Diaphorina citri psyllid: psy10415

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
RAILTNPDVQLKTPVGDLFNNDYWGTPITSPNSHGSYRPLTVLTFRLNYLACGLKPRSFHLINNLLHSAITYLVYILSSYVLPNRRARLFASLIFAVHPIHTEAVSDYHKTYLIQGERCTLEDLYVCLFV
cccccccccccccccHHHHccccccccccccccccccccHHEEHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHccccccHHHHHHHHHHHHHHHHHHHc
RAILTNPDVQLKTPVGDLFNNDYWGTPITSPNSHGSYRPLTVLTFRLNYLACGLKPRSFHLINNLLHSAITYLVYILSSYVLPNRRARLFASLIFAVHPIHTEAVSDYHKTYLIQGERCTLEDLYVCLFV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RAILTNPDVQLKTPVGDLFNNDYWGTPITSPNSHGSYRPLTVLTFRLNYLACGLKPRSFHLINNLLHSAITYLVYILSSYVLPNRRARLFASLIFAVHPIHTEAVSDYHKTYLIQGERCTLEDLYVCLFV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transmembrane and TPR repeat-containing protein 3 confidentQ6ZXV5
Transmembrane and TPR repeat-containing protein CG31690 confidentQ9VQE9
Transmembrane and TPR repeat-containing protein 3 confidentQ8BRH0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030324 [BP]lung developmentprobableGO:0060541, GO:0032502, GO:0030323, GO:0044707, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0035295, GO:0007275, GO:0044699
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted