BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy10415
         (130 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4GZY|D Chain D, Crystal Structures Of Bacterial Rna Polymerase Paused
           Elongation Complexes
 pdb|4GZZ|D Chain D, Crystal Structures Of Bacterial Rna Polymerase Paused
           Elongation Complexes
          Length = 1534

 Score = 29.3 bits (64), Expect = 0.61,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query: 3   ILTNPDVQLKTPVGDLFNNDYWGTPITSPNSHGSYRPLTVLT 44
           I+ N    L+  V  L +N   G P+T+P   GS RPL  LT
Sbjct: 566 IIRNEKRMLQEAVDALLDNGRRGAPVTNP---GSDRPLRSLT 604


>pdb|1IW7|D Chain D, Crystal Structure Of The Rna Polymerase Holoenzyme From
           Thermus Thermophilus At 2.6a Resolution
 pdb|1IW7|N Chain N, Crystal Structure Of The Rna Polymerase Holoenzyme From
           Thermus Thermophilus At 2.6a Resolution
 pdb|1SMY|D Chain D, Structural Basis For Transcription Regulation By Alarmone
           Ppgpp
 pdb|1SMY|N Chain N, Structural Basis For Transcription Regulation By Alarmone
           Ppgpp
 pdb|1ZYR|D Chain D, Structure Of Thermus Thermophilus Rna Polymerase
           Holoenzyme In Complex With The Antibiotic Streptolydigin
 pdb|1ZYR|N Chain N, Structure Of Thermus Thermophilus Rna Polymerase
           Holoenzyme In Complex With The Antibiotic Streptolydigin
 pdb|2A68|D Chain D, Crystal Structure Of The T. Thermophilus Rna Polymerase
           Holoenzyme In Complex With Antibiotic Rifabutin
 pdb|2A68|N Chain N, Crystal Structure Of The T. Thermophilus Rna Polymerase
           Holoenzyme In Complex With Antibiotic Rifabutin
 pdb|2A69|D Chain D, Crystal Structure Of The T. Thermophilus Rna Polymerase
           Holoenzyme In Complex With Antibiotic Rifapentin
 pdb|2A69|N Chain N, Crystal Structure Of The T. Thermophilus Rna Polymerase
           Holoenzyme In Complex With Antibiotic Rifapentin
 pdb|2A6E|D Chain D, Crystal Structure Of The T. Thermophilus Rna Polymerase
           Holoenzyme
 pdb|2A6E|N Chain N, Crystal Structure Of The T. Thermophilus Rna Polymerase
           Holoenzyme
 pdb|2A6H|D Chain D, Crystal Structure Of The T. Thermophilus Rna Polymerase
           Holoenzyme In Complex With Antibiotic Sterptolydigin
 pdb|2A6H|N Chain N, Crystal Structure Of The T. Thermophilus Rna Polymerase
           Holoenzyme In Complex With Antibiotic Sterptolydigin
 pdb|2CW0|D Chain D, Crystal Structure Of Thermus Thermophilus Rna Polymerase
           Holoenzyme At 3.3 Angstroms Resolution
 pdb|2CW0|N Chain N, Crystal Structure Of Thermus Thermophilus Rna Polymerase
           Holoenzyme At 3.3 Angstroms Resolution
 pdb|2BE5|D Chain D, Crystal Structure Of The T. Thermophilus Rna Polymerase
           Holoenzyme In Complex With Inhibitor Tagetitoxin
 pdb|2BE5|N Chain N, Crystal Structure Of The T. Thermophilus Rna Polymerase
           Holoenzyme In Complex With Inhibitor Tagetitoxin
 pdb|2O5I|D Chain D, Crystal Structure Of The T. Thermophilus Rna Polymerase
           Elongation Complex
 pdb|2O5I|N Chain N, Crystal Structure Of The T. Thermophilus Rna Polymerase
           Elongation Complex
 pdb|2O5J|D Chain D, Crystal Structure Of The T. Thermophilus Rnap Polymerase
           Elongation Complex With The Ntp Substrate Analog
 pdb|2O5J|N Chain N, Crystal Structure Of The T. Thermophilus Rnap Polymerase
           Elongation Complex With The Ntp Substrate Analog
 pdb|2PPB|D Chain D, Crystal Structure Of The T. Thermophilus Rnap Polymerase
           Elongation Complex With The Ntp Substrate Analog And
           Antibiotic Streptolydigin
 pdb|2PPB|N Chain N, Crystal Structure Of The T. Thermophilus Rnap Polymerase
           Elongation Complex With The Ntp Substrate Analog And
           Antibiotic Streptolydigin
 pdb|3DXJ|D Chain D, Crystal Structure Of Thermus Thermophilus Rna Polymerase
           Holoenzyme In Complex With The Antibiotic Myxopyronin
 pdb|3DXJ|N Chain N, Crystal Structure Of Thermus Thermophilus Rna Polymerase
           Holoenzyme In Complex With The Antibiotic Myxopyronin
 pdb|3EQL|D Chain D, Crystal Structure Of The T. Thermophilus Rna Polymerase
           Holoenzyme In Complex With Antibiotic Myxopyronin
 pdb|3EQL|N Chain N, Crystal Structure Of The T. Thermophilus Rna Polymerase
           Holoenzyme In Complex With Antibiotic Myxopyronin
 pdb|3AOH|D Chain D, Rna Polymerase-Gfh1 Complex (Crystal Type 1)
 pdb|3AOH|I Chain I, Rna Polymerase-Gfh1 Complex (Crystal Type 1)
 pdb|3AOH|N Chain N, Rna Polymerase-Gfh1 Complex (Crystal Type 1)
 pdb|3AOI|D Chain D, Rna Polymerase-Gfh1 Complex (Crystal Type 2)
 pdb|3AOI|I Chain I, Rna Polymerase-Gfh1 Complex (Crystal Type 2)
 pdb|3AOI|N Chain N, Rna Polymerase-Gfh1 Complex (Crystal Type 2)
 pdb|4G7H|D Chain D, Crystal Structure Of Thermus Thermophilus Transcription
           Initiation Complex
 pdb|4G7H|N Chain N, Crystal Structure Of Thermus Thermophilus Transcription
           Initiation Complex
 pdb|4G7O|D Chain D, Crystal Structure Of Thermus Thermophilus Transcription
           Initiation Complex Containing 2 Nt Of Rna
 pdb|4G7O|N Chain N, Crystal Structure Of Thermus Thermophilus Transcription
           Initiation Complex Containing 2 Nt Of Rna
 pdb|4G7Z|D Chain D, Crystal Structure Of Thermus Thermophilus Transcription
           Initiation Complex Containing 5-Bru At Template-Strand
           Position +1
 pdb|4G7Z|N Chain N, Crystal Structure Of Thermus Thermophilus Transcription
           Initiation Complex Containing 5-Bru At Template-Strand
           Position +1
          Length = 1524

 Score = 29.3 bits (64), Expect = 0.61,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query: 3   ILTNPDVQLKTPVGDLFNNDYWGTPITSPNSHGSYRPLTVLT 44
           I+ N    L+  V  L +N   G P+T+P   GS RPL  LT
Sbjct: 566 IIRNEKRMLQEAVDALLDNGRRGAPVTNP---GSDRPLRSLT 604


>pdb|1L9U|D Chain D, Thermus Aquaticus Rna Polymerase Holoenzyme At 4 A
           Resolution
 pdb|1L9U|M Chain M, Thermus Aquaticus Rna Polymerase Holoenzyme At 4 A
           Resolution
 pdb|1L9Z|D Chain D, Thermus Aquaticus Rna Polymerase HoloenzymeFORK-Junction
           Promoter Dna Complex At 6.5 A Resolution
 pdb|1YNJ|D Chain D, Taq Rna Polymerase-Sorangicin Complex
 pdb|1YNJ|J Chain J, Taq Rna Polymerase-Sorangicin Complex
 pdb|1YNN|D Chain D, Taq Rna Polymerase-rifampicin Complex
 pdb|1YNN|J Chain J, Taq Rna Polymerase-rifampicin Complex
          Length = 1524

 Score = 28.9 bits (63), Expect = 0.86,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 3   ILTNPDVQLKTPVGDLFNNDYWGTPITSPNSHGSYRPLTVLT 44
           I+ N    L+  V  + +N   G+P+T+P   GS RPL  LT
Sbjct: 566 IIRNEKRMLQEAVDAVIDNGRRGSPVTNP---GSERPLRSLT 604


>pdb|1I6V|D Chain D, Thermus Aquaticus Core Rna Polymerase-Rifampicin Complex
          Length = 1264

 Score = 28.9 bits (63), Expect = 0.86,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 3   ILTNPDVQLKTPVGDLFNNDYWGTPITSPNSHGSYRPLTVLT 44
           I+ N    L+  V  + +N   G+P+T+P   GS RPL  LT
Sbjct: 306 IIRNEKRMLQEAVDAVIDNGRRGSPVTNP---GSERPLRSLT 344


>pdb|1HQM|D Chain D, Crystal Structure Of Thermus Aquaticus Core Rna
           Polymerase- Includes Complete Structure With Side-Chains
           (Except For Disordered Regions)-Further Refined From
           Original Deposition-Contains Additional Sequence
           Information
          Length = 1265

 Score = 28.9 bits (63), Expect = 0.86,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 3   ILTNPDVQLKTPVGDLFNNDYWGTPITSPNSHGSYRPLTVLT 44
           I+ N    L+  V  + +N   G+P+T+P   GS RPL  LT
Sbjct: 306 IIRNEKRMLQEAVDAVIDNGRRGSPVTNP---GSERPLRSLT 344


>pdb|2GHO|D Chain D, Recombinant Thermus Aquaticus Rna Polymerase For
           Structural Studies
          Length = 1233

 Score = 28.9 bits (63), Expect = 0.86,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 3   ILTNPDVQLKTPVGDLFNNDYWGTPITSPNSHGSYRPLTVLT 44
           I+ N    L+  V  + +N   G+P+T+P   GS RPL  LT
Sbjct: 275 IIRNEKRMLQEAVDAVIDNGRRGSPVTNP---GSERPLRSLT 313


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.141    0.442 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,870,646
Number of Sequences: 62578
Number of extensions: 139186
Number of successful extensions: 396
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 390
Number of HSP's gapped (non-prelim): 6
length of query: 130
length of database: 14,973,337
effective HSP length: 88
effective length of query: 42
effective length of database: 9,466,473
effective search space: 397591866
effective search space used: 397591866
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)