Diaphorina citri psyllid: psy10442


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430
MDKGLVVQFVISTLLRYWLCHSEFKSLLQDRVEISNPINAWKNLVEGVTLMKDQVNPYDGDIFHESPLILHMFKFIIGNDNPYVQQSIPFIFILCDLLSAILLYYMAQSYMIQMVQIEKQNKHKYAKNITRILINIEDLVNVPKYVALAYLYNPFSILNCICLTSTVFANFFLCLFFFAFVTQKPILSSIALTLTVQQNIYPITLLVPACVHFHQYKKSWRLFLAGFLLCYSGFLYFCLGLMNQDTSFLAATYGFQLTVPNLQPNIGLFWYFFTEMFEHFRVLFIVAFQINSIFLYVLPLTLRLYKEPVLVAICLTGLAAVFKSYPCVGDIALYLALMPLCKYLFPFMQQGFIVACFFIGCSMFAPTVWHLWIYTRSANANFYFGVTLAFATSQIFLLTDLLFAYLKRDYTLENGIQKTIKGKPARLVLD
ccccHHHHHHHHHHHHHHHHHHcHHHHHcccEEEcccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHEEEEECcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccc
**KGLVVQFVISTLLRYWLCHSEFKSLLQDRVEISNPINAWKNLVEGVTLMKDQVNPYDGDIFHESPLILHMFKFIIGNDNPYVQQSIPFIFILCDLLSAILLYYMAQSYMIQMVQIEKQNKHKYAKNITRILINIEDLVNVPKYVALAYLYNPFSILNCICLTSTVFANFFLCLFFFAFVTQKPILSSIALTLTVQQNIYPITLLVPACVHFHQYKKSWRLFLAGFLLCYSGFLYFCLGLMNQDTSFLAATYGFQLTVPNLQPNIGLFWYFFTEMFEHFRVLFIVAFQINSIFLYVLPLTLRLYKEPVLVAICLTGLAAVFKSYPCVGDIALYLALMPLCKYLFPFMQQGFIVACFFIGCSMFAPTVWHLWIYTRSANANFYFGVTLAFATSQIFLLTDLLFAYLKRDYTLENGIQKTI******L***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKGLVVQFVISTLLRYWLCHSEFKSLLQDRVEISNPINAWKNLVEGVTLMKDQVNPYDGDIFHESPLILHMFKFIIGNDNPYVQQSIPFIFILCDLLSAILLYYMAQSYMIQMVQIEKQNKHKYAKNITRILINIEDLVNVPKYVALAYLYNPFSILNCICLTSTVFANFFLCLFFFAFVTQKPILSSIALTLTVQQNIYPITLLVPACVHFHQYKKSWRLFLAGFLLCYSGFLYFCLGLMNQDTSFLAATYGFQLTVPNLQPNIGLFWYFFTEMFEHFRVLFIVAFQINSIFLYVLPLTLRLYKEPVLVAICLTGLAAVFKSYPCVGDIALYLALMPLCKYLFPFMQQGFIVACFFIGCSMFAPTVWHLWIYTRSANANFYFGVTLAFATSQIFLLTDLLFAYLKRDYTLENGIQKTIKGKPARLVLD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphatidylinositol glycan anchor biosynthesis class U protein Component of the GPI transamidase complex. May be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.confidentQ9H490
Phosphatidylinositol glycan anchor biosynthesis class U protein Component of the GPI transamidase complex. May be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.confidentQ8K358
GPI transamidase component GAB1 Component of the GPI transamidase complex. May be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.confidentP41733

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0042765 [CC]GPI-anchor transamidase complexprobableGO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0030176, GO:0031301, GO:0031300, GO:0043227, GO:0031227, GO:0031224, GO:0005737, GO:0044446, GO:0031090, GO:0016021, GO:0016020, GO:0043226, GO:0044432, GO:0012505, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0003923 [MF]GPI-anchor transamidase activityprobableGO:0016787, GO:0003674, GO:0003824
GO:0046425 [BP]regulation of JAK-STAT cascadeprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0010627, GO:0050789
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0034394 [BP]protein localization to cell surfaceprobableGO:0008104, GO:0070727, GO:0034613, GO:0044763, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0006501 [BP]C-terminal protein lipidationprobableGO:0018410, GO:0044249, GO:0042157, GO:0034645, GO:0042158, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0043687, GO:0009987, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0006497, GO:0044238, GO:0019538, GO:0043412, GO:0044237, GO:0043170, GO:0009059
GO:0050976 [BP]detection of mechanical stimulus involved in sensory perception of touchprobableGO:0009582, GO:0009581, GO:0050975, GO:0050974, GO:0051606, GO:0044707, GO:0009605, GO:0009628, GO:0050982, GO:0050954, GO:0050896, GO:0007600, GO:0009612, GO:0032501, GO:0050906, GO:0050877, GO:0008150, GO:0044699, GO:0003008
GO:0016255 [BP]attachment of GPI anchor to proteinprobableGO:0006650, GO:0044249, GO:0042157, GO:0034645, GO:0042158, GO:0044255, GO:0045017, GO:0006629, GO:0044267, GO:0044710, GO:0044260, GO:0008150, GO:0071704, GO:0006505, GO:0006506, GO:0046467, GO:0006664, GO:0006644, GO:0006643, GO:1901576, GO:0009987, GO:0009247, GO:0006464, GO:0043412, GO:0036211, GO:0046488, GO:0008152, GO:0006661, GO:0046486, GO:0090407, GO:0008610, GO:0006497, GO:0044238, GO:0008654, GO:1901137, GO:1901135, GO:0009058, GO:0044237, GO:0043170, GO:0019538, GO:0006796, GO:0009059, GO:0006793, GO:0019637, GO:0046474
GO:0034235 [MF]GPI anchor bindingprobableGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:0051861

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted