Query         psy10433
Match_columns 152
No_of_seqs    92 out of 94
Neff          4.4 
Searched_HMMs 46136
Date          Fri Aug 16 17:48:00 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10433.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10433hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF15430 SVWC:  Single domain v  99.6 2.4E-15 5.1E-20  100.1   6.5   65   45-118     1-65  (65)
  2 smart00214 VWC von Willebrand   82.3     2.2 4.7E-05   27.9   3.5   26   45-73      1-26  (59)
  3 PF08194 DIM:  DIM protein;  In  76.8     3.7 8.1E-05   25.7   3.0   19    1-19      1-19  (36)
  4 PF13956 Ibs_toxin:  Toxin Ibs,  75.0     1.3 2.8E-05   24.1   0.5   17    1-17      2-18  (19)
  5 PF03032 Brevenin:  Brevenin/es  67.5     3.2   7E-05   27.1   1.2   18    3-20      8-25  (46)
  6 PF00093 VWC:  von Willebrand f  66.9       6 0.00013   25.7   2.5   38   45-89      1-38  (57)
  7 cd00061 FN1 Fibronectin type 1  62.7     7.3 0.00016   24.8   2.2   29   43-71      1-29  (43)
  8 PF00039 fn1:  Fibronectin type  47.5      16 0.00035   22.7   1.9   27   45-71      1-27  (39)
  9 PF15240 Pro-rich:  Proline-ric  44.1      15 0.00033   30.2   1.8   19    1-19      1-19  (179)
 10 PF12115 Salp15:  Salivary prot  42.9      14 0.00031   27.6   1.3    9   38-46     36-44  (118)
 11 PRK10523 lipoprotein involved   41.4      49  0.0011   28.2   4.5   30   26-62     42-71  (234)
 12 smart00215 VWC_out von Willebr  41.2      32 0.00069   23.7   2.8   24   45-72      1-24  (67)
 13 PF07771 TSGP1:  Tick salivary   40.1      13 0.00029   28.5   0.8   19    1-19      1-19  (120)
 14 PF00879 Defensin_propep:  Defe  34.8      48   0.001   22.2   2.7   20    1-20      1-20  (52)
 15 COG3771 Predicted membrane pro  32.6      49  0.0011   24.8   2.7   19    1-19      1-19  (97)
 16 PF11714 Inhibitor_I53:  Thromb  32.3      46   0.001   23.9   2.5   19    1-19      1-20  (78)
 17 PF07172 GRP:  Glycine rich pro  32.1      38 0.00083   24.8   2.1   14    6-19     11-24  (95)
 18 PRK09783 copper/silver efflux   31.7      58  0.0013   28.9   3.6   24   26-49     42-65  (409)
 19 smart00058 FN1 Fibronectin typ  31.3      44 0.00096   21.5   2.1   21   45-65      1-21  (45)
 20 PF10855 DUF2648:  Protein of u  31.2      21 0.00045   22.0   0.5   19    1-19      1-19  (33)
 21 PF12071 DUF3551:  Protein of u  30.7      93   0.002   22.3   3.9   12   38-49     38-49  (82)
 22 PF10731 Anophelin:  Thrombin i  30.0      62  0.0013   22.6   2.7   18    2-19      4-22  (65)
 23 COG3915 Uncharacterized protei  29.0      37  0.0008   27.4   1.7   20    1-20      4-24  (155)
 24 TIGR02052 MerP mercuric transp  28.2      45 0.00098   21.2   1.8   19    1-19      1-20  (92)
 25 PF03866 HAP:  Hydrophobic abun  27.8      45 0.00097   26.9   2.0   20    1-20      2-22  (164)
 26 PF15284 PAGK:  Phage-encoded v  26.4      77  0.0017   22.0   2.7   23    4-26      9-31  (61)
 27 PF12454 Ecm33:  GPI-anchored c  26.3      53  0.0012   20.9   1.7   18    1-18      4-21  (40)
 28 PF12714 TILa:  TILa domain      26.2 1.3E+02  0.0029   19.6   3.8   46   45-100     2-49  (56)
 29 PF09403 FadA:  Adhesion protei  25.3      24 0.00051   27.4   0.0   19    1-19      1-21  (126)
 30 PRK09934 fimbrial-like adhesin  24.3 1.1E+02  0.0023   23.9   3.5   78    1-89      1-82  (171)
 31 PRK00888 ftsB cell division pr  24.2      68  0.0015   23.7   2.3   15    1-15      1-15  (105)
 32 smart00817 Amelin Ameloblastin  21.5      83  0.0018   28.9   2.7   32    1-48      1-33  (411)
 33 PRK11505 hypothetical protein;  21.3      84  0.0018   24.0   2.3   17    1-17      1-17  (106)
 34 COG2143 Thioredoxin-related pr  21.3      77  0.0017   26.2   2.2   19    1-19      2-20  (182)
 35 PF12276 DUF3617:  Protein of u  21.2      86  0.0019   23.7   2.4    7   94-100    90-96  (162)
 36 PF05436 MF_alpha_N:  Mating fa  20.5 1.1E+02  0.0023   22.6   2.6   15    1-15      1-15  (86)
 37 PF04467 DUF483:  Protein of un  20.0      28  0.0006   27.4  -0.6   12  104-115    42-53  (128)

No 1  
>PF15430 SVWC:  Single domain von Willebrand factor type C
Probab=99.60  E-value=2.4e-15  Score=100.06  Aligned_cols=65  Identities=34%  Similarity=0.818  Sum_probs=57.6

Q ss_pred             eeecCCCeeecCCceeccCCCccceeeccCccCccceeEecccCCCCCCCCCCeeeccCCCCCCCCCCCCcccc
Q psy10433         45 CFASTKCTTVEVGQAWELAPFCGRSTCVKAEEDNRLLELVEDCGPLPKANPKCKLSEKTNKTAPFPDCCPTFEC  118 (152)
Q Consensus        45 Cy~~~~~~~l~~Ges~~~~p~C~r~tC~~~~~~~~~~l~I~~CG~~~l~~p~Ckl~e~~D~t~pYP~CCPk~~C  118 (152)
                      |+|.+  .+|+.|++|.+..+|++|+|.    .++..++|++|+.... .++|++..  |.+++||+|||+++|
T Consensus         1 C~y~~--~~~~~g~~~~~~~pC~~~~C~----~~~~~v~v~~C~~~~~-~~~C~~~~--~~~~~yP~CCp~~~C   65 (65)
T PF15430_consen    1 CYYNG--RTIPSGESYNPEEPCERWTCD----ASDGYVTVEGCPPPAP-PPGCELVP--DPTGPYPDCCPKYVC   65 (65)
T ss_pred             CEECC--EEcCCCcEecCCCCCceEEEE----CCCCEEEEEeCCCCCC-CCCCEEcc--CCCCCCCCCCCCccC
Confidence            78887  899999999999999999995    2344679999999884 69999996  999999999999987


No 2  
>smart00214 VWC von Willebrand factor (vWF) type C domain.
Probab=82.28  E-value=2.2  Score=27.93  Aligned_cols=26  Identities=23%  Similarity=0.634  Sum_probs=20.7

Q ss_pred             eeecCCCeeecCCceeccCCCccceeecc
Q psy10433         45 CFASTKCTTVEVGQAWELAPFCGRSTCVK   73 (152)
Q Consensus        45 Cy~~~~~~~l~~Ges~~~~p~C~r~tC~~   73 (152)
                      |++.+  .++..|++|.. +.|..=+|..
T Consensus         1 C~~~g--~~y~~G~~W~~-~~C~~C~C~~   26 (59)
T smart00214        1 CVHNG--EVYNDGETWKP-DPCQICTCLD   26 (59)
T ss_pred             CccCC--EEeCCCCEECC-CCCeECCcCC
Confidence            66766  89999999986 5699888844


No 3  
>PF08194 DIM:  DIM protein;  InterPro: IPR013172 Drosophila immune-induced molecules (DIMs) are short proteins induced during the immune response of Drosophila []. This entry includes DIMs 1 to 4 and DIM23.
Probab=76.83  E-value=3.7  Score=25.68  Aligned_cols=19  Identities=42%  Similarity=0.562  Sum_probs=11.0

Q ss_pred             ChhHHHHHHHHHHHHHhhh
Q psy10433          1 MKVIAFAFAFVLAVNAAEK   19 (152)
Q Consensus         1 m~~~~~~l~~~~~~~aa~~   19 (152)
                      ||+|.++++++.++++++.
T Consensus         1 Mk~l~~a~~l~lLal~~a~   19 (36)
T PF08194_consen    1 MKCLSLAFALLLLALAAAV   19 (36)
T ss_pred             CceeHHHHHHHHHHHHhcc
Confidence            8988654444444455544


No 4  
>PF13956 Ibs_toxin:  Toxin Ibs, type I toxin-antitoxin system
Probab=75.00  E-value=1.3  Score=24.13  Aligned_cols=17  Identities=24%  Similarity=0.339  Sum_probs=9.6

Q ss_pred             ChhHHHHHHHHHHHHHh
Q psy10433          1 MKVIAFAFAFVLAVNAA   17 (152)
Q Consensus         1 m~~~~~~l~~~~~~~aa   17 (152)
                      ||++++++.++.+||+|
T Consensus         2 Mk~vIIlvvLLliSf~a   18 (19)
T PF13956_consen    2 MKLVIILVVLLLISFPA   18 (19)
T ss_pred             ceehHHHHHHHhccccC
Confidence            78776444444456644


No 5  
>PF03032 Brevenin:  Brevenin/esculentin/gaegurin/rugosin family;  InterPro: IPR004275 In addition to the highly specific cell-mediated immune system, vertebrates possess an efficient host-defence mechanism against invading microorganisms which involves the synthesis of highly potent antimicrobial peptides with a large spectrum of activity. This entry represents a number of these defence peptides secreted from the skin of amphibians, including the opiate-like dermorphins and deltorphins, and the antimicrobial dermoseptins and temporins.; GO: 0006952 defense response, 0042742 defense response to bacterium, 0005576 extracellular region
Probab=67.51  E-value=3.2  Score=27.06  Aligned_cols=18  Identities=11%  Similarity=0.183  Sum_probs=13.9

Q ss_pred             hHHHHHHHHHHHHHhhhh
Q psy10433          3 VIAFAFAFVLAVNAAEKN   20 (152)
Q Consensus         3 ~~~~~l~~~~~~~aa~~~   20 (152)
                      +|+|||.+|++|+..+..
T Consensus         8 lLlfflG~ISlSlCeeEr   25 (46)
T PF03032_consen    8 LLLFFLGTISLSLCEEER   25 (46)
T ss_pred             HHHHHHHHcccchHHHhc
Confidence            445888899999987664


No 6  
>PF00093 VWC:  von Willebrand factor type C domain;  InterPro: IPR001007 The vWF domain is found in various plasma proteins: complement factors B, C2, CR3 and CR4; the integrins (I-domains); collagen types VI, VII, XII and XIV; and other extracellular proteins [, , ]. Although the majority of VWA-containing proteins are extracellular, the most ancient ones present in all eukaryotes are all intracellular proteins involved in functions such as transcription, DNA repair, ribosomal and membrane transport and the proteasome. A common feature appears to be involvement in multiprotein complexes. Proteins that incorporate vWF domains participate in numerous biological events (e.g. cell adhesion, migration, homing, pattern formation, and signal transduction), involving interaction with a large array of ligands []. A number of human diseases arise from mutations in VWA domains. Secondary structure prediction from 75 aligned vWF sequences has revealed a largely alternating sequence of alpha-helices and beta-strands []. The domain is named after the von Willebrand factor (VWF) type C repeat which is found in multidomain protein/multifunctional proteins involved in maintaining homeostasis [, ]. For the von Willebrand factor the duplicated VWFC domain is thought to participate in oligomerization, but not in the initial dimerization step []. The presence of this region in a number of other complex-forming proteins points to the possible involvment of the VWFC domain in complex formation.; GO: 0005515 protein binding; PDB: 1U5M_A.
Probab=66.94  E-value=6  Score=25.69  Aligned_cols=38  Identities=24%  Similarity=0.582  Sum_probs=19.8

Q ss_pred             eeecCCCeeecCCceeccCCCccceeeccCccCccceeEecccCC
Q psy10433         45 CFASTKCTTVEVGQAWELAPFCGRSTCVKAEEDNRLLELVEDCGP   89 (152)
Q Consensus        45 Cy~~~~~~~l~~Ges~~~~p~C~r~tC~~~~~~~~~~l~I~~CG~   89 (152)
                      |.+.+  .++..|++|.+.+ |..=+|..    +...=....|++
T Consensus         1 C~~~g--~~y~~g~~w~~~~-C~~C~C~~----G~v~C~~~~Cp~   38 (57)
T PF00093_consen    1 CSFNG--RVYQNGESWHPDP-CTTCTCQD----GEVQCSRIQCPP   38 (57)
T ss_dssp             EESSS---EE-SS-EE-S-S-SEEEEEET----TEEEEEE---S-
T ss_pred             CeeCC--EEeCCCCEECCCC-CcEeEecC----CEEEEcCCCCcC
Confidence            66777  8999999998765 99888843    222334455665


No 7  
>cd00061 FN1 Fibronectin type 1 domain, approximately 40 residue long with two conserved disulfide bridges. FN1 is one of three types of internal repeats which combine to form larger domains within fibronectin. Fibronectin, a plasma protein that binds cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin, usually exists as a dimer in plasma and as an insoluble multimer in extracellular matrices.  Dimers of nearly identical subunits are linked by a disulfide bond close to their C-terminus. FN1 domains also found in coagulation factor XII, HGF activator, and tissue-type plasminogen activator. In tissue plasminogen activator, FN1 domains may form functional fibrin-binding units with EGF-like domains C-terminal to FN1.
Probab=62.69  E-value=7.3  Score=24.79  Aligned_cols=29  Identities=24%  Similarity=0.464  Sum_probs=21.6

Q ss_pred             CCeeecCCCeeecCCceeccCCCccceee
Q psy10433         43 GMCFASTKCTTVEVGQAWELAPFCGRSTC   71 (152)
Q Consensus        43 GkCy~~~~~~~l~~Ges~~~~p~C~r~tC   71 (152)
                      .+||+..+...+..|++|.+...=..+.|
T Consensus         1 ~~C~d~~t~~~Y~ige~W~r~~~~~~~~C   29 (43)
T cd00061           1 EKCFDPQTGVFYRVGETWERPSEGHVLQC   29 (43)
T ss_pred             CcCCcCCcccEEeCCCEEEeecCCeEEEE
Confidence            37999988899999999976554233333


No 8  
>PF00039 fn1:  Fibronectin type I domain;  InterPro: IPR000083 Fibronectin type I repeats are one of the three repeats found in the fibronectin protein. Fibronectin is a plasma protein that binds cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Type I domain (FN1) is approximately 40 residues in length. Four conserved cysteines are involved in disulphide bonds. The 3D structure of the FN1 domain has been determined [, , ]. It consists of two antiparallel beta-sheets, first a double-stranded one, that is linked by a disulphide bond to a triple-stranded beta-sheet. The second conserved disulphide bridge links the C-terminal adjacent strands of the domain.  In human tissue plasminogen activator chain A the FN1 domain together with the following epidermal growth factor (EGF)-like domain are involved in fibrin-binding []. It has been suggested that these two modules form a single structural and functional unit []. The two domains keep their specific tertiary structure, but interact intimately to bury a hydrophobic core; the inter-module linker makes up the third strand of the EGF-module's major beta-sheet.; GO: 0005576 extracellular region; PDB: 2RKY_A 1FBR_A 2RL0_D 3M7P_A 3MQL_A 3ZRZ_A 2RKZ_F 2CKU_A 2CG6_A 3CAL_C ....
Probab=47.53  E-value=16  Score=22.70  Aligned_cols=27  Identities=26%  Similarity=0.527  Sum_probs=19.9

Q ss_pred             eeecCCCeeecCCceeccCCCccceee
Q psy10433         45 CFASTKCTTVEVGQAWELAPFCGRSTC   71 (152)
Q Consensus        45 Cy~~~~~~~l~~Ges~~~~p~C~r~tC   71 (152)
                      |++..+..+...|++|.+...=.++.|
T Consensus         1 C~d~~t~~~Y~vge~W~R~~~g~~~~C   27 (39)
T PF00039_consen    1 CFDPDTGQFYQVGETWERPYQGHMMQC   27 (39)
T ss_dssp             EEETTTTEEEETTEEEEEEETSSEEEE
T ss_pred             CCcCCCccEEeCCCEEEeecCCeEEEe
Confidence            788676799999999976655344444


No 9  
>PF15240 Pro-rich:  Proline-rich
Probab=44.12  E-value=15  Score=30.18  Aligned_cols=19  Identities=16%  Similarity=0.270  Sum_probs=8.6

Q ss_pred             ChhHHHHHHHHHHHHHhhh
Q psy10433          1 MKVIAFAFAFVLAVNAAEK   19 (152)
Q Consensus         1 m~~~~~~l~~~~~~~aa~~   19 (152)
                      |-+|+|.+++++||.|+..
T Consensus         1 MLlVLLSvALLALSSAQ~~   19 (179)
T PF15240_consen    1 MLLVLLSVALLALSSAQST   19 (179)
T ss_pred             ChhHHHHHHHHHhhhcccc
Confidence            4444444444444444443


No 10 
>PF12115 Salp15:  Salivary protein of 15kDa inhibits CD4+ T cell activation;  InterPro: IPR021971  This is a family of 15kDa salivary proteins from Acari Arachnids that is induced on feeding and assists the parasite to remain attached to its arthropod host. By repressing calcium fluxes triggered by TCR engagement, Salp15 inhibits CD4+ T cell activation. Salp15 shows weak similarity to Inhibin A, a member of the TGF-beta superfamily that inhibits the production of cytokines and the proliferation of T cells. 
Probab=42.87  E-value=14  Score=27.64  Aligned_cols=9  Identities=22%  Similarity=0.504  Sum_probs=5.9

Q ss_pred             CCCCCCCee
Q psy10433         38 LRDFPGMCF   46 (152)
Q Consensus        38 h~d~PGkCy   46 (152)
                      .|+|.+.|-
T Consensus        36 ~p~~i~~~~   44 (118)
T PF12115_consen   36 FPSLIGNCK   44 (118)
T ss_pred             CcccCccch
Confidence            347777776


No 11 
>PRK10523 lipoprotein involved with copper homeostasis and adhesion; Provisional
Probab=41.39  E-value=49  Score=28.15  Aligned_cols=30  Identities=23%  Similarity=0.556  Sum_probs=22.5

Q ss_pred             CcceeeeccCCCCCCCCCCeeecCCCeeecCCceecc
Q psy10433         26 PKTYRRLIPADVLRDFPGMCFASTKCTTVEVGQAWEL   62 (152)
Q Consensus        26 ~~~y~~iipad~h~d~PGkCy~~~~~~~l~~Ges~~~   62 (152)
                      ...|++++|.+   |-+|   ++. -++|....+|.+
T Consensus        42 ~gtY~G~LPCA---DC~G---I~t-tLtL~~DgTY~L   71 (234)
T PRK10523         42 QQSWRGVLPCA---DCEG---IET-SLFLEKDGTWVM   71 (234)
T ss_pred             ccEEeEEEECC---CCCC---ceE-EEEEcCCCCEEE
Confidence            67999999988   7777   444 278887777653


No 12 
>smart00215 VWC_out von Willebrand factor (vWF) type C domain.
Probab=41.24  E-value=32  Score=23.75  Aligned_cols=24  Identities=29%  Similarity=0.868  Sum_probs=19.0

Q ss_pred             eeecCCCeeecCCceeccCCCccceeec
Q psy10433         45 CFASTKCTTVEVGQAWELAPFCGRSTCV   72 (152)
Q Consensus        45 Cy~~~~~~~l~~Ges~~~~p~C~r~tC~   72 (152)
                      |++.+  +++.+|++|.  ..|.+=||.
T Consensus         1 C~~~G--~~y~~g~~w~--d~Cn~CtC~   24 (67)
T smart00215        1 CYNNG--SYYPPGAKWD--DDCNRCTCL   24 (67)
T ss_pred             CeECC--EEcCCCCccc--cCCCCCEec
Confidence            56676  8999999995  568887783


No 13 
>PF07771 TSGP1:  Tick salivary peptide group 1;  InterPro: IPR011694 This entry contains a group of peptides derived from a salivary gland cDNA library of the tick Ixodes scapularis (Black-legged tick) []. Also present are peptides from a related tick species, Ixodes ricinus (Sheep tick). They are characterised by a putative signal peptide, indicative of secretion, and conserved cysteine residues.
Probab=40.10  E-value=13  Score=28.49  Aligned_cols=19  Identities=11%  Similarity=0.079  Sum_probs=13.7

Q ss_pred             ChhHHHHHHHHHHHHHhhh
Q psy10433          1 MKVIAFAFAFVLAVNAAEK   19 (152)
Q Consensus         1 m~~~~~~l~~~~~~~aa~~   19 (152)
                      |++..++|.+|+|||....
T Consensus         1 m~~~~~~~vlv~la~~~~~   19 (120)
T PF07771_consen    1 MGLTVVTLVLVSLAFFGSA   19 (120)
T ss_pred             CcceeehhhHHhHHhhhhh
Confidence            7877777777888776544


No 14 
>PF00879 Defensin_propep:  Defensin propeptide The pattern for this Prosite entry doesn't match the propeptide.;  InterPro: IPR002366 Defensins are 2-6 kDa, cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses [], containing three pairs of intramolecular disulphide bonds []. On the basis of their size and pattern of disulphide bonding, mammalian defensins are classified into alpha, beta and theta categories. Alpha-defensins, which have been identified in humans, monkeys and several rodent species, are particularly abundant in neutrophils, certain macrophage populations and Paneth cells of the small intestine. Every mammalian species explored thus far has beta-defensins. In cows, as many as 13 beta-defensins exist in neutrophils. However, in other species, beta-defensins are more often produced by epithelial cells lining various organs (e.g. the epidermis, bronchial tree and genitourinary tract). Theta-defensins are cyclic and have so far only been identified in primate phagocytes.   Defensins are produced constitutively and/or in response to microbial products or proinflammatory cytokines. Some defensins are also called corticostatins (CS) because they inhibit corticotropin-stimulated corticosteroid production. The mechanism(s) by which microorganisms are killed and/or inactivated by defensins is not understood completely. However, it is generally believed that killing is a consequence of disruption of the microbial membrane. The polar topology of defensins, with spatially separated charged and hydrophobic regions, allows them to insert themselves into the phospholipid membranes so that their hydrophobic regions are buried within the lipid membrane interior and their charged (mostly cationic) regions interact with anionic phospholipid head groups and water. Subsequently, some defensins can aggregate to form `channel-like' pores; others might bind to and cover the microbial membrane in a `carpet-like' manner. The net outcome is the disruption of membrane integrity and function, which ultimately leads to the lysis of microorganisms. Some defensins are synthesized as propeptides which may be relevant to this process - in neutrophils only the mature peptides have been identified but in Paneth cells, the propeptide is stored in vesicles [] and appears to be cleaved by trypsin on activation.  ; GO: 0006952 defense response
Probab=34.76  E-value=48  Score=22.23  Aligned_cols=20  Identities=25%  Similarity=0.355  Sum_probs=15.8

Q ss_pred             ChhHHHHHHHHHHHHHhhhh
Q psy10433          1 MKVIAFAFAFVLAVNAAEKN   20 (152)
Q Consensus         1 m~~~~~~l~~~~~~~aa~~~   20 (152)
                      ||.|+++.+++.+++-|..+
T Consensus         1 MRTL~LLaAlLLlAlqaQAe   20 (52)
T PF00879_consen    1 MRTLALLAALLLLALQAQAE   20 (52)
T ss_pred             CcHHHHHHHHHHHHHHHhcc
Confidence            89888887888888877763


No 15 
>COG3771 Predicted membrane protein [Function unknown]
Probab=32.56  E-value=49  Score=24.76  Aligned_cols=19  Identities=21%  Similarity=0.065  Sum_probs=12.3

Q ss_pred             ChhHHHHHHHHHHHHHhhh
Q psy10433          1 MKVIAFAFAFVLAVNAAEK   19 (152)
Q Consensus         1 m~~~~~~l~~~~~~~aa~~   19 (152)
                      ||+|+.+++|.++..-|..
T Consensus         1 mKyil~~vlvlaifliavt   19 (97)
T COG3771           1 MKYILIFVLVLAIFLIAVT   19 (97)
T ss_pred             ChhHHHHHHHHHHHHHHhh
Confidence            8988766666665555544


No 16 
>PF11714 Inhibitor_I53:  Thrombin inhibitor Madanin  ;  InterPro: IPR021716  Members of this family are the peptidase inhibitor madanin proteins. These proteins were isolated from tick saliva []. 
Probab=32.33  E-value=46  Score=23.94  Aligned_cols=19  Identities=21%  Similarity=0.181  Sum_probs=10.3

Q ss_pred             Ch-hHHHHHHHHHHHHHhhh
Q psy10433          1 MK-VIAFAFAFVLAVNAAEK   19 (152)
Q Consensus         1 m~-~~~~~l~~~~~~~aa~~   19 (152)
                      || |.+++|++|+.+..-++
T Consensus         1 MKhFaiLilavVaSAvVMAy   20 (78)
T PF11714_consen    1 MKHFAILILAVVASAVVMAY   20 (78)
T ss_pred             CchHHHHHHHHHHHHHHHhc
Confidence            66 55566666654444333


No 17 
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=32.14  E-value=38  Score=24.82  Aligned_cols=14  Identities=14%  Similarity=0.247  Sum_probs=5.8

Q ss_pred             HHHHHHHHHHHhhh
Q psy10433          6 FAFAFVLAVNAAEK   19 (152)
Q Consensus         6 ~~l~~~~~~~aa~~   19 (152)
                      ++|++|.+.+++++
T Consensus        11 l~LA~lLlisSeva   24 (95)
T PF07172_consen   11 LLLAALLLISSEVA   24 (95)
T ss_pred             HHHHHHHHHHhhhh
Confidence            33434444444433


No 18 
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional
Probab=31.73  E-value=58  Score=28.92  Aligned_cols=24  Identities=13%  Similarity=-0.041  Sum_probs=17.9

Q ss_pred             CcceeeeccCCCCCCCCCCeeecC
Q psy10433         26 PKTYRRLIPADVLRDFPGMCFAST   49 (152)
Q Consensus        26 ~~~y~~iipad~h~d~PGkCy~~~   49 (152)
                      +--|+.=.....++|.||||=+=+
T Consensus        42 ~~~~~~pm~p~~~~~~pg~~p~~~   65 (409)
T PRK09783         42 VLFWYDPMYPNTRFDKPGKSPFMD   65 (409)
T ss_pred             eEEEeCCCCCCcCCCCCCCCCCCC
Confidence            344665566888999999998755


No 19 
>smart00058 FN1 Fibronectin type 1 domain. One of three types of internal repeat within the plasma protein, fibronectin. Found also in coagulation factor XII, HGF activator and tissue-type plasminogen activator. In t-PA and fibronectin, this domain type  contributes to fibrin-binding.
Probab=31.32  E-value=44  Score=21.45  Aligned_cols=21  Identities=33%  Similarity=0.650  Sum_probs=17.8

Q ss_pred             eeecCCCeeecCCceeccCCC
Q psy10433         45 CFASTKCTTVEVGQAWELAPF   65 (152)
Q Consensus        45 Cy~~~~~~~l~~Ges~~~~p~   65 (152)
                      ||++.+...+..|++|.+...
T Consensus         1 C~D~~t~~~Y~ige~W~r~~~   21 (45)
T smart00058        1 CFDEDTGTTYRIGDTWERPYE   21 (45)
T ss_pred             CccCCcccEEecCCEEEeecC
Confidence            788877899999999977655


No 20 
>PF10855 DUF2648:  Protein of unknown function (DUF2648);  InterPro: IPR022561  This family of proteins with unknown function appears to be restricted to eubacteia. 
Probab=31.19  E-value=21  Score=21.99  Aligned_cols=19  Identities=26%  Similarity=0.067  Sum_probs=12.9

Q ss_pred             ChhHHHHHHHHHHHHHhhh
Q psy10433          1 MKVIAFAFAFVLAVNAAEK   19 (152)
Q Consensus         1 m~~~~~~l~~~~~~~aa~~   19 (152)
                      ||=|+++|.++++.|-+-.
T Consensus         1 MKkl~i~L~l~ga~f~~fK   19 (33)
T PF10855_consen    1 MKKLAIILILGGAAFYGFK   19 (33)
T ss_pred             CCceeehhhhhhHHHHHHH
Confidence            7766677777777776543


No 21 
>PF12071 DUF3551:  Protein of unknown function (DUF3551);  InterPro: IPR021937  This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 79 to 104 amino acids in length. This protein has a single completely conserved residue C that may be functionally important. 
Probab=30.69  E-value=93  Score=22.30  Aligned_cols=12  Identities=42%  Similarity=0.601  Sum_probs=9.0

Q ss_pred             CCCCCCCeeecC
Q psy10433         38 LRDFPGMCFAST   49 (152)
Q Consensus        38 h~d~PGkCy~~~   49 (152)
                      ..++||.|.|.+
T Consensus        38 ~~g~~g~C~y~t   49 (82)
T PF12071_consen   38 GWGYPGDCSYST   49 (82)
T ss_pred             CCCCCccCCcCC
Confidence            347888888877


No 22 
>PF10731 Anophelin:  Thrombin inhibitor from mosquito;  InterPro: IPR018932  Members of this family are all inhibitors of thrombin, the peptidase that is at the end of the blood coagulation cascade and which creates the clot by cleaving fibrinogen. The interaction between thrombin and fibrinogen involves two different areas of contact - via the thrombin active site and via a second substrate-binding site known as an exosite. The inhibitor acts by blocking the exosite, rather than by interacting with the active site. The inhibitors are from mosquitoes that feed on human blood and which, by inhibiting thrombin, prevent the blood from clotting and keep it flowing. 
Probab=29.97  E-value=62  Score=22.63  Aligned_cols=18  Identities=17%  Similarity=0.176  Sum_probs=10.0

Q ss_pred             hhHH-HHHHHHHHHHHhhh
Q psy10433          2 KVIA-FAFAFVLAVNAAEK   19 (152)
Q Consensus         2 ~~~~-~~l~~~~~~~aa~~   19 (152)
                      |+++ .+|+++.+++++.+
T Consensus         4 Kl~vialLC~aLva~vQ~A   22 (65)
T PF10731_consen    4 KLIVIALLCVALVAIVQSA   22 (65)
T ss_pred             hhhHHHHHHHHHHHHHhcC
Confidence            4444 55566666665555


No 23 
>COG3915 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=29.04  E-value=37  Score=27.37  Aligned_cols=20  Identities=20%  Similarity=0.243  Sum_probs=17.6

Q ss_pred             ChhHH-HHHHHHHHHHHhhhh
Q psy10433          1 MKVIA-FAFAFVLAVNAAEKN   20 (152)
Q Consensus         1 m~~~~-~~l~~~~~~~aa~~~   20 (152)
                      ||+++ .||++.++++|++++
T Consensus         4 ~r~ll~~fL~l~~~slaqa~~   24 (155)
T COG3915           4 MRVLLLTFLALISSSLAQAEP   24 (155)
T ss_pred             HHHHHHHHHHHHhhHHhhcCc
Confidence            67777 899999999999995


No 24 
>TIGR02052 MerP mercuric transport protein periplasmic component. This model represents the periplasmic mercury (II) binding protein of the bacterial mercury detoxification system which passes mercuric ion to the MerT transporter for subsequent reduction to Hg(0) by the mercuric reductase MerA. MerP contains a distinctive GMTCXXC motif associated with metal binding. MerP is related to a larger family of metal binding proteins (pfam00403).
Probab=28.20  E-value=45  Score=21.18  Aligned_cols=19  Identities=37%  Similarity=0.305  Sum_probs=12.6

Q ss_pred             ChhHH-HHHHHHHHHHHhhh
Q psy10433          1 MKVIA-FAFAFVLAVNAAEK   19 (152)
Q Consensus         1 m~~~~-~~l~~~~~~~aa~~   19 (152)
                      ||-|+ +++++|++++-+.+
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~   20 (92)
T TIGR02052         1 MKKLATLLALFVLTSLPAWA   20 (92)
T ss_pred             ChhHHHHHHHHHHhcchhhh
Confidence            77666 77777777665444


No 25 
>PF03866 HAP:  Hydrophobic abundant protein (HAP)        ;  InterPro: IPR005566  Expression of Hydrophobic Abundant protein is thought to be developmentally regulated and possibly involved in spherule cell wall formation []. 
Probab=27.80  E-value=45  Score=26.86  Aligned_cols=20  Identities=30%  Similarity=0.325  Sum_probs=14.4

Q ss_pred             ChhHHHHHHHHHHH-HHhhhh
Q psy10433          1 MKVIAFAFAFVLAV-NAAEKN   20 (152)
Q Consensus         1 m~~~~~~l~~~~~~-~aa~~~   20 (152)
                      |||+++.|++.+++ +|.+.+
T Consensus         2 mkyvfvalc~~avvalate~~   22 (164)
T PF03866_consen    2 MKYVFVALCLFAVVALATEVE   22 (164)
T ss_pred             chhHHHHHHHHHHHHHhhHHH
Confidence            89998888877766 554443


No 26 
>PF15284 PAGK:  Phage-encoded virulence factor
Probab=26.35  E-value=77  Score=21.98  Aligned_cols=23  Identities=30%  Similarity=0.338  Sum_probs=8.8

Q ss_pred             HHHHHHHHHHHHHhhhhhcCCCC
Q psy10433          4 IAFAFAFVLAVNAAEKNAAGDRP   26 (152)
Q Consensus         4 ~~~~l~~~~~~~aa~~~~~~~~~   26 (152)
                      |+++|.+.+..|.|..-+++..+
T Consensus         9 L~l~~~LsA~~FSasamAa~~~~   31 (61)
T PF15284_consen    9 LALVFILSAAGFSASAMAADSSP   31 (61)
T ss_pred             HHHHHHHHHhhhhHHHHHHhhCC
Confidence            33333333444443332333333


No 27 
>PF12454 Ecm33:  GPI-anchored cell wall organization protein
Probab=26.27  E-value=53  Score=20.91  Aligned_cols=18  Identities=33%  Similarity=0.111  Sum_probs=13.7

Q ss_pred             ChhHHHHHHHHHHHHHhh
Q psy10433          1 MKVIAFAFAFVLAVNAAE   18 (152)
Q Consensus         1 m~~~~~~l~~~~~~~aa~   18 (152)
                      +||++-+|++++.++||.
T Consensus         4 ~Ky~lpAlaaag~a~A~s   21 (40)
T PF12454_consen    4 SKYLLPALAAAGAAAAAS   21 (40)
T ss_pred             HHHHHHHHHHHHHHHHhc
Confidence            378876788888888773


No 28 
>PF12714 TILa:  TILa domain
Probab=26.20  E-value=1.3e+02  Score=19.56  Aligned_cols=46  Identities=22%  Similarity=0.550  Sum_probs=29.1

Q ss_pred             ee-ecCCCeeecCCceeccCCCcc-ceeeccCccCccceeEecccCCCCCCCCCCeee
Q psy10433         45 CF-ASTKCTTVEVGQAWELAPFCG-RSTCVKAEEDNRLLELVEDCGPLPKANPKCKLS  100 (152)
Q Consensus        45 Cy-~~~~~~~l~~Ges~~~~p~C~-r~tC~~~~~~~~~~l~I~~CG~~~l~~p~Ckl~  100 (152)
                      |+ +.+  .-+++|++|-..+ |. +=+|..   +..++=...+|++    ...|.+.
T Consensus         2 C~d~~G--~yy~~Ge~~~~~~-C~~~C~C~~---~g~v~C~~~~C~~----~e~C~~~   49 (56)
T PF12714_consen    2 CTDYNG--RYYPPGESWWTDD-CTQRCTCQP---NGQVQCQPSSCPP----GEVCQIQ   49 (56)
T ss_pred             CcCcCC--EEECCCCEEeCCC-CCEeEEEcC---CCeEEEeCCCCCC----CCEeEeC
Confidence            56 555  8899999997665 54 446743   3444455667774    2557665


No 29 
>PF09403 FadA:  Adhesion protein FadA;  InterPro: IPR018543  FadA (Fusobacterium adhesin A) is an adhesin which forms two alpha helices. ; PDB: 3ETZ_B 3ETY_A 2GL2_B 3ETX_C 3ETW_A.
Probab=25.30  E-value=24  Score=27.35  Aligned_cols=19  Identities=21%  Similarity=0.097  Sum_probs=0.0

Q ss_pred             Ch-hHH-HHHHHHHHHHHhhh
Q psy10433          1 MK-VIA-FAFAFVLAVNAAEK   19 (152)
Q Consensus         1 m~-~~~-~~l~~~~~~~aa~~   19 (152)
                      || +++ ++|++.++||||..
T Consensus         1 MKK~ll~~~lllss~sfaA~~   21 (126)
T PF09403_consen    1 MKKILLLGMLLLSSISFAATA   21 (126)
T ss_dssp             ---------------------
T ss_pred             ChHHHHHHHHHHHHHHHHccc
Confidence            55 333 56777788888866


No 30 
>PRK09934 fimbrial-like adhesin protein SfmF; Provisional
Probab=24.33  E-value=1.1e+02  Score=23.87  Aligned_cols=78  Identities=14%  Similarity=0.098  Sum_probs=36.3

Q ss_pred             ChhHH-HHHHHHHHHHHhhhhhcCCCCcc-eeeeccCCCCCCCCCCeeecCC--CeeecCCceeccCCCccceeeccCcc
Q psy10433          1 MKVIA-FAFAFVLAVNAAEKNAAGDRPKT-YRRLIPADVLRDFPGMCFASTK--CTTVEVGQAWELAPFCGRSTCVKAEE   76 (152)
Q Consensus         1 m~~~~-~~l~~~~~~~aa~~~~~~~~~~~-y~~iipad~h~d~PGkCy~~~~--~~~l~~Ges~~~~p~C~r~tC~~~~~   76 (152)
                      ||-++ .+++++.++..+....+.++.+. |++.+-+..       |.+...  ..+|..|+- ....+=..   .....
T Consensus         1 m~~~~~~~~~~~~~~~~~~a~~~~g~v~i~f~G~I~~~t-------C~i~~~~~~~~V~Lg~v-~~~~~~~~---g~~~~   69 (171)
T PRK09934          1 MRRVFFACFCGLLWSPLSWAADPLGEINIELHGNVVDFT-------CTVNTADSDKTVDLGTW-PTKQLLNA---GDTTQ   69 (171)
T ss_pred             ChhHHHHHHHHHhhChhhhhccCCCeEEEEEEEEEEeCc-------ceEcCCCcceEEECCcc-cHHHcccC---CCCCC
Confidence            66443 22332333333333233455554 567776664       988643  357777753 11111000   00011


Q ss_pred             CccceeEecccCC
Q psy10433         77 DNRLLELVEDCGP   89 (152)
Q Consensus        77 ~~~~~l~I~~CG~   89 (152)
                      ...|.|...+|+.
T Consensus        70 ~~~F~I~L~~C~~   82 (171)
T PRK09934         70 PVPFSLKLEGCPP   82 (171)
T ss_pred             CEeEEEEEcCCCC
Confidence            3566677777863


No 31 
>PRK00888 ftsB cell division protein FtsB; Reviewed
Probab=24.25  E-value=68  Score=23.68  Aligned_cols=15  Identities=13%  Similarity=0.264  Sum_probs=8.5

Q ss_pred             ChhHHHHHHHHHHHH
Q psy10433          1 MKVIAFAFAFVLAVN   15 (152)
Q Consensus         1 m~~~~~~l~~~~~~~   15 (152)
                      ||+|+++|+++.+.+
T Consensus         1 m~~~~~vll~ll~~l   15 (105)
T PRK00888          1 MRLLTLLLLALLVWL   15 (105)
T ss_pred             CcHHHHHHHHHHHHH
Confidence            888774444444343


No 32 
>smart00817 Amelin Ameloblastin precursor (Amelin). This family consists of several mammalian Ameloblastin precursor (Amelin) proteins. Matrix proteins of tooth enamel consist mainly of amelogenin but also of non-amelogenin proteins, which, although their volumetric percentage is low, have an important role in enamel mineralisation. One of the non-amelogenin proteins is ameloblastin, also known as amelin and sheathlin. Ameloblastin (AMBN) is one of the enamel sheath proteins which is though to have a role in determining the prismatic structure of growing enamel crystals.
Probab=21.45  E-value=83  Score=28.91  Aligned_cols=32  Identities=31%  Similarity=0.360  Sum_probs=23.3

Q ss_pred             ChhHHHHHHHHHHHHHhhhhhcCCCCcceeeeccCCC-CCCCCCCeeec
Q psy10433          1 MKVIAFAFAFVLAVNAAEKNAAGDRPKTYRRLIPADV-LRDFPGMCFAS   48 (152)
Q Consensus         1 m~~~~~~l~~~~~~~aa~~~~~~~~~~~y~~iipad~-h~d~PGkCy~~   48 (152)
                      ||.+++++++++.+||                +|.-. |+-+||.=-++
T Consensus         1 M~~~iL~~cLl~~afA----------------~Pl~Pq~pg~pG~~s~S   33 (411)
T smart00817        1 MKDLALVLCLLKTSFA----------------VPAFPQQPGTPGMASLS   33 (411)
T ss_pred             CcchhHHHHHHhhhhc----------------cccCCCCCCCCceeeee
Confidence            8888899999999994                34344 66788855444


No 33 
>PRK11505 hypothetical protein; Provisional
Probab=21.31  E-value=84  Score=24.00  Aligned_cols=17  Identities=18%  Similarity=0.075  Sum_probs=12.3

Q ss_pred             ChhHHHHHHHHHHHHHh
Q psy10433          1 MKVIAFAFAFVLAVNAA   17 (152)
Q Consensus         1 m~~~~~~l~~~~~~~aa   17 (152)
                      ||+.+++.+++|+.|+.
T Consensus         1 mk~~~l~~ll~g~~~~~   17 (106)
T PRK11505          1 MKITLLVTLLFGLVFLT   17 (106)
T ss_pred             CchHHHHHHHHHHHHhh
Confidence            78777666777777764


No 34 
>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones]
Probab=21.26  E-value=77  Score=26.22  Aligned_cols=19  Identities=21%  Similarity=0.273  Sum_probs=15.4

Q ss_pred             ChhHHHHHHHHHHHHHhhh
Q psy10433          1 MKVIAFAFAFVLAVNAAEK   19 (152)
Q Consensus         1 m~~~~~~l~~~~~~~aa~~   19 (152)
                      ||+|+++|+++++.+.|..
T Consensus         2 mRvl~i~Lliis~fl~a~~   20 (182)
T COG2143           2 MRVLLIVLLIISLFLSACK   20 (182)
T ss_pred             cchHHHHHHHHHHHHHHHh
Confidence            7888888888888887776


No 35 
>PF12276 DUF3617:  Protein of unknown function (DUF3617);  InterPro: IPR022061  This family of proteins is found in bacteria. Proteins in this family are typically between 155 and 179 amino acids in length. There is a single completely conserved residue C that may be functionally important. 
Probab=21.16  E-value=86  Score=23.66  Aligned_cols=7  Identities=29%  Similarity=0.819  Sum_probs=4.1

Q ss_pred             CCCCeee
Q psy10433         94 NPKCKLS  100 (152)
Q Consensus        94 ~p~Ckl~  100 (152)
                      ..+|+..
T Consensus        90 ~~~C~~~   96 (162)
T PF12276_consen   90 NQDCTYT   96 (162)
T ss_pred             CCCCCEe
Confidence            4666664


No 36 
>PF05436 MF_alpha_N:  Mating factor alpha precursor N-terminus;  InterPro: IPR008675 This entry contains the N-terminal regions of the Saccharomyces mating factor alpha precursor protein. All proteins in this family contain one or more copies of IPR006742 from INTERPRO further toward their C terminus.; GO: 0007618 mating, 0005576 extracellular region
Probab=20.52  E-value=1.1e+02  Score=22.55  Aligned_cols=15  Identities=33%  Similarity=0.233  Sum_probs=9.3

Q ss_pred             ChhHHHHHHHHHHHH
Q psy10433          1 MKVIAFAFAFVLAVN   15 (152)
Q Consensus         1 m~~~~~~l~~~~~~~   15 (152)
                      |||..++.+++.++.
T Consensus         1 MKf~siLsa~ala~~   15 (86)
T PF05436_consen    1 MKFSSILSAAALASS   15 (86)
T ss_pred             CchHHHHHHHHHHHH
Confidence            998875555544444


No 37 
>PF04467 DUF483:  Protein of unknown function (DUF483);  InterPro: IPR007556 This is a family of uncharacterised prokaryotic proteins.
Probab=20.01  E-value=28  Score=27.38  Aligned_cols=12  Identities=42%  Similarity=1.060  Sum_probs=10.3

Q ss_pred             CCCCCCCCCCCc
Q psy10433        104 NKTAPFPDCCPT  115 (152)
Q Consensus       104 D~t~pYP~CCPk  115 (152)
                      -...+||+||-+
T Consensus        42 GklL~YPdCCv~   53 (128)
T PF04467_consen   42 GKLLGYPDCCVK   53 (128)
T ss_pred             hccCCCcHHHHH
Confidence            467899999988


Done!