Diaphorina citri psyllid: psy10445

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-----

MAGTPDQVRLSGLPDTTSHTLRSSRQKRQFLAFSIPTIVTVNPCVTNRGLLGQCLRFKQCYPYLKLPDFIWEPVIYDSFDSCSYIAPDGTQGVGVCCTTPLQGGYPIISQDLSEEPEIPTYPSFAFNWPPPVPTHPPDHTPATHPPSIVSSTETAHFPTEVPVTTTEAGKVDMSCGQKNGYQDLDQERIVGGQNAEQNEWPWVVAIFNSGKQFCGGSLIDTQHVLTAAHCVAHMSSWDVAKLSVNLGDHNIKQKNEVKHVERKVKRLVRHKAFDMRTLYNDVAILTLDKPVKYSDTIRAICLPRGRASYEGKIATVIGWGSLRESGPQPAVLQKVNIPVWTNADCKARYGPVAPGGIVDHFLCAGRATKDSCTGDSGGPLMVNDGKWTQVGIVSWGIGCGKGEYPGVYTRVTYFMPWITKNLKKN

ccccccCEEEcccccccccccccccccccccccccccccccccccccccccEEEECccccccccccccccccccEECcccccccccccccccccCCccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEccccccccccccEEEEEcccCEEEEEEEEcccEEEEcccccccccccccccEEEECccccccccccccEEEEEEEEEEEccccccccccccEEEEEEcccccccccccccccccccccccccEEEEEEccccccccccccccEEEEEEECccHHHHHcccccccccccccEEEcccccccccccccccEEEECccCEEEEEEEEccccccccccccEEEcccccHHHHHHHHHcc

******Q**LSG****************Q*LAFSIPTIVTVNPCVTNRGLLGQCLRFKQCYPYLKLPDFIWEPVIYDSFDSCSYIAPDGTQGVGVCCTTPLQG*YPIISQ*******IPTYPSFAFN****************************************AG*VDMSCGQKNGYQDLDQERIVGGQNAEQNEWPWVVAIFNSGKQFCGGSLIDTQHVLTAAHCVAHMSSWDVAKLSVNLGDHNIKQKNEVKHVERKVKRLVRHKAFDMRTLYNDVAILTLDKPVKYSDTIRAICLPRGRASYEGKIATVIGWGSLRESGPQPAVLQKVNIPVWTNADCKARYGPVAPGGIVDHFLCAGRATKDSCTGDSGGPLMVNDGKWTQVGIVSWGIGCGKGEYPGVYTRVTYFMPWITKNL***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0004252 [MF]	serine-type endopeptidase activity	probable	GO:0016787, GO:0004175, GO:0017171, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008236
GO:0044425 [CC]	membrane part	probable	GO:0005575, GO:0016020
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0043167 [MF]	ion binding	probable	GO:0003674, GO:0005488
GO:0006508 [BP]	proteolysis	probable	GO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0065007 [BP]	biological regulation	probable	GO:0008150
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2F9N, chain A
Confidence level:very confident
Coverage over the Query: 189-424
View the alignment between query and template
View the model in PyMOL

Template: 2XXL, chain A
Confidence level:very confident
Coverage over the Query: 39-104,122,141-152,171-424
View the alignment between query and template
View the model in PyMOL