGFG   40 (86)
Q Consensus        30 ~LtIidTpGfG   40 (86)
                      .++++||||--
T Consensus       136 ~i~~iDTPGhe  146 (587)
T TIGR00487       136 MITFLDTPGHE  146 (587)
T ss_pred             EEEEEECCCCc
Confidence            78999999964


No 218
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily.  H-Ras, N-Ras, and K-Ras4A/4B are the prototypical members of the Ras family.  These isoforms generate distinct signal outputs despite interacting with a common set of activators and effectors, and are strongly associated with oncogenic progression in tumor initiation.  Mutated versions of Ras that are insensitive to GAP stimulation (and are therefore constitutively active) are found in a significant fraction of human cancers.  Many Ras guanine nucleotide exchange factors (GEFs) have been identified.  They are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active (GTP-bound) Ras interacts with several effector proteins that stimulate a variety of diverse cytoplasmic signaling activities.  Some are known to positively mediate the oncogenic properties of Ras, including Raf, phosphatidylinositol 3-kinase (PI3K), RalGEFs, and Tiam1.  
Probab=36.02  E-value=94  Score=18.98  Aligned_cols=15  Identities=33%  Similarity=0.472  Sum_probs=11.8

Q ss_pred             cCeEEEEEEEeCCCC
Q psy104           25 RGVKLRLTVVDTPGF   39 (86)
Q Consensus        25 ~~~~l~LtIidTpGf   39 (86)
                      ++-.+.+.++||||-
T Consensus        45 ~~~~~~~~i~Dt~G~   59 (162)
T cd04138          45 DGETCLLDILDTAGQ   59 (162)
T ss_pred             CCEEEEEEEEECCCC
Confidence            445677899999995


No 219
>KOG0446|consensus
Probab=35.73  E-value=24  Score=28.94  Aligned_cols=44  Identities=18%  Similarity=0.260  Sum_probs=32.2

Q ss_pred             EEEEEEEeCCCCCCccCCccchhHHHHHHHHHHHHhhhhhcCCcc
Q psy104           28 KLRLTVVDTPGFGDSINSEESWRACCSYIDDQFRQYFNDESGLNR   72 (86)
Q Consensus        28 ~l~LtIidTpGfGd~i~n~~~~~~i~~yI~~qf~~yl~eE~~i~R   72 (86)
                      -.+||+||.||+= .+-..+....|..-|..-...|+..+..+-.
T Consensus       131 v~~lTLvDlPG~t-kvpv~dqp~di~~qI~~mi~~yi~~~~~iIL  174 (657)
T KOG0446|consen  131 VANLTLVDLPGLT-KVPVADQPDDIEEEIKSMIEEYIEKPNRIIL  174 (657)
T ss_pred             CchhhhcCCCCCc-ccccCCCCccHHHHHHHHHHHhccccchhhh
Confidence            4689999999994 4555557777888888888888776655443


No 220
>TIGR00437 feoB ferrous iron transporter FeoB. FeoB (773 amino acids in E. coli), a cytoplasmic membrane protein required for iron(II) update, is encoded in an operon with FeoA (75 amino acids), which is also required, and is regulated by Fur. There appear to be two copies in Archaeoglobus fulgidus and Clostridium acetobutylicum.
Probab=35.64  E-value=1.6e+02  Score=23.81  Aligned_cols=27  Identities=33%  Similarity=0.482  Sum_probs=15.6

Q ss_pred             EEEEEEEEEeecCeEEEEEEEeCCCCCCc
Q psy104           14 TIEKKSMDIEERGVKLRLTVVDTPGFGDS   42 (86)
Q Consensus        14 ~I~~~~~~l~e~~~~l~LtIidTpGfGd~   42 (86)
                      .+......++-++.  +++++||||.-+.
T Consensus        28 Tv~~~~~~i~~~~~--~i~lvDtPG~~~~   54 (591)
T TIGR00437        28 TVEKKEGKLGFQGE--DIEIVDLPGIYSL   54 (591)
T ss_pred             EEEEEEEEEEECCe--EEEEEECCCcccc
Confidence            33333333333443  4689999998653


No 221
>CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional
Probab=35.54  E-value=23  Score=26.69  Aligned_cols=15  Identities=47%  Similarity=0.780  Sum_probs=11.3

Q ss_pred             CeEEEEEEEeCCCCCC
Q psy104           26 GVKLRLTVVDTPGFGD   41 (86)
Q Consensus        26 ~~~l~LtIidTpGfGd   41 (86)
                      ++|+ ++++||||+--
T Consensus       154 ~lPI-ItlvDTpGA~~  168 (322)
T CHL00198        154 GLPI-LTFIDTPGAWA  168 (322)
T ss_pred             CCCE-EEEEeCCCcCc
Confidence            4443 89999999953


No 222
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]
Probab=35.53  E-value=57  Score=26.23  Aligned_cols=29  Identities=28%  Similarity=0.381  Sum_probs=18.7

Q ss_pred             CcceEEEEEEEEEeecCeEEEEEEEeCCCC
Q psy104           10 GKTTTIEKKSMDIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        10 ~~t~~I~~~~~~l~e~~~~l~LtIidTpGf   39 (86)
                      .-|-.|-.|.+.+...+ .-.|+++||||=
T Consensus        37 GITQhIGA~~v~~~~~~-~~~itFiDTPGH   65 (509)
T COG0532          37 GITQHIGAYQVPLDVIK-IPGITFIDTPGH   65 (509)
T ss_pred             ceeeEeeeEEEEeccCC-CceEEEEcCCcH
Confidence            34566777777665221 126889999984


No 223
>PTZ00416 elongation factor 2; Provisional
Probab=35.20  E-value=31  Score=28.88  Aligned_cols=15  Identities=27%  Similarity=0.585  Sum_probs=12.0

Q ss_pred             EEEEEEEeCCCCCCc
Q psy104           28 KLRLTVVDTPGFGDS   42 (86)
Q Consensus        28 ~l~LtIidTpGfGd~   42 (86)
                      ...++++||||+-+.
T Consensus        91 ~~~i~liDtPG~~~f  105 (836)
T PTZ00416         91 PFLINLIDSPGHVDF  105 (836)
T ss_pred             ceEEEEEcCCCHHhH
Confidence            467899999998653


No 224
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta).  SR-beta and SR-alpha form the heterodimeric signal recognition particle (SRP or SR) receptor that binds SRP to regulate protein translocation across the ER membrane.  Nascent polypeptide chains are synthesized with an N-terminal hydrophobic signal sequence that binds SRP54, a component of the SRP.  SRP directs targeting of the ribosome-nascent chain complex (RNC) to the ER membrane via interaction with the SR, which is localized to the ER membrane.  The RNC is then transferred to the protein-conducting channel, or translocon, which facilitates polypeptide translation across the ER membrane or integration into the ER membrane.  SR-beta is found only in eukaryotes; it is believed to control the release of the signal sequence from SRP54 upon binding of the ribosome to the translocon.  High expression of SR-beta has been observed in human colon cancer, suggesting it may play a role in the development of this typ
Probab=35.19  E-value=55  Score=22.12  Aligned_cols=14  Identities=29%  Similarity=0.577  Sum_probs=11.2

Q ss_pred             EEEEEEEeCCCCCC
Q psy104           28 KLRLTVVDTPGFGD   41 (86)
Q Consensus        28 ~l~LtIidTpGfGd   41 (86)
                      ..++.|+||||-..
T Consensus        47 ~~~~~l~D~pG~~~   60 (203)
T cd04105          47 GKKFRLVDVPGHPK   60 (203)
T ss_pred             CceEEEEECCCCHH
Confidence            46788999999763


No 225
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins. In vertebrates, myosin XV appears to be expressed in sensory tissue and play a role in hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis caus
Probab=35.09  E-value=72  Score=26.29  Aligned_cols=36  Identities=25%  Similarity=0.494  Sum_probs=25.3

Q ss_pred             EEEEEEEeCCCCCCccCCccchhHH-HHHHHHHHHHhhh
Q psy104           28 KLRLTVVDTPGFGDSINSEESWRAC-CSYIDDQFRQYFN   65 (86)
Q Consensus        28 ~l~LtIidTpGfGd~i~n~~~~~~i-~~yI~~qf~~yl~   65 (86)
                      ...+.|.|.+||=..-  .++|+.+ ++|..++...++.
T Consensus       360 ~~~IgILDIfGFE~f~--~NsfEQLcINyaNEkLQ~~f~  396 (677)
T cd01387         360 TLSIAILDIYGFEDLS--FNSFEQLCINYANENLQYLFN  396 (677)
T ss_pred             CceEEEEecCccccCC--CCCHHHHHhHHHHHHHHHHHH
Confidence            3468899999995433  3567744 8888887776643


No 226
>cd01378 MYSc_type_I Myosin motor domain, type I myosins. Myosin I generates movement at the leading edge in cell motility, and class I myosins have been implicated in phagocytosis and vesicle transport. Myosin I, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 picon
Probab=34.98  E-value=66  Score=26.43  Aligned_cols=36  Identities=22%  Similarity=0.409  Sum_probs=26.4

Q ss_pred             eEEEEEEEeCCCCCCccCCccchhHH-HHHHHHHHHHhh
Q psy104           27 VKLRLTVVDTPGFGDSINSEESWRAC-CSYIDDQFRQYF   64 (86)
Q Consensus        27 ~~l~LtIidTpGfGd~i~n~~~~~~i-~~yI~~qf~~yl   64 (86)
                      ....+.|.|.+||=..-  .++|+.+ ++|..+++..++
T Consensus       364 ~~~~IgILDIfGFE~f~--~NsfEQLcINyaNEkLQ~~f  400 (674)
T cd01378         364 KNKVIGVLDIYGFEIFQ--KNSFEQFCINYVNEKLQQIF  400 (674)
T ss_pred             CcceEEEEecccccccc--cccHHHHHhHHHHHHHHHHH
Confidence            35568999999996543  3467754 899998887774


No 227
>PRK12739 elongation factor G; Reviewed
Probab=34.56  E-value=38  Score=27.59  Aligned_cols=28  Identities=32%  Similarity=0.476  Sum_probs=17.0

Q ss_pred             ceEEEEEEEEEeecCeEEEEEEEeCCCCCC
Q psy104           12 TTTIEKKSMDIEERGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        12 t~~I~~~~~~l~e~~~~l~LtIidTpGfGd   41 (86)
                      ...+......++-++  .+++++||||+-+
T Consensus        58 giti~~~~~~~~~~~--~~i~liDTPG~~~   85 (691)
T PRK12739         58 GITITSAATTCFWKG--HRINIIDTPGHVD   85 (691)
T ss_pred             CCCccceeEEEEECC--EEEEEEcCCCHHH
Confidence            344444444444444  4678899999754


No 228
>cd01900 YchF YchF subfamily.  YchF is a member of the Obg family, which includes four other subfamilies of GTPases: Obg, DRG, Ygr210, and NOG1.  Obg is an essential gene that is involved in DNA replication in C. crescentus and Streptomyces griseus and is associated with the ribosome.  Several members of the family, including YchF, possess the TGS domain related to the RNA-binding proteins.  Experimental data and genomic analysis suggest that YchF may be part of a nucleoprotein complex and may function as a GTP-dependent translational factor.
Probab=34.38  E-value=35  Score=24.87  Aligned_cols=14  Identities=29%  Similarity=0.413  Sum_probs=11.4

Q ss_pred             eEEEEEEEeCCCCC
Q psy104           27 VKLRLTVVDTPGFG   40 (86)
Q Consensus        27 ~~l~LtIidTpGfG   40 (86)
                      ++-.+.++||||+-
T Consensus        60 ~~~~i~lvD~pGl~   73 (274)
T cd01900          60 VPATIEFVDIAGLV   73 (274)
T ss_pred             eeeEEEEEECCCcC
Confidence            35579999999985


No 229
>KOG1954|consensus
Probab=34.17  E-value=20  Score=28.32  Aligned_cols=33  Identities=21%  Similarity=0.422  Sum_probs=19.8

Q ss_pred             EEEEEEeCCCCC--Cc--cCCccchhHHHHHHHHHHH
Q psy104           29 LRLTVVDTPGFG--DS--INSEESWRACCSYIDDQFR   61 (86)
Q Consensus        29 l~LtIidTpGfG--d~--i~n~~~~~~i~~yI~~qf~   61 (86)
                      =+++||||||.=  ..  +.....|.-+..+..++-+
T Consensus       147 e~vtiVdtPGILsgeKQrisR~ydF~~v~~WFaeR~D  183 (532)
T KOG1954|consen  147 ESVTIVDTPGILSGEKQRISRGYDFTGVLEWFAERVD  183 (532)
T ss_pred             hheeeeccCcccccchhcccccCChHHHHHHHHHhcc
Confidence            368999999983  22  3333446666665555433


No 230
>PRK05306 infB translation initiation factor IF-2; Validated
Probab=34.08  E-value=55  Score=27.55  Aligned_cols=14  Identities=36%  Similarity=0.546  Sum_probs=11.2

Q ss_pred             EEEEEEeCCCCCCc
Q psy104           29 LRLTVVDTPGFGDS   42 (86)
Q Consensus        29 l~LtIidTpGfGd~   42 (86)
                      ..++++||||..+.
T Consensus       337 ~~ItfiDTPGhe~F  350 (787)
T PRK05306        337 GKITFLDTPGHEAF  350 (787)
T ss_pred             EEEEEEECCCCccc
Confidence            56899999997654


No 231
>cd01380 MYSc_type_V Myosin motor domain, type V myosins. Myosins V transport a variety of intracellular cargo processively along actin filaments, such as membraneous organelles and mRNA. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an act
Probab=34.05  E-value=66  Score=26.52  Aligned_cols=35  Identities=23%  Similarity=0.401  Sum_probs=25.5

Q ss_pred             EEEEEEEeCCCCCCccCCccchhHH-HHHHHHHHHHhh
Q psy104           28 KLRLTVVDTPGFGDSINSEESWRAC-CSYIDDQFRQYF   64 (86)
Q Consensus        28 ~l~LtIidTpGfGd~i~n~~~~~~i-~~yI~~qf~~yl   64 (86)
                      ...+.|.|.+||=..-  .++|+.+ ++|..+++..|+
T Consensus       367 ~~~IgiLDI~GFE~f~--~NsfEQLcINyaNEkLQ~~f  402 (691)
T cd01380         367 TSFIGVLDIYGFETFE--KNSFEQFCINYANEKLQQQF  402 (691)
T ss_pred             cceEEEEecCcccccC--CCCHHHHhhhhhhHHHHHHH
Confidence            4567899999995443  3467754 899998887764


No 232
>cd01379 MYSc_type_III Myosin motor domain, type III myosins. Myosin III has been shown to play a role in  the vision process in insects and in hearing in mammals. Myosin III, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the
Probab=33.85  E-value=72  Score=26.19  Aligned_cols=35  Identities=26%  Similarity=0.596  Sum_probs=25.0

Q ss_pred             EEEEEEEeCCCCCCccCCccchhH-HHHHHHHHHHHhh
Q psy104           28 KLRLTVVDTPGFGDSINSEESWRA-CCSYIDDQFRQYF   64 (86)
Q Consensus        28 ~l~LtIidTpGfGd~i~n~~~~~~-i~~yI~~qf~~yl   64 (86)
                      ...+.|+|.+||=..-.  ++++. .++|..++...++
T Consensus       372 ~~~IgiLDI~GFE~f~~--NsfEQLcINyaNEkLQ~~f  407 (653)
T cd01379         372 QLNVGILDIFGFENFKK--NSFEQLCINIANEQIQYYF  407 (653)
T ss_pred             cceEEEEeccccccCCC--CCHHHHHhhhhHHHHHHHH
Confidence            45689999999964433  45664 4888888877663


No 233
>PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional
Probab=33.43  E-value=27  Score=25.33  Aligned_cols=16  Identities=25%  Similarity=0.308  Sum_probs=12.2

Q ss_pred             cCeEEEEEEEeCCCCCC
Q psy104           25 RGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        25 ~~~~l~LtIidTpGfGd   41 (86)
                      .++|+ ++++||||+-.
T Consensus        97 ~~lPv-V~lvDtpGa~~  112 (256)
T PRK12319         97 FGRPV-VTFINTAGAYP  112 (256)
T ss_pred             cCCCE-EEEEECCCcCC
Confidence            35554 89999999964


No 234
>PF15016 DUF4520:  Domain of unknown function (DUF4520)
Probab=33.36  E-value=29  Score=21.24  Aligned_cols=13  Identities=23%  Similarity=0.130  Sum_probs=10.3

Q ss_pred             CCCCCCeeEEeec
Q psy104           73 KNIVDNREVVDKS   85 (86)
Q Consensus        73 ~~~~D~RVH~Cl~   85 (86)
                      .-+.|.||||.+.
T Consensus        19 ~AysDgrVr~~F~   31 (85)
T PF15016_consen   19 TAYSDGRVRVHFD   31 (85)
T ss_pred             EEEcCCeEEEEEc
Confidence            3678999999874


No 235
>TIGR03779 Bac_Flav_CT_M Bacteroides conjugative transposon TraM protein. Members of this protein family are designated TraM and are found in a proposed transfer region of a class of conjugative transposon found in the Bacteroides lineage.
Probab=33.30  E-value=71  Score=24.97  Aligned_cols=29  Identities=24%  Similarity=0.308  Sum_probs=23.7

Q ss_pred             cceEEEEEEEEEeecCeEEEEEEEeCCCC
Q psy104           11 KTTTIEKKSMDIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        11 ~t~~I~~~~~~l~e~~~~l~LtIidTpGf   39 (86)
                      +-+.|...++...++=+|++|+|.|+.|-
T Consensus       304 ~R~~i~I~si~~~g~iipV~L~vyD~DG~  332 (410)
T TIGR03779       304 ERLDIKISSIEYNGTILPVELSVYDTDGQ  332 (410)
T ss_pred             ceEEEEEEEEEECCEEEEEEEEEEcCCCC
Confidence            34677778887777778999999999885


No 236
>PF08189 Meleagrin:  Meleagrin/Cygnin family;  InterPro: IPR012573 This family consists of meleagrin and cygnin basic peptides that are isolated from turkey and black swan respectively. Both peptides are low in molecular weight and contain three disulphide bonds with high concentrations of aromatic residues. These peptides show similarity to transferrins and probably play some vital role in avian eggs but the exact function is still unknown [].
Probab=33.28  E-value=29  Score=18.17  Aligned_cols=11  Identities=9%  Similarity=-0.170  Sum_probs=8.9

Q ss_pred             CCCCeeEEeec
Q psy104           75 IVDNREVVDKS   85 (86)
Q Consensus        75 ~~D~RVH~Cl~   85 (86)
                      -+|..+||||-
T Consensus        25 s~~CK~yCClP   35 (39)
T PF08189_consen   25 SQDCKMYCCLP   35 (39)
T ss_pred             cCCccEEEeCC
Confidence            36889999984


No 237
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily.  Rnd3/RhoE/Rho8 is a member of the novel Rho subfamily Rnd, together with Rnd1/Rho6 and Rnd2/Rho7.  Rnd3/RhoE is known to bind the serine-threonine kinase ROCK I.  Unphosphorylated Rnd3/RhoE associates primarily with membranes, but ROCK I-phosphorylated Rnd3/RhoE localizes in the cytosol.  Phosphorylation of Rnd3/RhoE correlates with its activity in disrupting RhoA-induced stress fibers and inhibiting Ras-induced fibroblast transformation.  In cells that lack stress fibers, such as macrophages and monocytes, Rnd3/RhoE induces a redistribution of actin, causing morphological changes in the cell.  In addition, Rnd3/RhoE has been shown to inhibit cell cycle progression in G1 phase at a point upstream of the pRb family pocket protein checkpoint.  Rnd3/RhoE has also been shown to inhibit Ras- and Raf-induced fibroblast transformation.  In mammary epithelial tumor cells, Rnd3/RhoE regulates the assembly of the apical junction complex and tight
Probab=33.24  E-value=1.5e+02  Score=19.67  Aligned_cols=19  Identities=26%  Similarity=0.379  Sum_probs=15.0

Q ss_pred             EEeecCeEEEEEEEeCCCC
Q psy104           21 DIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        21 ~l~e~~~~l~LtIidTpGf   39 (86)
                      .+.-++..++|.|.||+|-
T Consensus        45 ~~~~~~~~~~l~iwDtaG~   63 (182)
T cd04172          45 SFEIDTQRIELSLWDTSGS   63 (182)
T ss_pred             EEEECCEEEEEEEEECCCc
Confidence            4455677899999999984


No 238
>PF00460 Flg_bb_rod:  Flagella basal body rod protein;  InterPro: IPR001444 Many bacterial species swim actively by means of flagella. The flagella organelle is made of three parts: the basal body, the hook and the filament. The basal body consists of four rings (L,P,S, and M) mounted on a central rod []. In Salmonella typhimurium and related organisms the rod has been shown to consist of four different, yet evolutionary related proteins: in the distal portion of the rod there are about 26 subunits of protein flgG and in the proximal portion there are about six subunits each of proteins flgB, flgC, and flgF. These four proteins contain a highly conserved asparagine-rich domain at their N terminus.; GO: 0003774 motor activity, 0005198 structural molecule activity, 0001539 ciliary or flagellar motility, 0009288 bacterial-type flagellum; PDB: 3A69_A.
Probab=33.18  E-value=14  Score=18.20  Aligned_cols=6  Identities=50%  Similarity=1.337  Sum_probs=0.0

Q ss_pred             EeCCCC
Q psy104           34 VDTPGF   39 (86)
Q Consensus        34 idTpGf   39 (86)
                      ++||||
T Consensus        25 ~nT~Gy   30 (31)
T PF00460_consen   25 ANTPGY   30 (31)
T ss_dssp             ------
T ss_pred             cCCCCC
Confidence            578887


No 239
>cd04131 Rnd Rnd subfamily.  The Rnd subfamily contains Rnd1/Rho6, Rnd2/Rho7, and Rnd3/RhoE/Rho8.  These novel Rho family proteins have substantial structural differences compared to other Rho members, including N- and C-terminal extensions relative to other Rhos.  Rnd3/RhoE is farnesylated at the C-terminal prenylation site, unlike most other Rho proteins that are geranylgeranylated.  In addition, Rnd members are unable to hydrolyze GTP and are resistant to GAP activity.  They are believed to exist only in the GTP-bound conformation, and are antagonists of RhoA activity.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=33.11  E-value=1.4e+02  Score=19.52  Aligned_cols=19  Identities=26%  Similarity=0.384  Sum_probs=14.6

Q ss_pred             EEeecCeEEEEEEEeCCCC
Q psy104           21 DIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        21 ~l~e~~~~l~LtIidTpGf   39 (86)
                      .+.-++-.++|.+.||+|-
T Consensus        41 ~~~~~~~~~~l~iwDt~G~   59 (178)
T cd04131          41 SFEIDEQRIELSLWDTSGS   59 (178)
T ss_pred             EEEECCEEEEEEEEECCCc
Confidence            3444567899999999985


No 240
>PRK11058 GTPase HflX; Provisional
Probab=33.05  E-value=46  Score=25.70  Aligned_cols=26  Identities=27%  Similarity=0.464  Sum_probs=15.3

Q ss_pred             cceEEEEEEEEEeecCeEEEEEEEeCCCC
Q psy104           11 KTTTIEKKSMDIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        11 ~t~~I~~~~~~l~e~~~~l~LtIidTpGf   39 (86)
                      .|.......+.+...+   .+.++|||||
T Consensus       230 tTld~~~~~i~l~~~~---~~~l~DTaG~  255 (426)
T PRK11058        230 ATLDPTLRRIDVADVG---ETVLADTVGF  255 (426)
T ss_pred             CCcCCceEEEEeCCCC---eEEEEecCcc
Confidence            3444444555443221   4568999999


No 241
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates f
Probab=33.03  E-value=83  Score=25.94  Aligned_cols=34  Identities=21%  Similarity=0.448  Sum_probs=24.8

Q ss_pred             EEEEEEeCCCCCCccCCccchhHH-HHHHHHHHHHhh
Q psy104           29 LRLTVVDTPGFGDSINSEESWRAC-CSYIDDQFRQYF   64 (86)
Q Consensus        29 l~LtIidTpGfGd~i~n~~~~~~i-~~yI~~qf~~yl   64 (86)
                      -.+.|+|.+||=..-.  ++|+.+ ++|-.++...++
T Consensus       365 ~~IgiLDI~GFE~f~~--NsfEQLcINyaNEkLQ~~f  399 (677)
T cd01383         365 RSISILDIYGFESFDK--NSFEQFCINYANERLQQHF  399 (677)
T ss_pred             ceEEEeeccccccCCC--CCHHHHHHHHHHHHHHHHH
Confidence            4678999999965443  467744 889988877763


No 242
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins. Myosin VI is a monomeric myosin, which moves towards the minus-end of actin filaments, in contrast to most other myosins. It has been implicated in endocytosis, secretion, and cell migration. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the minus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of
Probab=32.52  E-value=67  Score=26.65  Aligned_cols=34  Identities=24%  Similarity=0.465  Sum_probs=24.7

Q ss_pred             EEEEEEeCCCCCCccCCccchhHH-HHHHHHHHHHhh
Q psy104           29 LRLTVVDTPGFGDSINSEESWRAC-CSYIDDQFRQYF   64 (86)
Q Consensus        29 l~LtIidTpGfGd~i~n~~~~~~i-~~yI~~qf~~yl   64 (86)
                      -.+.|.|.+||=..-  .++++.+ ++|..++...++
T Consensus       397 ~~IgiLDIfGFE~f~--~NsfEQLcINyaNEkLQ~~f  431 (717)
T cd01382         397 NFIGVLDIAGFEYFE--HNSFEQFCINYCNEKLQQFF  431 (717)
T ss_pred             cEEEEEeccccccCC--CCCHHHHhhhhhHHHHHHHH
Confidence            358899999995443  3467744 899888887774


No 243
>PRK12685 flgB flagellar basal body rod protein FlgB; Reviewed
Probab=32.26  E-value=18  Score=22.99  Aligned_cols=8  Identities=38%  Similarity=0.887  Sum_probs=6.7

Q ss_pred             EEeCCCCC
Q psy104           33 VVDTPGFG   40 (86)
Q Consensus        33 IidTpGfG   40 (86)
                      =+|||||-
T Consensus        32 NadTPgYk   39 (116)
T PRK12685         32 NAETPGYK   39 (116)
T ss_pred             ccCCCCcC
Confidence            47999995


No 244
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases.  Arf proteins are activators of phospholipase D isoforms.  Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated.  Arfs are N-terminally myristoylated.  Members of the Arf family are regulators of vesicle formation in intracellular traffic that interact reversibly with membranes of the secretory and endocytic compartments in a GTP-dependent manner.  They depart from other small GTP-binding proteins by a unique structural device, interswitch toggle, that implements front-back communication from N-terminus to the nucleotide binding site.  Arf-like (Arl) proteins are close relatives of the Arf, but only Arl1 has been shown to function in membrane traffic like the Arf proteins.  Arl2 has an unrelated function in the folding of native tubulin, and Arl4 may function in the nucleus.  Most other Arf family proteins are so far relatively poorly characterized.  Thu
Probab=32.13  E-value=70  Score=19.83  Aligned_cols=14  Identities=29%  Similarity=0.368  Sum_probs=11.4

Q ss_pred             EEEEEEEeCCCCCC
Q psy104           28 KLRLTVVDTPGFGD   41 (86)
Q Consensus        28 ~l~LtIidTpGfGd   41 (86)
                      .+.+.+.||||...
T Consensus        42 ~~~~~i~D~~G~~~   55 (158)
T cd00878          42 NVSFTVWDVGGQDK   55 (158)
T ss_pred             CEEEEEEECCCChh
Confidence            47899999999754


No 245
>PRK07182 flgB flagellar basal body rod protein FlgB; Reviewed
Probab=32.04  E-value=19  Score=23.81  Aligned_cols=7  Identities=57%  Similarity=1.051  Sum_probs=6.1

Q ss_pred             EeCCCCC
Q psy104           34 VDTPGFG   40 (86)
Q Consensus        34 idTpGfG   40 (86)
                      +|||||-
T Consensus        33 adTPGYk   39 (148)
T PRK07182         33 VNTPNFQ   39 (148)
T ss_pred             cCCCCCC
Confidence            6999995


No 246
>PHA02857 monoglyceride lipase; Provisional
Probab=31.90  E-value=54  Score=22.43  Aligned_cols=18  Identities=22%  Similarity=0.242  Sum_probs=13.9

Q ss_pred             EEEEEEeCCCCCCccCCc
Q psy104           29 LRLTVVDTPGFGDSINSE   46 (86)
Q Consensus        29 l~LtIidTpGfGd~i~n~   46 (86)
                      +++-..|-||+|.+-...
T Consensus        53 ~~via~D~~G~G~S~~~~   70 (276)
T PHA02857         53 ILVFSHDHIGHGRSNGEK   70 (276)
T ss_pred             CEEEEccCCCCCCCCCcc
Confidence            567789999999875443


No 247
>PF11567 PfUIS3:  Plasmodium falciparum UIS3 membrane protein;  InterPro: IPR021626  UIS3 is a membrane protein essential for sporozoite development in infected hepatocytes. This family is 130-229 of the Plasmodium falciparum UIS3 protein which is compact and has an all alpha-helical structure.PfUIS3(130-229) interacts with lipids, phospholipid lysosomes, the human liver fatty acid-binding protein and with the lipid phosphatidylethanolamine. The interaction with liver fatty acid-binding protein provides the parasite with a method to import essential fatty acids/lipids during rapid growth phases of sporozoites []. ; PDB: 2VWA_C.
Probab=31.35  E-value=51  Score=20.60  Aligned_cols=18  Identities=22%  Similarity=0.656  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHHHhhhhhc
Q psy104           51 ACCSYIDDQFRQYFNDES   68 (86)
Q Consensus        51 ~i~~yI~~qf~~yl~eE~   68 (86)
                      -+..|+.++|..||.+|.
T Consensus        83 ~~e~fLq~~y~~~~~~~~  100 (101)
T PF11567_consen   83 NVEHFLQEQYQQYLSQEE  100 (101)
T ss_dssp             HHHHHHHHHHHHHHHHH-
T ss_pred             hHHHHHHHHHHHHHhhhc
Confidence            346799999999999875


No 248
>cd04151 Arl1 Arl1 subfamily.  Arl1 (Arf-like 1) localizes to the Golgi complex, where it is believed to recruit effector proteins to the trans-Golgi network.  Like most members of the Arf family, Arl1 is myristoylated at its N-terminal helix and mutation of the myristoylation site disrupts Golgi targeting.  In humans, the Golgi-localized proteins golgin-97 and golgin-245 have been identified as Arl1 effectors.  Golgins are large coiled-coil proteins found in the Golgi, and these golgins contain a C-terminal GRIP domain, which is the site of Arl1 binding.  Additional Arl1 effectors include the GARP (Golgi-associated retrograde protein)/VFT (Vps53) vesicle-tethering complex and Arfaptin 2.  Arl1 is not required for exocytosis, but appears necessary for trafficking from the endosomes to the Golgi.  In Drosophila zygotes, mutation of Arl1 is lethal, and in the host-bloodstream form of Trypanosoma brucei, Arl1 is essential for viability.
Probab=31.25  E-value=40  Score=21.15  Aligned_cols=13  Identities=31%  Similarity=0.386  Sum_probs=10.9

Q ss_pred             EEEEEEEeCCCCC
Q psy104           28 KLRLTVVDTPGFG   40 (86)
Q Consensus        28 ~l~LtIidTpGfG   40 (86)
                      .+++.++||||..
T Consensus        42 ~~~~~i~Dt~G~~   54 (158)
T cd04151          42 NLKFQVWDLGGQT   54 (158)
T ss_pred             CEEEEEEECCCCH
Confidence            4688999999975


No 249
>KOG2655|consensus
Probab=31.15  E-value=39  Score=26.02  Aligned_cols=74  Identities=16%  Similarity=0.007  Sum_probs=50.0

Q ss_pred             cceEEEEEEEEEeecCeEEEEEEEeCCCCCCccCCc--cchhHHHHHHHHHHHHhhhhhcCCccCCCCCCeeEEee
Q psy104           11 KTTTIEKKSMDIEERGVKLRLTVVDTPGFGDSINSE--ESWRACCSYIDDQFRQYFNDESGLNRKNIVDNREVVDK   84 (86)
Q Consensus        11 ~t~~I~~~~~~l~e~~~~l~LtIidTpGfGd~i~n~--~~~~~i~~yI~~qf~~yl~eE~~i~R~~~~D~RVH~Cl   84 (86)
                      -+..|......++.+|-.....--...|+.+--|-+  +.|..-.-+|...++.+..-...+...++...++++|.
T Consensus       217 ~PFAIigs~~~~e~~G~~~vrgR~YpWG~veien~~h~DF~~Lr~~Li~thl~dLk~~T~~~~YEnYR~~~L~~~~  292 (366)
T KOG2655|consen  217 IPFAIIGSNTEIEEKGKKRVRGRKYPWGTVEIENPEHCDFKKLRNLLIRTHLEDLKDTTNNLLYENYRTEKLEGLL  292 (366)
T ss_pred             CCeEEEecCceeecCCceEeeceecCCceeeccCCCcchHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHhhcc
Confidence            346777777778888877666678899999776644  44666666777777777666666655555555555554


No 250
>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins. Myosins in this group have been associated with functions in sensory systems such as vision and hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydr
Probab=31.07  E-value=87  Score=25.78  Aligned_cols=35  Identities=20%  Similarity=0.445  Sum_probs=25.3

Q ss_pred             EEEEEEEeCCCCCCccCCccchhHH-HHHHHHHHHHhh
Q psy104           28 KLRLTVVDTPGFGDSINSEESWRAC-CSYIDDQFRQYF   64 (86)
Q Consensus        28 ~l~LtIidTpGfGd~i~n~~~~~~i-~~yI~~qf~~yl   64 (86)
                      ...+.|.|.+||=..-  .++|+.+ ++|..++...++
T Consensus       361 ~~~IgiLDIfGFE~f~--~NsfEQLcINy~NEkLQ~~f  396 (671)
T cd01381         361 RNSIGVLDIFGFENFD--VNSFEQLCINFANENLQQFF  396 (671)
T ss_pred             cceEEEEecCCcccCC--CCCHHHHHHHHHHHHHHHHH
Confidence            4568899999995443  3467744 899998877663


No 251
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the 
Probab=30.99  E-value=83  Score=26.40  Aligned_cols=36  Identities=22%  Similarity=0.598  Sum_probs=26.6

Q ss_pred             EEEEEEeCCCCCCccCC----ccchhHH-HHHHHHHHHHhh
Q psy104           29 LRLTVVDTPGFGDSINS----EESWRAC-CSYIDDQFRQYF   64 (86)
Q Consensus        29 l~LtIidTpGfGd~i~n----~~~~~~i-~~yI~~qf~~yl   64 (86)
                      ..+.|.|.+||=..-.|    .++|+.+ ++|..+++..++
T Consensus       373 ~~IgiLDIfGFE~f~~n~~~~~NsfEQLcINyaNEkLQq~f  413 (767)
T cd01386         373 ASIMLVDTPGFQNPASQGKDRAATFEELCHNYLQERLQLLF  413 (767)
T ss_pred             cEEEEEecccccccccccccCCCCHHHHhhhhhHHHHHHHH
Confidence            46789999999654332    2578854 899999888775


No 252
>TIGR01947 rnfG electron transport complex, RnfABCDGE type, G subunit. The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation. A closely related complex in E. coli, RsxABCDGE (Reducer of SoxR), reduces the 2Fe-2S-containing superoxide sensor SoxR, active as a transcription factor when oxidized. This family of putative NADH oxidoreductase complexes exists in many of the same species as the related NQR, a Na(+)-translocating NADH-quinone reductase, but is distinct. This model describes the A subunit.
Probab=30.98  E-value=31  Score=23.52  Aligned_cols=20  Identities=45%  Similarity=0.861  Sum_probs=12.6

Q ss_pred             cCeEEEEEEE---eCCCCCCccC
Q psy104           25 RGVKLRLTVV---DTPGFGDSIN   44 (86)
Q Consensus        25 ~~~~l~LtIi---dTpGfGd~i~   44 (86)
                      +|.-..+.|+   +|||+|+.+.
T Consensus       106 dg~I~gv~v~~~~ETpGlG~~i~  128 (186)
T TIGR01947       106 DGTILGVRVLSHKETPGLGDKIE  128 (186)
T ss_pred             CCeEEEEEEeecCCCcccccccc
Confidence            3443344443   6999998876


No 253
>cd04158 ARD1 ARD1 subfamily.  ARD1 (ADP-ribosylation factor domain protein 1) is an unusual member of the Arf family.  In addition to the C-terminal Arf domain, ARD1 has an additional 46-kDa N-terminal domain that contains a RING finger domain, two predicted B-Boxes, and a coiled-coil protein interaction motif.  This domain belongs to the TRIM (tripartite motif) or RBCC (RING, B-Box, coiled-coil) family.  Like most Arfs, the ARD1 Arf domain lacks detectable GTPase activity.  However, unlike most Arfs, the full-length ARD1 protein has significant GTPase activity due to the GAP (GTPase-activating protein) activity exhibited by the 46-kDa N-terminal domain.  The GAP domain of ARD1 is specific for its own Arf domain and does not bind other Arfs.  The rate of GDP dissociation from the ARD1 Arf domain is slowed by the adjacent 15 amino acids, which act as a GDI (GDP-dissociation inhibitor) domain.  ARD1 is ubiquitously expressed in cells and localizes to the Golgi and to the lysosomal membra
Probab=30.76  E-value=78  Score=20.22  Aligned_cols=14  Identities=29%  Similarity=0.430  Sum_probs=11.4

Q ss_pred             EEEEEEEeCCCCCC
Q psy104           28 KLRLTVVDTPGFGD   41 (86)
Q Consensus        28 ~l~LtIidTpGfGd   41 (86)
                      .+++.++||||...
T Consensus        42 ~~~i~l~Dt~G~~~   55 (169)
T cd04158          42 NLKFTIWDVGGKHK   55 (169)
T ss_pred             CEEEEEEECCCChh
Confidence            47889999999754


No 254
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily.  Rnd2/Rho7 is a member of the novel Rho subfamily Rnd, together with Rnd1/Rho6 and Rnd3/RhoE/Rho8.  Rnd2/Rho7 is transiently expressed in radially migrating cells in the brain while they are within the subventricular zone of the hippocampus and cerebral cortex.  These migrating cells typically develop into pyramidal neurons.  Cells that exogenously expressed Rnd2/Rho7 failed to migrate to upper layers of the brain, suggesting that Rnd2/Rho7 plays a role in the radial migration and morphological changes of developing pyramidal neurons, and that Rnd2/Rho7 degradation is necessary for proper cellular migration.  The Rnd2/Rho7 GEF Rapostlin is found primarily in the brain and together with Rnd2/Rho7 induces dendrite branching.  Unlike Rnd1/Rho6 and Rnd3/RhoE/Rho8, which are RhoA antagonists, Rnd2/Rho7 binds the GEF Pragmin and significantly stimulates RhoA activity and Rho-A mediated cell contraction.  Rnd2/Rho7 is also found to be expressed in sperma
Probab=30.74  E-value=99  Score=21.51  Aligned_cols=21  Identities=24%  Similarity=0.311  Sum_probs=15.8

Q ss_pred             EEEeecCeEEEEEEEeCCCCC
Q psy104           20 MDIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        20 ~~l~e~~~~l~LtIidTpGfG   40 (86)
                      ..+.-++..++|.+.||+|-.
T Consensus        40 ~~~~~~~~~v~L~iwDt~G~e   60 (222)
T cd04173          40 ASFEIDKRRIELNMWDTSGSS   60 (222)
T ss_pred             EEEEECCEEEEEEEEeCCCcH
Confidence            344456778999999999953


No 255
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF.
Probab=30.73  E-value=41  Score=26.75  Aligned_cols=33  Identities=15%  Similarity=0.128  Sum_probs=23.1

Q ss_pred             EEEEEEEeCCCCCCccCCccchhHHHHHHHHHHHHhh
Q psy104           28 KLRLTVVDTPGFGDSINSEESWRACCSYIDDQFRQYF   64 (86)
Q Consensus        28 ~l~LtIidTpGfGd~i~n~~~~~~i~~yI~~qf~~yl   64 (86)
                      -+.|-|=|||+.   +-. .||.||..-|...=..-|
T Consensus       235 gvd~iiddtp~~---v~l-s~fdp~rreia~~~l~~l  267 (514)
T TIGR03319       235 GVDLIIDDTPEA---VIL-SGFDPVRREIARMALEKL  267 (514)
T ss_pred             CceEEEcCCCCe---EEe-cCCchHHHHHHHHHHHHH
Confidence            466888899976   333 489999888876544433


No 256
>PF09439 SRPRB:  Signal recognition particle receptor beta subunit;  InterPro: IPR019009  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. The SR receptor is a monomer consisting of the loosely membrane-associated SR-alpha homologue FtsY, while the eukaryotic SR receptor is a heterodimer of SR-alpha (70 kDa) and SR-beta (25 kDa), both of which contain a GTP-binding domain []. SR-alpha regulates the targeting of SRP-ribosome-nascent polypeptide complexes to the translocon []. SR-alpha binds to the SRP54 subunit of the SRP complex. The SR-beta subunit is a transmembrane GTPase that anchors the SR-alpha subunit (a peripheral membrane GTPase) to the ER membrane []. SR-beta interacts with the N-terminal SRX-domain of SR-alpha, which is not present in the bacterial FtsY homologue. SR-beta also functions in recruiting the SRP-nascent polypeptide to the protein-conducting channel.   The beta subunit of the signal recognition particle receptor (SRP) is a transmembrane GTPase, which anchors the alpha subunit to the endoplasmic reticulum membrane []. ; PDB: 2GED_B 1NRJ_B 2GO5_2 2FH5_B.
Probab=30.37  E-value=18  Score=24.89  Aligned_cols=15  Identities=33%  Similarity=0.505  Sum_probs=10.7

Q ss_pred             EEEEEEEeCCCCCCc
Q psy104           28 KLRLTVVDTPGFGDS   42 (86)
Q Consensus        28 ~l~LtIidTpGfGd~   42 (86)
                      .-.+.+||+||-+.-
T Consensus        48 ~~~~~lvD~PGH~rl   62 (181)
T PF09439_consen   48 GKKLRLVDIPGHPRL   62 (181)
T ss_dssp             GTCECEEEETT-HCC
T ss_pred             CCEEEEEECCCcHHH
Confidence            346789999998754


No 257
>PLN03230 acetyl-coenzyme A carboxylase carboxyl transferase; Provisional
Probab=30.35  E-value=32  Score=27.07  Aligned_cols=14  Identities=57%  Similarity=0.809  Sum_probs=10.9

Q ss_pred             CeEEEEEEEeCCCCC
Q psy104           26 GVKLRLTVVDTPGFG   40 (86)
Q Consensus        26 ~~~l~LtIidTpGfG   40 (86)
                      ++|+ |++|||||+-
T Consensus       221 ~lPI-VtLVDTpGA~  234 (431)
T PLN03230        221 GFPI-LTFVDTPGAY  234 (431)
T ss_pred             CCCE-EEEEeCCCcC
Confidence            4443 8999999985


No 258
>cd01873 RhoBTB RhoBTB subfamily.  Members of the RhoBTB subfamily of Rho GTPases are present in vertebrates, Drosophila, and Dictyostelium.  RhoBTB proteins are characterized by a modular organization, consisting of a GTPase domain, a proline rich region, a tandem of two BTB (Broad-Complex, Tramtrack, and Bric a brac) domains, and a C-terminal region of unknown function.  RhoBTB proteins may act as docking points for multiple components participating in signal transduction cascades.  RhoBTB genes appeared upregulated in some cancer cell lines, suggesting a participation of RhoBTB proteins in the pathogenesis of particular tumors.  Note that the Dictyostelium RacA GTPase domain is more closely related to Rac proteins than to RhoBTB proteins, where RacA actually belongs.  Thus, the Dictyostelium RacA is not included here.  Most Rho proteins contain a lipid modification site at the C-terminus; however, RhoBTB is one of few Rho subfamilies that lack this feature.
Probab=30.26  E-value=54  Score=22.08  Aligned_cols=16  Identities=38%  Similarity=0.376  Sum_probs=13.6

Q ss_pred             ecCeEEEEEEEeCCCC
Q psy104           24 ERGVKLRLTVVDTPGF   39 (86)
Q Consensus        24 e~~~~l~LtIidTpGf   39 (86)
                      -+|.+++|.+.||+|-
T Consensus        61 ~~~~~v~l~iwDTaG~   76 (195)
T cd01873          61 VDGVSVSLRLWDTFGD   76 (195)
T ss_pred             eCCEEEEEEEEeCCCC
Confidence            3567899999999995


No 259
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily.  Arl5 (Arf-like 5) and Arl8, like Arl4 and Arl7, are localized to the nucleus and nucleolus.  Arl5 is developmentally regulated during embryogenesis in mice.  Human Arl5 interacts with the heterochromatin protein 1-alpha (HP1alpha), a nonhistone chromosomal protein that is associated with heterochromatin and telomeres, and prevents telomere fusion.  Arl5 may also play a role in embryonic nuclear dynamics and/or signaling cascades. Arl8 was identified from a fetal cartilage cDNA library.  It is found in brain, heart, lung, cartilage, and kidney.  No function has been assigned for Arl8 to date.
Probab=30.12  E-value=75  Score=20.43  Aligned_cols=13  Identities=23%  Similarity=0.353  Sum_probs=10.8

Q ss_pred             EEEEEEEeCCCCC
Q psy104           28 KLRLTVVDTPGFG   40 (86)
Q Consensus        28 ~l~LtIidTpGfG   40 (86)
                      .++|.++||||..
T Consensus        58 ~~~~~l~D~~G~~   70 (174)
T cd04153          58 NIRFLMWDIGGQE   70 (174)
T ss_pred             CeEEEEEECCCCH
Confidence            4778999999974


No 260
>PRK13351 elongation factor G; Reviewed
Probab=29.14  E-value=35  Score=27.66  Aligned_cols=15  Identities=40%  Similarity=0.678  Sum_probs=11.8

Q ss_pred             EEEEEEEeCCCCCCc
Q psy104           28 KLRLTVVDTPGFGDS   42 (86)
Q Consensus        28 ~l~LtIidTpGfGd~   42 (86)
                      ..+++++||||..+.
T Consensus        72 ~~~i~liDtPG~~df   86 (687)
T PRK13351         72 NHRINLIDTPGHIDF   86 (687)
T ss_pred             CEEEEEEECCCcHHH
Confidence            357899999998653


No 261
>PLN00116 translation elongation factor EF-2 subunit; Provisional
Probab=29.04  E-value=29  Score=29.12  Aligned_cols=15  Identities=27%  Similarity=0.581  Sum_probs=12.0

Q ss_pred             EEEEEEEeCCCCCCc
Q psy104           28 KLRLTVVDTPGFGDS   42 (86)
Q Consensus        28 ~l~LtIidTpGfGd~   42 (86)
                      ..++++|||||.-|.
T Consensus        97 ~~~inliDtPGh~dF  111 (843)
T PLN00116         97 EYLINLIDSPGHVDF  111 (843)
T ss_pred             ceEEEEECCCCHHHH
Confidence            567899999998544


No 262
>TIGR03874 4cys_cytochr c-type cytochrome, methanol metabolism-related. This family represents a c-type cytochrome related to (but excluding) cytochrome c-555 of Methylococcus capsulatus. Members contain four invariant Cys residues, including two from a heme-binding motif shared with c-555, and two others.
Probab=29.02  E-value=41  Score=22.48  Aligned_cols=26  Identities=23%  Similarity=0.247  Sum_probs=19.7

Q ss_pred             eCCCCCCccCCccchhHHHHHHHHHH
Q psy104           35 DTPGFGDSINSEESWRACCSYIDDQF   60 (86)
Q Consensus        35 dTpGfGd~i~n~~~~~~i~~yI~~qf   60 (86)
                      -.|+|+...+....+..|..||..+-
T Consensus        91 ~MPaF~~~LsD~~eIa~L~~YLR~~~  116 (143)
T TIGR03874        91 VMPAFGDNPNVMCYLDDLYVYLRARG  116 (143)
T ss_pred             CCCCccccCCcHHHHHHHHHHHHhcc
Confidence            38999988876556788888887653


No 263
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new act
Probab=28.71  E-value=1e+02  Score=25.36  Aligned_cols=35  Identities=26%  Similarity=0.484  Sum_probs=25.7

Q ss_pred             EEEEEEEeCCCCCCccCCccchhH-HHHHHHHHHHHhh
Q psy104           28 KLRLTVVDTPGFGDSINSEESWRA-CCSYIDDQFRQYF   64 (86)
Q Consensus        28 ~l~LtIidTpGfGd~i~n~~~~~~-i~~yI~~qf~~yl   64 (86)
                      ...+.|.|.+||=..-.  ++++. .++|..++...++
T Consensus       366 ~~~IgiLDI~GFE~f~~--NsfEQLcINyaNEkLQ~~f  401 (674)
T cd01384         366 KSLIGVLDIYGFESFKT--NSFEQFCINLTNEKLQQHF  401 (674)
T ss_pred             CeEEEEEecccccccCc--CCHHHHHhhhhHHHHHHHH
Confidence            35688999999965543  36664 4889888887764


No 264
>PF14038 YqzE:  YqzE-like protein
Probab=28.26  E-value=65  Score=18.14  Aligned_cols=17  Identities=24%  Similarity=0.620  Sum_probs=14.5

Q ss_pred             hHHHHHHHHHHHHhhhh
Q psy104           50 RACCSYIDDQFRQYFND   66 (86)
Q Consensus        50 ~~i~~yI~~qf~~yl~e   66 (86)
                      +..++|+.+|+=.|+..
T Consensus         3 nDyVKy~Tqq~V~Ymdt   19 (54)
T PF14038_consen    3 NDYVKYMTQQFVKYMDT   19 (54)
T ss_pred             hHHHHHHHHHHHHHhhC
Confidence            35699999999999875


No 265
>PRK06003 flgB flagellar basal body rod protein FlgB; Reviewed
Probab=28.24  E-value=23  Score=22.70  Aligned_cols=7  Identities=43%  Similarity=1.099  Sum_probs=6.0

Q ss_pred             EeCCCCC
Q psy104           34 VDTPGFG   40 (86)
Q Consensus        34 idTpGfG   40 (86)
                      +|||||-
T Consensus        31 ~~TPgyk   37 (126)
T PRK06003         31 ANTPGYR   37 (126)
T ss_pred             cCCCCcc
Confidence            6999995


No 266
>KOG1145|consensus
Probab=28.16  E-value=66  Score=26.62  Aligned_cols=32  Identities=28%  Similarity=0.463  Sum_probs=23.0

Q ss_pred             CCCCCCcceEEEEEEEEEeecCeEEEEEEEeCCCC
Q psy104            5 GNNRQGKTTTIEKKSMDIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus         5 ~~~~~~~t~~I~~~~~~l~e~~~~l~LtIidTpGf   39 (86)
                      |.++..-|-.|-..++.+. +|  =++|..||||=
T Consensus       180 A~E~GGITQhIGAF~V~~p-~G--~~iTFLDTPGH  211 (683)
T KOG1145|consen  180 AGEAGGITQHIGAFTVTLP-SG--KSITFLDTPGH  211 (683)
T ss_pred             hhhcCCccceeceEEEecC-CC--CEEEEecCCcH
Confidence            3444455667778888777 66  57899999994


No 267
>KOG0095|consensus
Probab=27.82  E-value=1.6e+02  Score=20.54  Aligned_cols=26  Identities=27%  Similarity=0.491  Sum_probs=19.4

Q ss_pred             ceEEEEEEEEEeecCeEEEEEEEeCCCC
Q psy104           12 TTTIEKKSMDIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        12 t~~I~~~~~~l~e~~~~l~LtIidTpGf   39 (86)
                      .+.+..++++++  |-+++|.|-||.|=
T Consensus        41 gvdfmiktvev~--gekiklqiwdtagq   66 (213)
T KOG0095|consen   41 GVDFMIKTVEVN--GEKIKLQIWDTAGQ   66 (213)
T ss_pred             eeeEEEEEEEEC--CeEEEEEEeeccch
Confidence            466677776654  56899999999884


No 268
>PRK12298 obgE GTPase CgtA; Reviewed
Probab=27.61  E-value=44  Score=25.50  Aligned_cols=12  Identities=33%  Similarity=0.661  Sum_probs=10.2

Q ss_pred             EEEEEeCCCCCC
Q psy104           30 RLTVVDTPGFGD   41 (86)
Q Consensus        30 ~LtIidTpGfGd   41 (86)
                      ++.++||||+..
T Consensus       208 ~i~~vDtPGi~~  219 (390)
T PRK12298        208 SFVVADIPGLIE  219 (390)
T ss_pred             EEEEEeCCCccc
Confidence            578999999964


No 269
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=27.53  E-value=33  Score=24.95  Aligned_cols=51  Identities=31%  Similarity=0.393  Sum_probs=38.6

Q ss_pred             eecCeEEEEEEEeCCCCCCc-----cCCccchhHHHHHHHH-----HHHHhhhhhcCCccC
Q psy104           23 EERGVKLRLTVVDTPGFGDS-----INSEESWRACCSYIDD-----QFRQYFNDESGLNRK   73 (86)
Q Consensus        23 ~e~~~~l~LtIidTpGfGd~-----i~n~~~~~~i~~yI~~-----qf~~yl~eE~~i~R~   73 (86)
                      ++|.+..+|||-|-.|||..     .-+..+|.-|...|+-     --++||.+=++..|+
T Consensus        82 Q~N~i~~rlTV~dLv~FGRfPYSqGRlt~eD~~~I~~aieyl~L~~l~dryLd~LSGGQrQ  142 (252)
T COG4604          82 QENHINSRLTVRDLVGFGRFPYSQGRLTKEDRRIINEAIEYLHLEDLSDRYLDELSGGQRQ  142 (252)
T ss_pred             hhchhhheeEHHHHhhcCCCcccCCCCchHHHHHHHHHHHHhcccchHHHhHHhcccchhh
Confidence            37788999999999999965     4456678888665553     346788887888775


No 270
>cd04159 Arl10_like Arl10-like subfamily.  Arl9/Arl10 was identified from a human cancer-derived EST dataset.  No functional information about the subfamily is available at the current time, but crystal structures of human Arl10b and Arl10c have been solved.
Probab=27.30  E-value=1.1e+02  Score=18.39  Aligned_cols=12  Identities=33%  Similarity=0.299  Sum_probs=10.2

Q ss_pred             EEEEEEeCCCCC
Q psy104           29 LRLTVVDTPGFG   40 (86)
Q Consensus        29 l~LtIidTpGfG   40 (86)
                      +.+.++||||..
T Consensus        44 ~~~~~~D~~g~~   55 (159)
T cd04159          44 VTLKVWDLGGQP   55 (159)
T ss_pred             EEEEEEECCCCH
Confidence            679999999963


No 271
>PF02089 Palm_thioest:  Palmitoyl protein thioesterase;  InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children. Mutations in the palmitoyl protein thioesterase gene causing infantile neuronal ceroid lipofuscinosis []. The most common mutation results in intracellular accumulation of the polypeptide and undetectable enzyme activity in the brain. Direct sequencing of cDNAs derived from brain RNA of INCL patients has shown a mis-sense transversion of A to T at nucleotide position 364, which results in substitution of Trp for Arg at position 122 in the protein - Arg 122 is immediately adjacent to a lipase consensus sequence that contains the putative active site Ser of PPT. The occurrence of this and two other independent mutations in the PPT gene strongly suggests that defects in this gene cause INCL.; GO: 0008474 palmitoyl-(protein) hydrolase activity, 0006464 protein modification process; PDB: 3GRO_B 1PJA_A 1EXW_A 1EH5_A 1EI9_A.
Probab=27.17  E-value=49  Score=24.45  Aligned_cols=29  Identities=31%  Similarity=0.306  Sum_probs=18.3

Q ss_pred             EEeCCCCCCccCCccchhHHHHHHHHHHH
Q psy104           33 VVDTPGFGDSINSEESWRACCSYIDDQFR   61 (86)
Q Consensus        33 IidTpGfGd~i~n~~~~~~i~~yI~~qf~   61 (86)
                      ||--.|+||+-.|..++..|.++|++.+-
T Consensus         8 vViwHGmGD~~~~~~~m~~i~~~i~~~~P   36 (279)
T PF02089_consen    8 VVIWHGMGDSCCNPSSMGSIKELIEEQHP   36 (279)
T ss_dssp             EEEE--TT--S--TTTHHHHHHHHHHHST
T ss_pred             EEEEEcCccccCChhHHHHHHHHHHHhCC
Confidence            56678999999888889999888887653


No 272
>COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism]
Probab=26.98  E-value=37  Score=25.64  Aligned_cols=11  Identities=45%  Similarity=0.643  Sum_probs=8.3

Q ss_pred             EEEEEeCCCCC
Q psy104           30 RLTVVDTPGFG   40 (86)
Q Consensus        30 ~LtIidTpGfG   40 (86)
                      -+|+|||||-=
T Consensus       153 iitfIDT~GAy  163 (317)
T COG0825         153 IITFIDTPGAY  163 (317)
T ss_pred             EEEEecCCCCC
Confidence            37899998853


No 273
>PF14149 YhfH:  YhfH-like protein
Probab=26.71  E-value=53  Score=17.09  Aligned_cols=14  Identities=29%  Similarity=0.295  Sum_probs=11.5

Q ss_pred             HHHHHHHHHHhhhh
Q psy104           53 CSYIDDQFRQYFND   66 (86)
Q Consensus        53 ~~yI~~qf~~yl~e   66 (86)
                      -+.|++|.+.|+.+
T Consensus        20 G~~i~EQ~E~Y~n~   33 (37)
T PF14149_consen   20 GKEIEEQAECYGNE   33 (37)
T ss_pred             HHHHHHHHHHHhCc
Confidence            46799999999865


No 274
>PF01797 Y1_Tnp:  Transposase IS200 like;  InterPro: IPR002686 Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This entry represents a domain found in transposases for IS200 from Escherichia coli []. More information about these proteins can be found at Protein of the Month: Transposase [].; GO: 0003677 DNA binding, 0004803 transposase activity, 0006313 transposition, DNA-mediated; PDB: 2F5G_B 2F4F_B 2EC2_F 2XM3_C 2XQC_D 2XO6_A 2XMA_E 2VJV_B 2VIH_B 2VJU_A ....
Probab=26.67  E-value=29  Score=21.10  Aligned_cols=12  Identities=25%  Similarity=0.473  Sum_probs=9.4

Q ss_pred             chhHHHHHHHHH
Q psy104           48 SWRACCSYIDDQ   59 (86)
Q Consensus        48 ~~~~i~~yI~~q   59 (86)
                      +...+.+||..|
T Consensus       110 ~~~~~~~YI~~n  121 (121)
T PF01797_consen  110 SLDNVIRYIENN  121 (121)
T ss_dssp             BHHHHHHHHHHH
T ss_pred             hHHHHHHHHhhC
Confidence            777888888765


No 275
>PLN00223 ADP-ribosylation factor; Provisional
Probab=26.64  E-value=1e+02  Score=20.22  Aligned_cols=12  Identities=33%  Similarity=0.440  Sum_probs=10.0

Q ss_pred             EEEEEEEeCCCC
Q psy104           28 KLRLTVVDTPGF   39 (86)
Q Consensus        28 ~l~LtIidTpGf   39 (86)
                      .+.|.+.||||-
T Consensus        60 ~~~~~i~D~~Gq   71 (181)
T PLN00223         60 NISFTVWDVGGQ   71 (181)
T ss_pred             CEEEEEEECCCC
Confidence            467999999994


No 276
>PRK15494 era GTPase Era; Provisional
Probab=26.27  E-value=44  Score=24.74  Aligned_cols=12  Identities=33%  Similarity=0.648  Sum_probs=9.8

Q ss_pred             EEEEEeCCCCCC
Q psy104           30 RLTVVDTPGFGD   41 (86)
Q Consensus        30 ~LtIidTpGfGd   41 (86)
                      ++.++||||+..
T Consensus       101 qi~~~DTpG~~~  112 (339)
T PRK15494        101 QVILYDTPGIFE  112 (339)
T ss_pred             EEEEEECCCcCC
Confidence            568999999853


No 277
>PRK09866 hypothetical protein; Provisional
Probab=25.52  E-value=43  Score=28.10  Aligned_cols=27  Identities=30%  Similarity=0.437  Sum_probs=16.3

Q ss_pred             EEEEEEEEee-cCeEEEEEEEeCCCCCC
Q psy104           15 IEKKSMDIEE-RGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        15 I~~~~~~l~e-~~~~l~LtIidTpGfGd   41 (86)
                      |.+...++.+ ....-.+.++||||+-.
T Consensus       215 iev~f~hl~g~l~~~~QIIFVDTPGIhk  242 (741)
T PRK09866        215 IEVEFVHLAGLESYPGQLTLLDTPGPNE  242 (741)
T ss_pred             eeeeeeeccccccccCCEEEEECCCCCC
Confidence            3344445542 22345778999999964


No 278
>cd04156 ARLTS1 ARLTS1 subfamily.  ARLTS1 (Arf-like tumor suppressor gene 1), also known as Arl11, is a member of the Arf family of small GTPases that is believed to play a major role in apoptotic signaling.  ARLTS1 is widely expressed and functions as a tumor suppressor gene in several human cancers.  ARLTS1 is a low-penetrance suppressor that accounts for a small percentage of familial melanoma or familial chronic lymphocytic leukemia (CLL).  ARLTS1 inactivation seems to occur most frequently through biallelic down-regulation by hypermethylation of the promoter.  In breast cancer, ARLTS1 alterations were typically a combination of a hypomorphic polymorphism plus loss of heterozygosity.  In a case of thyroid adenoma, ARLTS1 alterations were polymorphism plus promoter hypermethylation.  The nonsense polymorphism Trp149Stop occurs with significantly greater frequency in familial cancer cases than in sporadic cancer cases, and the Cys148Arg polymorphism is associated with an increase in h
Probab=25.50  E-value=1e+02  Score=19.03  Aligned_cols=13  Identities=46%  Similarity=0.463  Sum_probs=11.0

Q ss_pred             EEEEEEEeCCCCC
Q psy104           28 KLRLTVVDTPGFG   40 (86)
Q Consensus        28 ~l~LtIidTpGfG   40 (86)
                      .+.|.+.||||..
T Consensus        43 ~~~l~i~D~~G~~   55 (160)
T cd04156          43 HLSLTVWDVGGQE   55 (160)
T ss_pred             ceEEEEEECCCCH
Confidence            4789999999964


No 279
>PRK01908 electron transport complex protein RnfG; Validated
Probab=25.43  E-value=41  Score=23.49  Aligned_cols=12  Identities=50%  Similarity=0.933  Sum_probs=9.1

Q ss_pred             EeCCCCCCccCC
Q psy104           34 VDTPGFGDSINS   45 (86)
Q Consensus        34 idTpGfGd~i~n   45 (86)
                      -+|||+|+.+..
T Consensus       122 ~ETpGLG~~i~~  133 (205)
T PRK01908        122 HETPGLGDKIEL  133 (205)
T ss_pred             CCCcccchhhhh
Confidence            369999987754


No 280
>KOG0464|consensus
Probab=25.19  E-value=82  Score=25.51  Aligned_cols=29  Identities=31%  Similarity=0.646  Sum_probs=18.7

Q ss_pred             cceEEEEEEEEEeecCeEEEEEEEeCCCCCC
Q psy104           11 KTTTIEKKSMDIEERGVKLRLTVVDTPGFGD   41 (86)
Q Consensus        11 ~t~~I~~~~~~l~e~~~~l~LtIidTpGfGd   41 (86)
                      ..+.|+..-+.+.=.|  .++++|||||-=|
T Consensus        86 rgitiqsaav~fdwkg--~rinlidtpghvd  114 (753)
T KOG0464|consen   86 RGITIQSAAVNFDWKG--HRINLIDTPGHVD  114 (753)
T ss_pred             cCceeeeeeeeccccc--ceEeeecCCCcce
Confidence            3455666666555444  4567899999644


No 281
>PTZ00133 ADP-ribosylation factor; Provisional
Probab=24.96  E-value=1e+02  Score=20.16  Aligned_cols=13  Identities=31%  Similarity=0.468  Sum_probs=10.8

Q ss_pred             EEEEEEEeCCCCC
Q psy104           28 KLRLTVVDTPGFG   40 (86)
Q Consensus        28 ~l~LtIidTpGfG   40 (86)
                      .+.+.+.||||-.
T Consensus        60 ~~~~~l~D~~G~~   72 (182)
T PTZ00133         60 NLKFTMWDVGGQD   72 (182)
T ss_pred             CEEEEEEECCCCH
Confidence            4789999999964


No 282
>KOG0078|consensus
Probab=24.89  E-value=2.6e+02  Score=19.87  Aligned_cols=32  Identities=34%  Similarity=0.319  Sum_probs=22.5

Q ss_pred             CCcceEEEEEEEEEeecCeEEEEEEEeCCCCC
Q psy104            9 QGKTTTIEKKSMDIEERGVKLRLTVVDTPGFG   40 (86)
Q Consensus         9 ~~~t~~I~~~~~~l~e~~~~l~LtIidTpGfG   40 (86)
                      ..+|+-|.-+.-.++-+|.+++|.+.||-|=.
T Consensus        41 ~~sTiGIDFk~kti~l~g~~i~lQiWDtaGQe   72 (207)
T KOG0078|consen   41 FISTIGIDFKIKTIELDGKKIKLQIWDTAGQE   72 (207)
T ss_pred             ccceEEEEEEEEEEEeCCeEEEEEEEEcccch
Confidence            44555555554455667799999999998843


No 283
>cd04143 Rhes_like Rhes_like subfamily.  This subfamily includes Rhes (Ras homolog enriched in striatum) and Dexras1/AGS1 (activator of G-protein signaling 1).  These proteins are homologous, but exhibit significant differences in tissue distribution and subcellular localization.  Rhes is found primarily in the striatum of the brain, but is also expressed in other areas of the brain, such as the cerebral cortex, hippocampus, inferior colliculus, and cerebellum.  Rhes expression is controlled by thyroid hormones.  In rat PC12 cells, Rhes is farnesylated and localizes to the plasma membrane.  Rhes binds and activates PI3K, and plays a role in coupling serpentine membrane receptors with heterotrimeric G-protein signaling.  Rhes has recently been shown to be reduced under conditions of dopamine supersensitivity and may play a role in determining dopamine receptor sensitivity.  Dexras1/AGS1 is a dexamethasone-induced Ras protein that is expressed primarily in the brain, with low expression l
Probab=24.70  E-value=1.5e+02  Score=20.88  Aligned_cols=16  Identities=38%  Similarity=0.580  Sum_probs=13.1

Q ss_pred             cCeEEEEEEEeCCCCC
Q psy104           25 RGVKLRLTVVDTPGFG   40 (86)
Q Consensus        25 ~~~~l~LtIidTpGfG   40 (86)
                      ++-.+.|.|.||+|..
T Consensus        44 ~~~~~~l~I~Dt~G~~   59 (247)
T cd04143          44 RGEVYQLDILDTSGNH   59 (247)
T ss_pred             CCEEEEEEEEECCCCh
Confidence            4567999999999953


No 284
>PF11144 DUF2920:  Protein of unknown function (DUF2920);  InterPro: IPR022605  This bacterial family of proteins has no known function. 
Probab=24.63  E-value=48  Score=25.81  Aligned_cols=33  Identities=30%  Similarity=0.506  Sum_probs=21.8

Q ss_pred             EEEEEEEeCCCCCCccCCccchhHHHHHHHHHHH
Q psy104           28 KLRLTVVDTPGFGDSINSEESWRACCSYIDDQFR   61 (86)
Q Consensus        28 ~l~LtIidTpGfGd~i~n~~~~~~i~~yI~~qf~   61 (86)
                      .++--|+-.||||...|... ..-+.+|+..+|.
T Consensus        33 e~kaIvfiI~GfG~dan~~~-~d~~r~~iA~~fn   65 (403)
T PF11144_consen   33 EIKAIVFIIPGFGADANSNY-LDFMREYIAKKFN   65 (403)
T ss_pred             CceEEEEEeCCcCCCcchHH-HHHHHHHHHHhCC
Confidence            55556777899999888653 2455555555554


No 285
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins.  GTPases act as molecular switches regulating diverse cellular processes.  DRG2 and DRG1 comprise the DRG subfamily in eukaryotes.  In view of their widespread expression in various tissues and high conservation among distantly related species in eukaryotes and archaea, DRG proteins may regulate fundamental cellular processes.  It is proposed that the DRG subfamily proteins play their physiological roles through RNA binding.
Probab=24.54  E-value=56  Score=22.76  Aligned_cols=12  Identities=25%  Similarity=0.612  Sum_probs=9.7

Q ss_pred             EEEEEEeCCCCC
Q psy104           29 LRLTVVDTPGFG   40 (86)
Q Consensus        29 l~LtIidTpGfG   40 (86)
                      ..+.++||||+-
T Consensus        47 ~~i~l~DtpG~~   58 (233)
T cd01896          47 AKIQLLDLPGII   58 (233)
T ss_pred             eEEEEEECCCcc
Confidence            467899999983


No 286
>KOG0395|consensus
Probab=24.48  E-value=1.8e+02  Score=19.89  Aligned_cols=27  Identities=22%  Similarity=0.325  Sum_probs=18.8

Q ss_pred             cceEEEEEEEEEeecCeEEEEEEEeCCC
Q psy104           11 KTTTIEKKSMDIEERGVKLRLTVVDTPG   38 (86)
Q Consensus        11 ~t~~I~~~~~~l~e~~~~l~LtIidTpG   38 (86)
                      +|.+ ..|.-.+.-++-...|.|.||+|
T Consensus        34 ptie-d~y~k~~~v~~~~~~l~ilDt~g   60 (196)
T KOG0395|consen   34 PTIE-DSYRKELTVDGEVCMLEILDTAG   60 (196)
T ss_pred             CCcc-ccceEEEEECCEEEEEEEEcCCC
Confidence            3443 44444555557889999999999


No 287
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional
Probab=24.17  E-value=1.4e+02  Score=19.75  Aligned_cols=16  Identities=31%  Similarity=0.478  Sum_probs=13.2

Q ss_pred             EEEEEEeCCCCCCccC
Q psy104           29 LRLTVVDTPGFGDSIN   44 (86)
Q Consensus        29 l~LtIidTpGfGd~i~   44 (86)
                      .++-.+|-||+|.+-.
T Consensus        28 ~~vi~~D~~G~G~S~~   43 (242)
T PRK11126         28 YPRLYIDLPGHGGSAA   43 (242)
T ss_pred             CCEEEecCCCCCCCCC
Confidence            6788999999997644


No 288
>PRK09554 feoB ferrous iron transport protein B; Reviewed
Probab=24.11  E-value=1.4e+02  Score=25.02  Aligned_cols=14  Identities=36%  Similarity=0.451  Sum_probs=10.9

Q ss_pred             EEEEEEeCCCCCCc
Q psy104           29 LRLTVVDTPGFGDS   42 (86)
Q Consensus        29 l~LtIidTpGfGd~   42 (86)
                      .+++++||||.-+.
T Consensus        50 ~~i~lvDtPG~ysl   63 (772)
T PRK09554         50 HQVTLVDLPGTYSL   63 (772)
T ss_pred             eEEEEEECCCcccc
Confidence            45789999998653


No 289
>PF10662 PduV-EutP:  Ethanolamine utilisation - propanediol utilisation;  InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways. Both pathways require coenzyme B12 (adenosylcobalamin, AdoCbl). Bacteria that harbour these pathways can use ethanolamine as a source of carbon and nitrogen, or propanediol as a sole carbon and energy source, respectively. The exact roles of the EutP and PduV proteins in these respective pathways are not yet determined. Members of this family contain P-loop consensus motifs in the N-terminal part, and are distantly related to various GTPases and ATPases, including ATPase components of transport systems. Propanediol degradation is thought to be important for the natural Salmonella populations, since propanediol is produced by the fermentation of the common plant sugars rhamnose and fucose [, ]. More than 1% of the Salmonella enterica genome is devoted to the utilisation of propanediol and cobalamin biosynthesis. In vivo expression technology has indicated that propanediol utilisation (pdu) genes may be important for growth in host tissues, and competitive index studies with mice have shown that pdu mutations confer a virulence defect [, ]. The pdu operon is contiguous and co-regulated with the cobalamin (B12) biosynthesis cob operon, indicating that propanediol catabolism may be the primary reason for de novo B12 synthesis in Salmonella [, , ]. Please see IPR003207 from INTERPRO, IPR003208 from INTERPRO, IPR009204 from INTERPRO, IPR009191 from INTERPRO, IPR009192 from INTERPRO for more details on the propanediol utilisation pathway and the pdu operon.; GO: 0005524 ATP binding, 0006576 cellular biogenic amine metabolic process
Probab=23.71  E-value=36  Score=22.62  Aligned_cols=7  Identities=57%  Similarity=1.189  Sum_probs=5.8

Q ss_pred             EEEeCCC
Q psy104           32 TVVDTPG   38 (86)
Q Consensus        32 tIidTpG   38 (86)
                      .+|||||
T Consensus        39 ~~IDTPG   45 (143)
T PF10662_consen   39 NTIDTPG   45 (143)
T ss_pred             cEEECCh
Confidence            4799997


No 290
>PHA02130 hypothetical protein
Probab=23.46  E-value=37  Score=20.13  Aligned_cols=20  Identities=25%  Similarity=0.747  Sum_probs=16.8

Q ss_pred             cchhHHHHHHHHHHHHhhhh
Q psy104           47 ESWRACCSYIDDQFRQYFND   66 (86)
Q Consensus        47 ~~~~~i~~yI~~qf~~yl~e   66 (86)
                      .+|+.+.++++++|+.+=..
T Consensus        14 ks~~sl~~wl~~~~dswddd   33 (81)
T PHA02130         14 KSWESLREWLDERFDSWDDD   33 (81)
T ss_pred             HHHHHHHHHHHhcccccccc
Confidence            58999999999999987544


No 291
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated. This group of proteins are members of the alpha/beta hydrolase superfamily. These proteins are generally found in genomes containing the exosortase/PEP-CTERM protein expoert system, specifically the type 1 variant of this system described by the Genome Property GenProp0652. When found in this context they are invariably present in the vicinity of a second, relatively unrelated enzyme (ortholog 2, TIGR03101) of the same superfamily.
Probab=23.29  E-value=2.3e+02  Score=19.80  Aligned_cols=33  Identities=18%  Similarity=0.225  Sum_probs=20.6

Q ss_pred             EEEEEEeCCCCCCccCCccchhHHHHHHHHHHH
Q psy104           29 LRLTVVDTPGFGDSINSEESWRACCSYIDDQFR   61 (86)
Q Consensus        29 l~LtIidTpGfGd~i~n~~~~~~i~~yI~~qf~   61 (86)
                      +..-.+|.||+|++......|.....-+.+-++
T Consensus        58 ~~v~~~Dl~G~G~S~~~~~~~~~~~~d~~~~~~   90 (274)
T TIGR03100        58 FPVLRFDYRGMGDSEGENLGFEGIDADIAAAID   90 (274)
T ss_pred             CEEEEeCCCCCCCCCCCCCCHHHHHHHHHHHHH
Confidence            567799999999876544445444333444433


No 292
>COG1160 Predicted GTPases [General function prediction only]
Probab=23.28  E-value=1.3e+02  Score=23.82  Aligned_cols=32  Identities=19%  Similarity=0.204  Sum_probs=19.5

Q ss_pred             EEEEEEeCCCCCCccCCccchhHHHHHHHHHHHHhhh
Q psy104           29 LRLTVVDTPGFGDSINSEESWRACCSYIDDQFRQYFN   65 (86)
Q Consensus        29 l~LtIidTpGfGd~i~n~~~~~~i~~yI~~qf~~yl~   65 (86)
                      ..+.+|||+|+-+.-+     .++..-+.+|=+.-+.
T Consensus        51 ~~f~lIDTgGl~~~~~-----~~l~~~i~~Qa~~Ai~   82 (444)
T COG1160          51 REFILIDTGGLDDGDE-----DELQELIREQALIAIE   82 (444)
T ss_pred             ceEEEEECCCCCcCCc-----hHHHHHHHHHHHHHHH
Confidence            4588999999964332     2345555555554443


No 293
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma. eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA.
Probab=23.17  E-value=55  Score=24.82  Aligned_cols=12  Identities=42%  Similarity=0.739  Sum_probs=10.1

Q ss_pred             EEEEEEEeCCCC
Q psy104           28 KLRLTVVDTPGF   39 (86)
Q Consensus        28 ~l~LtIidTpGf   39 (86)
                      ..+++++||||-
T Consensus        79 ~~~i~liDtPGh   90 (406)
T TIGR03680        79 LRRVSFVDAPGH   90 (406)
T ss_pred             ccEEEEEECCCH
Confidence            457899999995


No 294
>PLN02824 hydrolase, alpha/beta fold family protein
Probab=23.08  E-value=2e+02  Score=19.86  Aligned_cols=12  Identities=33%  Similarity=0.609  Sum_probs=6.3

Q ss_pred             EEEEeCCCCCCc
Q psy104           31 LTVVDTPGFGDS   42 (86)
Q Consensus        31 LtIidTpGfGd~   42 (86)
                      +-.+|-||+|.+
T Consensus        58 vi~~DlpG~G~S   69 (294)
T PLN02824         58 VYAIDLLGYGYS   69 (294)
T ss_pred             EEEEcCCCCCCC
Confidence            344555555544


No 295
>KOG0468|consensus
Probab=22.82  E-value=1e+02  Score=26.35  Aligned_cols=31  Identities=19%  Similarity=0.502  Sum_probs=22.0

Q ss_pred             CcceEEEEEEEEE---eecCeEEEEEEEeCCCCC
Q psy104           10 GKTTTIEKKSMDI---EERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        10 ~~t~~I~~~~~~l---~e~~~~l~LtIidTpGfG   40 (86)
                      ....+|......+   ..+|...-++++||||==
T Consensus       175 eRg~sIK~~p~Tl~l~D~~~KS~l~nilDTPGHV  208 (971)
T KOG0468|consen  175 ERGCSIKSTPVTLVLSDSKGKSYLMNILDTPGHV  208 (971)
T ss_pred             hcCceEeecceEEEEecCcCceeeeeeecCCCcc
Confidence            4456666655533   367889999999999963


No 296
>PF07885 Ion_trans_2:  Ion channel;  InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria []. ; PDB: 1KKD_A 2A0L_A 1ORQ_C 3UKM_C 1LNQ_E 3OUS_A 3LDC_A 3LDD_A 3RBZ_A 3LDE_A ....
Probab=22.73  E-value=58  Score=18.50  Aligned_cols=17  Identities=29%  Similarity=0.561  Sum_probs=9.7

Q ss_pred             EeCCCCCCccCCccchh
Q psy104           34 VDTPGFGDSINSEESWR   50 (86)
Q Consensus        34 idTpGfGd~i~n~~~~~   50 (86)
                      +-|-||||-...+...+
T Consensus        36 ~tTvGyGDi~p~t~~gr   52 (79)
T PF07885_consen   36 ITTVGYGDIVPQTPAGR   52 (79)
T ss_dssp             HTT---SSSSTSSHHHH
T ss_pred             HhcccCCCccCCccchH
Confidence            46899999988864433


No 297
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated
Probab=22.72  E-value=57  Score=24.89  Aligned_cols=13  Identities=38%  Similarity=0.715  Sum_probs=10.5

Q ss_pred             EEEEEEeCCCCCC
Q psy104           29 LRLTVVDTPGFGD   41 (86)
Q Consensus        29 l~LtIidTpGfGd   41 (86)
                      .+++++||||..+
T Consensus        85 ~~i~liDtPG~~~   97 (411)
T PRK04000         85 RRVSFVDAPGHET   97 (411)
T ss_pred             cEEEEEECCCHHH
Confidence            5789999999643


No 298
>PF06500 DUF1100:  Alpha/beta hydrolase of unknown function (DUF1100);  InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate []. This entry also includes 2,6-dihydropseudooxynicotine hydrolase which has a role in nicotine catabolism by cleaving a C-C bond in 2,6-dihydroxypseudooxyicotine [, ].; PDB: 3OUR_A 3MVE_B 2JBW_C.
Probab=22.53  E-value=1.1e+02  Score=23.93  Aligned_cols=30  Identities=30%  Similarity=0.529  Sum_probs=17.1

Q ss_pred             EEEEEEeCCCCCCcc------CCccchhHHHHHHHH
Q psy104           29 LRLTVVDTPGFGDSI------NSEESWRACCSYIDD   58 (86)
Q Consensus        29 l~LtIidTpGfGd~i------~n~~~~~~i~~yI~~   58 (86)
                      +..-++|-||.|++.      |-+.-|.+|++|+..
T Consensus       219 iA~LtvDmPG~G~s~~~~l~~D~~~l~~aVLd~L~~  254 (411)
T PF06500_consen  219 IAMLTVDMPGQGESPKWPLTQDSSRLHQAVLDYLAS  254 (411)
T ss_dssp             -EEEEE--TTSGGGTTT-S-S-CCHHHHHHHHHHHH
T ss_pred             CEEEEEccCCCcccccCCCCcCHHHHHHHHHHHHhc
Confidence            345579999999863      222237777777655


No 299
>cd01899 Ygr210 Ygr210 subfamily.  Ygr210 is a member of Obg-like family and present in archaea and fungi.  They are characterized by a distinct glycine-rich motif immediately following the Walker B motif.  The Ygr210 and YyaF/YchF subfamilies appear to form one major branch of the Obg-like family.  Among eukaryotes, the Ygr210 subfamily is represented only in fungi.  These fungal proteins form a tight cluster with their archaeal orthologs, which suggests the possibility of horizontal transfer from archaea to fungi.
Probab=22.22  E-value=54  Score=24.31  Aligned_cols=11  Identities=18%  Similarity=0.640  Sum_probs=9.9

Q ss_pred             EEEEEEeCCCC
Q psy104           29 LRLTVVDTPGF   39 (86)
Q Consensus        29 l~LtIidTpGf   39 (86)
                      +.+.++||||+
T Consensus        69 v~i~l~D~aGl   79 (318)
T cd01899          69 VPVELIDVAGL   79 (318)
T ss_pred             ceEEEEECCCC
Confidence            56999999999


No 300
>PRK15467 ethanolamine utilization protein EutP; Provisional
Probab=22.18  E-value=35  Score=22.03  Aligned_cols=9  Identities=44%  Similarity=0.342  Sum_probs=7.4

Q ss_pred             EEeCCCCCC
Q psy104           33 VVDTPGFGD   41 (86)
Q Consensus        33 IidTpGfGd   41 (86)
                      ++||||+..
T Consensus        41 ~iDtpG~~~   49 (158)
T PRK15467         41 DIDTPGEYF   49 (158)
T ss_pred             cccCCcccc
Confidence            699999863


No 301
>KOG0097|consensus
Probab=22.14  E-value=1.3e+02  Score=20.71  Aligned_cols=30  Identities=33%  Similarity=0.372  Sum_probs=20.1

Q ss_pred             CcceEEEEEEEEEeecCeEEEEEEEeCCCC
Q psy104           10 GKTTTIEKKSMDIEERGVKLRLTVVDTPGF   39 (86)
Q Consensus        10 ~~t~~I~~~~~~l~e~~~~l~LtIidTpGf   39 (86)
                      +.|+-+.--+-.|+-.|-+++|.|-||.|-
T Consensus        41 phtigvefgtriievsgqkiklqiwdtagq   70 (215)
T KOG0097|consen   41 PHTIGVEFGTRIIEVSGQKIKLQIWDTAGQ   70 (215)
T ss_pred             CcccceecceeEEEecCcEEEEEEeecccH
Confidence            344444444445566678999999999874


No 302
>PF09623 Cas_NE0113:  CRISPR-associated protein NE0113 (Cas_NE0113);  InterPro: IPR019092 Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) are a family of DNA direct repeats separated by regularly sized non-repetitive spacer sequences that are found in most bacterial and archaeal genomes []. CRISPRs appear to provide acquired resistance against bacteriophages, possibly acting with an RNA interference-like mechanism to inhibit gene functions of invasive DNA elements [, ]. Differences in the number and type of spacers between CRISPR repeats correlate with phage sensitivity. It is thought that following phage infection, bacteria integrate new spacers derived from phage genomic sequences, and that the removal or addition of particular spacers modifies the phage-resistance phenotype of the cell. Therefore, the specificity of CRISPRs may be determined by spacer-phage sequence similarity. In addition, there are many protein families known as CRISPR-associated sequences (Cas), which are encoded in the vicinity of CRISPR loci []. CRISPR/cas gene regions can be quite large, with up to 20 different, tandem-arranged cas genes next to a CRISPR cluster or filling the region between two repeat clusters. Cas genes and CRISPRs are found on mobile genetic elements such as plasmids, and have undergone extensive horizontal transfer. Cas proteins are thought to be involved in the propagation and functioning of CRISPRs. Some Cas proteins show similarity to helicases and repair proteins, although the functions of most are unknown. Cas families can be divided into subtypes according to operon organisation and phylogeny.   This entry represents a Cas protein family found in both bacteria and arachaea. The function of these proteins is unknown. 
Probab=22.12  E-value=58  Score=23.22  Aligned_cols=10  Identities=20%  Similarity=0.049  Sum_probs=8.2

Q ss_pred             CCCeeEEeec
Q psy104           76 VDNREVVDKS   85 (86)
Q Consensus        76 ~D~RVH~Cl~   85 (86)
                      .+.||||||+
T Consensus       111 ~~~~lh~sIA  120 (224)
T PF09623_consen  111 PGRRLHVSIA  120 (224)
T ss_pred             CCCeEEEEec
Confidence            3588999997


No 303
>COG1161 Predicted GTPases [General function prediction only]
Probab=22.06  E-value=51  Score=24.38  Aligned_cols=10  Identities=40%  Similarity=0.747  Sum_probs=8.9

Q ss_pred             EEEEeCCCCC
Q psy104           31 LTVVDTPGFG   40 (86)
Q Consensus        31 LtIidTpGfG   40 (86)
                      +-++||||+-
T Consensus       179 i~LlDtPGii  188 (322)
T COG1161         179 IYLLDTPGII  188 (322)
T ss_pred             eEEecCCCcC
Confidence            7799999985


No 304
>PF11342 DUF3144:  Protein of unknown function (DUF3144);  InterPro: IPR021490  This family of proteins with unknown function appears to be restricted to Proteobacteria. 
Probab=21.81  E-value=1e+02  Score=18.45  Aligned_cols=19  Identities=16%  Similarity=0.503  Sum_probs=15.7

Q ss_pred             hhHHHHHHHHHHHHhhhhh
Q psy104           49 WRACCSYIDDQFRQYFNDE   67 (86)
Q Consensus        49 ~~~i~~yI~~qf~~yl~eE   67 (86)
                      =+.+++|..+||+..|.+-
T Consensus        55 ke~~i~~f~~qy~~mL~~n   73 (78)
T PF11342_consen   55 KEEAIDYFTEQYRKMLEEN   73 (78)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            3578999999999998763


No 305
>COG2869 NqrC Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrC [Energy production and conversion]
Probab=21.76  E-value=51  Score=24.19  Aligned_cols=16  Identities=38%  Similarity=0.960  Sum_probs=12.9

Q ss_pred             EeCCCCCCccCCccchh
Q psy104           34 VDTPGFGDSINSEESWR   50 (86)
Q Consensus        34 idTpGfGd~i~n~~~~~   50 (86)
                      -+|||+|-.|.|- .|+
T Consensus       176 GETPGLGgeI~NP-~Wq  191 (264)
T COG2869         176 GETPGLGGEIENP-KWQ  191 (264)
T ss_pred             CCCCCCccccCCH-HHH
Confidence            3799999999987 455


No 306
>PF04670 Gtr1_RagA:  Gtr1/RagA G protein conserved region;  InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1. RCC1 catalyzes guanine nucleotide exchange on Ran, a well characterised nuclear Ras-like small G protein that plays an essential role in the import and export of proteins and RNAs across the nuclear membrane through the nuclear pore complex. RCC1 is located inside the nucleus, bound to chromatin. The concentration of GTP within the cell is ~30 times higher than the concentration of GDP, thus resulting in the preferential production of the GTP form of Ran by RCC1 within the nucleus. Gtr1p is located within both the cytoplasm and the nucleus and has been reported to play a role in cell growth. Biochemical analysis revealed that Gtr1 is in fact a G protein of the Ras family. The RagA/B proteins are the human homologues of Gtr1 and Rag A and Gtr1p belong to the sixth subfamily of the Ras-like small GTPase superfamily []. ; GO: 0005525 GTP binding, 0005634 nucleus, 0005737 cytoplasm; PDB: 3R7W_B 2Q3F_B 3LLU_A.
Probab=21.69  E-value=64  Score=22.95  Aligned_cols=35  Identities=26%  Similarity=0.312  Sum_probs=19.8

Q ss_pred             CCcceEEEEEEEEEeecCeEEEEEEEeCCCCCCccCCc
Q psy104            9 QGKTTTIEKKSMDIEERGVKLRLTVVDTPGFGDSINSE   46 (86)
Q Consensus         9 ~~~t~~I~~~~~~l~e~~~~l~LtIidTpGfGd~i~n~   46 (86)
                      ...|..++...+....   -+.|+|.|.||-.+-..+.
T Consensus        31 L~~T~~ve~~~v~~~~---~~~l~iwD~pGq~~~~~~~   65 (232)
T PF04670_consen   31 LEPTIDVEKSHVRFLS---FLPLNIWDCPGQDDFMENY   65 (232)
T ss_dssp             -----SEEEEEEECTT---SCEEEEEEE-SSCSTTHTT
T ss_pred             cCCcCCceEEEEecCC---CcEEEEEEcCCcccccccc
Confidence            4566666655543222   3689999999998777763


No 307
>PTZ00014 myosin-A; Provisional
Probab=21.55  E-value=1.5e+02  Score=25.10  Aligned_cols=35  Identities=17%  Similarity=0.261  Sum_probs=25.3

Q ss_pred             EEEEEEEeCCCCCCccCCccchhHH-HHHHHHHHHHhh
Q psy104           28 KLRLTVVDTPGFGDSINSEESWRAC-CSYIDDQFRQYF   64 (86)
Q Consensus        28 ~l~LtIidTpGfGd~i~n~~~~~~i-~~yI~~qf~~yl   64 (86)
                      ...+.|.|.+||=..-  .++|+.+ ++|-.+++.+++
T Consensus       461 ~~~IGiLDI~GFE~f~--~NSfEQLcINy~NEkLQq~F  496 (821)
T PTZ00014        461 KVFIGMLDIFGFEVFK--NNSLEQLFINITNEMLQKNF  496 (821)
T ss_pred             CceEEEEecccccccC--cchHHHHHHHHHHHHHHHHH
Confidence            3468899999995443  3467744 889888877774


No 308
>KOG4742|consensus
Probab=21.54  E-value=36  Score=25.35  Aligned_cols=11  Identities=55%  Similarity=1.047  Sum_probs=8.7

Q ss_pred             EEeCCCCCCcc
Q psy104           33 VVDTPGFGDSI   43 (86)
Q Consensus        33 IidTpGfGd~i   43 (86)
                      -.||||||.++
T Consensus       234 ~~~~~gFGaTt  244 (286)
T KOG4742|consen  234 AYDTPGFGATT  244 (286)
T ss_pred             cccCCCcchhh
Confidence            36899999773


No 309
>KOG0079|consensus
Probab=21.47  E-value=1.7e+02  Score=20.34  Aligned_cols=25  Identities=28%  Similarity=0.586  Sum_probs=18.8

Q ss_pred             ceEEEEEEEEEeecCeEEEEEEEeCCC
Q psy104           12 TTTIEKKSMDIEERGVKLRLTVVDTPG   38 (86)
Q Consensus        12 t~~I~~~~~~l~e~~~~l~LtIidTpG   38 (86)
                      .+.+..+++++.  |-+++|-|-||.|
T Consensus        42 GvDfkirTv~i~--G~~VkLqIwDtAG   66 (198)
T KOG0079|consen   42 GVDFKIRTVDIN--GDRVKLQIWDTAG   66 (198)
T ss_pred             eeeEEEEEeecC--CcEEEEEEeeccc
Confidence            355666666666  6788899999987


No 310
>PF01039 Carboxyl_trans:  Carboxyl transferase domain;  InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ]. The carboxyl transferase domain carries out the following reaction; transcarboxylation from biotin to an acceptor molecule. There are two recognised types of carboxyl transferase. One of them uses acyl-CoA and the other uses 2-oxo acid as the acceptor molecule of carbon dioxide. All of the members in this family utilise acyl-CoA as the acceptor molecule.; GO: 0016874 ligase activity; PDB: 2F9Y_B 1XO6_B 1XNV_B 3MFM_C 3IBB_A 1XNW_F 3IAV_B 1XNY_A 3IB9_A 3U9S_F ....
Probab=21.35  E-value=72  Score=25.05  Aligned_cols=36  Identities=25%  Similarity=0.261  Sum_probs=21.6

Q ss_pred             CeEEEEEEEeCCCCCCccCCccchhHHHHHHHHHHHHhh
Q psy104           26 GVKLRLTVVDTPGFGDSINSEESWRACCSYIDDQFRQYF   64 (86)
Q Consensus        26 ~~~l~LtIidTpGfGd~i~n~~~~~~i~~yI~~qf~~yl   64 (86)
                      ++|| |+++|||||=  ...+.-+.-+.+++..-+..|-
T Consensus       329 ~iPl-v~l~dtpGf~--~g~~~E~~g~~~~ga~~~~a~~  364 (493)
T PF01039_consen  329 NIPL-VTLVDTPGFM--PGPEAERAGIIRAGARLLYALA  364 (493)
T ss_dssp             T--E-EEEEEECEB----SHHHHHTTHHHHHHHHHHHHH
T ss_pred             CCce-EEEeeccccc--ccchhhhcchHHHHHHHHHHHH
Confidence            4553 7899999994  4444445567777776666553


No 311
>TIGR02729 Obg_CgtA Obg family GTPase CgtA. This model describes a univeral, mostly one-gene-per-genome GTP-binding protein that associates with ribosomal subunits and appears to play a role in ribosomal RNA maturation. This GTPase, related to the nucleolar protein Obg, is designated CgtA in bacteria. Mutations in this gene are pleiotropic, but it appears that effects on cellular functions such as chromosome partition may be secondary to the effect on ribosome structure. Recent work done in Vibrio cholerae shows an essential role in the stringent response, in which RelA-dependent ability to synthesize the alarmone ppGpp is required for deletion of this GTPase to be lethal.
Probab=21.15  E-value=70  Score=23.71  Aligned_cols=12  Identities=25%  Similarity=0.517  Sum_probs=10.2

Q ss_pred             EEEEEEeCCCCC
Q psy104           29 LRLTVVDTPGFG   40 (86)
Q Consensus        29 l~LtIidTpGfG   40 (86)
                      .+++++||||+.
T Consensus       205 ~~~~i~D~PGli  216 (329)
T TIGR02729       205 RSFVIADIPGLI  216 (329)
T ss_pred             eEEEEEeCCCcc
Confidence            567899999984


No 312
>PRK09601 GTP-binding protein YchF; Reviewed
Probab=21.07  E-value=60  Score=24.81  Aligned_cols=15  Identities=27%  Similarity=0.397  Sum_probs=11.7

Q ss_pred             eEEEEEEEeCCCCCC
Q psy104           27 VKLRLTVVDTPGFGD   41 (86)
Q Consensus        27 ~~l~LtIidTpGfGd   41 (86)
                      ++-.+.++||||+-.
T Consensus        64 ~~a~i~lvD~pGL~~   78 (364)
T PRK09601         64 VPATIEFVDIAGLVK   78 (364)
T ss_pred             cCceEEEEECCCCCC
Confidence            345789999999853


No 313
>PRK12297 obgE GTPase CgtA; Reviewed
Probab=21.03  E-value=68  Score=24.88  Aligned_cols=13  Identities=23%  Similarity=0.508  Sum_probs=10.7

Q ss_pred             EEEEEEeCCCCCC
Q psy104           29 LRLTVVDTPGFGD   41 (86)
Q Consensus        29 l~LtIidTpGfGd   41 (86)
                      .+++++||||++.
T Consensus       206 ~~~~laD~PGlie  218 (424)
T PRK12297        206 RSFVMADIPGLIE  218 (424)
T ss_pred             ceEEEEECCCCcc
Confidence            4688999999963


No 314
>PRK06004 flgB flagellar basal body rod protein FlgB; Reviewed
Probab=20.85  E-value=38  Score=21.81  Aligned_cols=7  Identities=71%  Similarity=1.308  Sum_probs=6.2

Q ss_pred             EeCCCCC
Q psy104           34 VDTPGFG   40 (86)
Q Consensus        34 idTpGfG   40 (86)
                      +|||||-
T Consensus        23 ~~Tpgyk   29 (127)
T PRK06004         23 ADTPGFR   29 (127)
T ss_pred             cCCCCcc
Confidence            6999996


No 315
>cd00879 Sar1 Sar1 subfamily.  Sar1 is an essential component of COPII vesicle coats involved in export of cargo from the ER.  The GTPase activity of Sar1 functions as a molecular switch to control protein-protein and protein-lipid interactions that direct vesicle budding from the ER.  Activation of the GDP to the GTP-bound form of Sar1 involves the membrane-associated guanine nucleotide exchange factor (GEF) Sec12.  Sar1 is unlike all Ras superfamily GTPases that use either myristoyl or prenyl groups to direct membrane association and function, in that Sar1 lacks such modification.  Instead, Sar1 contains a unique nine-amino-acid N-terminal extension.  This extension contains an evolutionarily conserved cluster of bulky hydrophobic amino acids, referred to as the Sar1-N-terminal activation recruitment (STAR) motif.  The STAR motif mediates the recruitment of Sar1 to ER membranes and facilitates its interaction with mammalian Sec12 GEF leading to activation.
Probab=20.74  E-value=1.3e+02  Score=19.30  Aligned_cols=12  Identities=17%  Similarity=0.423  Sum_probs=9.8

Q ss_pred             EEEEEEeCCCCC
Q psy104           29 LRLTVVDTPGFG   40 (86)
Q Consensus        29 l~LtIidTpGfG   40 (86)
                      +.+.++||||..
T Consensus        63 ~~~~l~D~~G~~   74 (190)
T cd00879          63 IKFKTFDLGGHE   74 (190)
T ss_pred             EEEEEEECCCCH
Confidence            568899999964


No 316
>COG1815 FlgB Flagellar basal body protein [Cell motility and secretion]
Probab=20.64  E-value=40  Score=22.24  Aligned_cols=8  Identities=50%  Similarity=0.970  Sum_probs=6.5

Q ss_pred             EEeCCCCC
Q psy104           33 VVDTPGFG   40 (86)
Q Consensus        33 IidTpGfG   40 (86)
                      =+|||||-
T Consensus        31 NadTP~yK   38 (133)
T COG1815          31 NADTPGYK   38 (133)
T ss_pred             cCCCCCCC
Confidence            37999995


No 317
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis]
Probab=20.55  E-value=1e+02  Score=24.82  Aligned_cols=29  Identities=21%  Similarity=0.377  Sum_probs=18.4

Q ss_pred             ceEEEEEEEEEeecCeEEEEEEEeCCCCCCc
Q psy104           12 TTTIEKKSMDIEERGVKLRLTVVDTPGFGDS   42 (86)
Q Consensus        12 t~~I~~~~~~l~e~~~~l~LtIidTpGfGd~   42 (86)
                      .++|+++-..++=+  ...+++.||||=-|.
T Consensus        66 GISVtsSVMqF~Y~--~~~iNLLDTPGHeDF   94 (528)
T COG4108          66 GISVTSSVMQFDYA--DCLVNLLDTPGHEDF   94 (528)
T ss_pred             CceEEeeEEEeccC--CeEEeccCCCCcccc
Confidence            45555555444433  356789999997654


No 318
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase. This protein catalyzes the formation of SHCHC, or (1 R,6 R)-2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate, by elmination of pyruvate from 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate (SEPHCHC). Note that SHCHC synthase activity previously was attributed to MenD, which in fact is SEPHCHC synthase.
Probab=20.52  E-value=2.3e+02  Score=17.84  Aligned_cols=27  Identities=22%  Similarity=0.420  Sum_probs=17.6

Q ss_pred             EEEEEEeCCCCCCccCC----ccchhHHHHH
Q psy104           29 LRLTVVDTPGFGDSINS----EESWRACCSY   55 (86)
Q Consensus        29 l~LtIidTpGfGd~i~n----~~~~~~i~~y   55 (86)
                      +.+-.+|-||+|.+-..    ..+|..+++.
T Consensus        28 ~~v~~~d~~g~G~s~~~~~~~~~~~~~~~~~   58 (251)
T TIGR03695        28 FRCLAIDLPGHGSSQSPDEIERYDFEEAAQD   58 (251)
T ss_pred             CeEEEEcCCCCCCCCCCCccChhhHHHHHHH
Confidence            45678999999987442    2345555544


No 319
>PF09547 Spore_IV_A:  Stage IV sporulation protein A (spore_IV_A);  InterPro: IPR014201 This entry is designated stage IV sporulation protein A. It acts in the mother cell compartment and plays a role in spore coat morphogenesis []. A comparative genome analysis of all sequenced genomes of Firmicutes shows that the proteins are strictly conserved among the sub-set of endospore-forming species. 
Probab=20.49  E-value=73  Score=25.49  Aligned_cols=17  Identities=24%  Similarity=0.724  Sum_probs=15.2

Q ss_pred             ecCeEEEEEEEeCCCCC
Q psy104           24 ERGVKLRLTVVDTPGFG   40 (86)
Q Consensus        24 e~~~~l~LtIidTpGfG   40 (86)
                      ++++.+++++||+.||-
T Consensus        86 ~~~~~~kVRLiDCVGy~  102 (492)
T PF09547_consen   86 DDGIKVKVRLIDCVGYM  102 (492)
T ss_pred             cCCceEEEEEEeeccee
Confidence            67899999999999984


No 320
>PRK12620 flgB flagellar basal body rod protein FlgB; Provisional
Probab=20.35  E-value=41  Score=21.54  Aligned_cols=7  Identities=71%  Similarity=1.369  Sum_probs=6.0

Q ss_pred             EeCCCCC
Q psy104           34 VDTPGFG   40 (86)
Q Consensus        34 idTpGfG   40 (86)
                      +|||||-
T Consensus        33 adTPgYk   39 (132)
T PRK12620         33 VDTPGYK   39 (132)
T ss_pred             cCCCCcC
Confidence            6999995


No 321
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase. This family consists of the polyhydroxyalkanoic acid (PHA) depolymerase of Pseudomonas oleovorans, Pseudomonas putida BM01, and related species. This enzyme is part of polyester storage and mobilization system as in many bacteria. However, species containing this enzyme are unusual in their capacity to produce aromatic polyesters when grown on carbon sources such as benzoic acid or phenylacetic acid.
Probab=20.23  E-value=2.4e+02  Score=19.25  Aligned_cols=29  Identities=21%  Similarity=0.363  Sum_probs=17.2

Q ss_pred             EEEEEEeCCCCCCccCCc--cchhHHHHHHH
Q psy104           29 LRLTVVDTPGFGDSINSE--ESWRACCSYID   57 (86)
Q Consensus        29 l~LtIidTpGfGd~i~n~--~~~~~i~~yI~   57 (86)
                      .++-.+|-||+|.+-...  .++..+.+.+.
T Consensus        52 ~~vi~~Dl~G~G~S~~~~~~~~~~~~~~~~~   82 (276)
T TIGR02240        52 LEVIAFDVPGVGGSSTPRHPYRFPGLAKLAA   82 (276)
T ss_pred             ceEEEECCCCCCCCCCCCCcCcHHHHHHHHH
Confidence            567788999999774322  23444444443


Done!