Query         psy1045
Match_columns 113
No_of_seqs    63 out of 65
Neff          3.0 
Searched_HMMs 46136
Date          Fri Aug 16 18:29:14 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy1045.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/1045hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd01231 PH_Lnk LNK-family Plec 100.0 3.1E-42 6.6E-47  249.8   5.3   78   36-113     1-82  (107)
  2 PF00169 PH:  PH domain;  Inter  96.7    0.01 2.2E-07   36.8   6.4   70   34-112     1-76  (104)
  3 smart00233 PH Pleckstrin homol  96.5    0.02 4.4E-07   34.4   6.4   70   35-112     2-74  (102)
  4 cd00821 PH Pleckstrin homology  95.7   0.033 7.1E-07   33.2   4.8   54   52-112    14-70  (96)
  5 cd00900 PH-like Pleckstrin hom  95.1    0.16 3.5E-06   30.4   6.5   68   37-111     2-70  (99)
  6 cd01257 PH_IRS Insulin recepto  95.1    0.05 1.1E-06   38.2   4.8   54   34-95      2-62  (101)
  7 cd01253 PH_beta_spectrin Beta-  92.1    0.76 1.6E-05   30.7   6.0   59   50-112    19-78  (104)
  8 cd01266 PH_Gab Gab (Grb2-assoc  91.0     1.1 2.5E-05   30.6   6.2   45   51-95     16-63  (108)
  9 KOG2550|consensus               90.2   0.095 2.1E-06   46.8   0.3   16    1-16     78-93  (503)
 10 TIGR01303 IMP_DH_rel_1 IMP deh  87.1    0.21 4.6E-06   43.4   0.3   16    1-16     59-74  (475)
 11 cd01235 PH_SETbf Set binding f  83.6     2.2 4.8E-05   27.8   3.8   42   51-94     12-53  (101)
 12 cd01233 Unc104 Unc-104 pleckst  83.0     4.5 9.7E-05   27.4   5.3   48   35-90      3-50  (100)
 13 cd01246 PH_oxysterol_bp Oxyste  79.0      11 0.00023   23.6   5.7   45   37-89      2-48  (91)
 14 cd01219 PH_FGD FGD (faciogenit  63.2      25 0.00055   23.8   5.1   35   33-75      1-35  (101)
 15 PTZ00314 inosine-5'-monophosph  57.2     3.9 8.4E-05   35.7   0.3   15    1-15     66-80  (495)
 16 cd01250 PH_centaurin Centaurin  55.5      48  0.0011   20.6   5.3   34   51-88     13-48  (94)
 17 cd01260 PH_CNK Connector enhan  53.6      60  0.0013   21.1   5.9   36   51-90     17-52  (96)
 18 cd01241 PH_Akt Akt pleckstrin   49.7      80  0.0017   21.4   6.2   69   35-111     2-71  (102)
 19 COG0516 GuaB IMP dehydrogenase  48.5       7 0.00015   29.0   0.4   14    1-14     63-76  (170)
 20 PF00478 IMPDH:  IMP dehydrogen  41.7     9.2  0.0002   32.7   0.2   16    1-16     53-68  (352)
 21 cd01252 PH_cytohesin Cytohesin  32.1 1.7E+02  0.0037   20.2   5.7   47   36-90      2-48  (125)
 22 cd01261 PH_SOS Son of Sevenles  30.6      88  0.0019   22.6   3.7   14   33-46      3-16  (112)
 23 cd08344 MhqB_like_N N-terminal  30.2      59  0.0013   21.0   2.6   21   58-78     92-112 (112)
 24 PRK07807 inosine 5-monophospha  28.8      21 0.00046   31.3   0.4   16    1-16     60-75  (479)
 25 PF07776 zf-AD:  Zinc-finger as  28.7      16 0.00034   21.8  -0.3   38   57-103     2-39  (75)
 26 cd01236 PH_outspread Outspread  26.6 1.5E+02  0.0032   21.0   4.2   60   50-112    20-87  (104)
 27 PF06590 PerB:  PerB protein;    26.1      41 0.00089   25.3   1.4   13   67-79     38-50  (129)
 28 cd01245 PH_RasGAP_CG5898 RAS G  23.8 1.1E+02  0.0023   21.5   3.1   44   51-95     13-56  (98)
 29 PF15360 Apelin:  APJ endogenou  22.5      51  0.0011   22.0   1.2   27   36-62     13-41  (55)
 30 TIGR00068 glyox_I lactoylgluta  22.1      99  0.0022   21.3   2.7   27   55-81    121-147 (150)
 31 PRK10291 glyoxalase I; Provisi  21.9 1.2E+02  0.0027   20.0   3.0   26   53-78     98-123 (129)
 32 PRK07107 inosine 5-monophospha  21.6      35 0.00076   30.1   0.3   15    1-15     67-81  (502)
 33 PF04283 CheF-arch:  Chemotaxis  20.6 1.2E+02  0.0025   24.2   3.1   39   50-96     21-59  (221)
 34 cd01264 PH_melted Melted pleck  20.4 1.3E+02  0.0029   21.3   3.0   46   67-112    28-84  (101)

No 1  
>cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain. LNK-family Pleckstrin homology (PH) domain.  The Lnk family of proteins consists of Lnk, APS and SH2B. They are adaptor proteins consisting of a PH domain and an SH2 domain, which mediates signaling through growth factor receptors. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. The lnk family PH domain is likely involved in targeting of the adaptor proteins to the plasma membrane.
Probab=100.00  E-value=3.1e-42  Score=249.77  Aligned_cols=78  Identities=54%  Similarity=0.893  Sum_probs=74.6

Q ss_pred             EeeeeeeeccCC--CCCcccccceeeeEEEecCCeeeEEecC--CCCCCCcccccccceeehhccCCccCCCCCCeeEEe
Q psy1045          36 KEGIVNYLVGEN--TDGTQKWEKCRLALVKTVGGYMLEFYSP--PKSLKPKKGVFCFLITEARETSALEMPDHENTFVLK  111 (113)
Q Consensus        36 rEG~l~yl~~~~--~~~~~~WqkcRL~Lrk~~~g~~LEfy~P--PKsskPK~~i~Cs~I~EVR~tt~LEMPD~~nTFVLK  111 (113)
                      |||+|||+.+++  ++++++||||||+|+++.+||.||||.|  |||||||++++||+|+|||+||+||||||+||||||
T Consensus         1 kEg~l~y~~~d~~~~~~~~~WqkcRl~L~~~~gg~~le~~~~~pPKssrpk~~v~C~~I~EvR~tt~LEmPD~~nTFvLK   80 (107)
T cd01231           1 KEGVLRYSLADEADMDSGARWQRGRLVLRKAVGGYMLEFYLPLPPKSSKPKLQVACSSISEVRECTRLEMPDNLYTFVLK   80 (107)
T ss_pred             CchhhccccccccCCCCccccceeeEEEEecCCCceEEEEccCCCCCCCCccccchhhhhhhhhcccccccCcccEEEEE
Confidence            699999998876  7899999999999999999999999998  999999999999999999999999999999999999


Q ss_pred             eC
Q psy1045         112 GR  113 (113)
Q Consensus       112 v~  113 (113)
                      +.
T Consensus        81 ~~   82 (107)
T cd01231          81 VD   82 (107)
T ss_pred             ec
Confidence            83


No 2  
>PF00169 PH:  PH domain;  InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ]. The pleckstrin homology domain commonly found in eukaryotic signalling proteins. The domain family possesses multiple functions including the abilities to bind inositol phosphates, and various proteins. PH domains have been found to possess inserted domains (such as in PLC gamma, syntrophins) and to be inserted within other domains. Mutations in Brutons tyrosine kinase (Btk) within its PH domain cause X-linked agammaglobulinaemia (XLA) in patients. Point mutations cluster into the positively charged end of the molecule around the predicted binding site for phosphatidylinositol lipids. The 3D structure of several PH domains has been determined []. All known cases have a common structure consisting of two perpendicular anti-parallel beta sheets, followed by a C-terminal amphipathic helix. The loops connecting the beta-strands differ greatly in length, making the PH domain relatively difficult to detect. There are no totally invariant residues within the PH domain. Proteins reported to contain one more PH domains belong to the following families:  Pleckstrin, the protein where this domain was first detected, is the major substrate of protein kinase C in platelets. Pleckstrin is one of the rare proteins to contains two PH domains. Ser/Thr protein kinases such as the Akt/Rac family, the beta-adrenergic receptor kinases, the mu isoform of PKC and the trypanosomal NrkA family. Tyrosine protein kinases belonging to the Btk/Itk/Tec subfamily. Insulin Receptor Substrate 1 (IRS-1). Regulators of small G-proteins like guanine nucleotide releasing factor GNRP (Ras-GRF) (which contains 2 PH domains), guanine nucleotide exchange proteins like vav, dbl, SoS and Saccharomyces cerevisiae CDC24, GTPase activating proteins like rasGAP and BEM2/IPL2, and the human break point cluster protein bcr. Cytoskeletal proteins such as dynamin (see IPR001401 from INTERPRO), Caenorhabditis elegans kinesin-like protein unc-104 (see IPR001752 from INTERPRO), spectrin beta-chain, syntrophin (2 PH domains) and S. cerevisiae nuclear migration protein NUM1. Mammalian phosphatidylinositol-specific phospholipase C (PI-PLC) (see IPR000909 from INTERPRO) isoforms gamma and delta. Isoform gamma contains two PH domains, the second one is split into two parts separated by about 400 residues. Oxysterol binding proteins OSBP, S. cerevisiae OSH1 and YHR073w. Mouse protein citron, a putative rho/rac effector that binds to the GTP-bound forms of rho and rac. Several S. cerevisiae proteins involved in cell cycle regulation and bud formation like BEM2, BEM3, BUD4 and the BEM1-binding proteins BOI2 (BEB1) and BOI1 (BOB1). C. elegans protein MIG-10. C. elegans hypothetical proteins C04D8.1, K06H7.4 and ZK632.12. S. cerevisiae hypothetical proteins YBR129c and YHR155w. ; GO: 0005515 protein binding; PDB: 1DYN_B 2DYN_B 3SNH_A 3ZYS_C 1X05_A 2I5F_A 1ZM0_B 1XX0_A 2I5C_C 3A8P_D ....
Probab=96.71  E-value=0.01  Score=36.81  Aligned_cols=70  Identities=24%  Similarity=0.339  Sum_probs=55.8

Q ss_pred             eeEeeeeeeeccCCCCCcccccceeeeEEEecCCeeeEEecCCC---CCCCcccccccceeehhccCCcc---CCCCCCe
Q psy1045          34 CRKEGIVNYLVGENTDGTQKWEKCRLALVKTVGGYMLEFYSPPK---SLKPKKGVFCFLITEARETSALE---MPDHENT  107 (113)
Q Consensus        34 ~~rEG~l~yl~~~~~~~~~~WqkcRL~Lrk~~~g~~LEfy~PPK---sskPK~~i~Cs~I~EVR~tt~LE---MPD~~nT  107 (113)
                      |++||.|....    .....|++.-.+|+.    -.|-+|..++   ..+|+..|+...+ +|+.....+   -.+..|.
T Consensus         1 ~~~~G~L~~~~----~~~~~wk~r~~vL~~----~~L~~~~~~~~~~~~~~~~~i~l~~~-~v~~~~~~~~~~~~~~~~~   71 (104)
T PF00169_consen    1 CIKEGWLLKKS----SSRKKWKKRYFVLRD----SYLLYYKSSKDKSDSKPKGSIPLDDC-TVRPDPSSDFLSNKKRKNC   71 (104)
T ss_dssp             EEEEEEEEEEE----SSSSSEEEEEEEEET----TEEEEESSTTTTTESSESEEEEGTTE-EEEEETSSTSTSTSSSSSE
T ss_pred             CEEEEEEEEEC----CCCCCeEEEEEEEEC----CEEEEEecCccccceeeeEEEEecCc-eEEEcCccccccccCCCcE
Confidence            57899998766    356789999888875    4466888888   7899999999999 888877664   6777888


Q ss_pred             eEEee
Q psy1045         108 FVLKG  112 (113)
Q Consensus       108 FVLKv  112 (113)
                      |.|..
T Consensus        72 f~i~~   76 (104)
T PF00169_consen   72 FEITT   76 (104)
T ss_dssp             EEEEE
T ss_pred             EEEEe
Confidence            88864


No 3  
>smart00233 PH Pleckstrin homology domain. Domain commonly found in eukaryotic signalling proteins. The domain family possesses multiple functions including the abilities to bind inositol phosphates, and various proteins. PH domains have been found to possess inserted domains (such as in PLC gamma, syntrophins) and to be inserted within other domains. Mutations in Brutons tyrosine kinase (Btk) within its PH domain cause X-linked agammaglobulinaemia (XLA) in patients. Point mutations cluster into the positively charged end of the molecule around the predicted binding site for phosphatidylinositol lipids.
Probab=96.46  E-value=0.02  Score=34.35  Aligned_cols=70  Identities=26%  Similarity=0.359  Sum_probs=46.3

Q ss_pred             eEeeeeeeeccCCCCCcccccceeeeEEEecCCeeeEEecCCCC---CCCcccccccceeehhccCCccCCCCCCeeEEe
Q psy1045          35 RKEGIVNYLVGENTDGTQKWEKCRLALVKTVGGYMLEFYSPPKS---LKPKKGVFCFLITEARETSALEMPDHENTFVLK  111 (113)
Q Consensus        35 ~rEG~l~yl~~~~~~~~~~WqkcRL~Lrk~~~g~~LEfy~PPKs---skPK~~i~Cs~I~EVR~tt~LEMPD~~nTFVLK  111 (113)
                      .+||.|......   +...|+++-++|..    ..|.+|.++..   ..|...|+...+ .|......+.....|+|.|+
T Consensus         2 ~~~G~l~~~~~~---~~~~~~~~~~~L~~----~~l~~~~~~~~~~~~~~~~~i~l~~~-~v~~~~~~~~~~~~~~f~l~   73 (102)
T smart00233        2 IKEGWLYKKSGG---KKKSWKKRYFVLFN----STLLYYKSEKAKKDYKPKGSIDLSGI-TVREAPDPDSAKKPHCFEIK   73 (102)
T ss_pred             ceeEEEEEeCCC---ccCCceEEEEEEEC----CEEEEEeCCCccccCCCceEEECCcC-EEEeCCCCccCCCceEEEEE
Confidence            478888876543   45689999999986    57778887766   355555555554 44444433334568889886


Q ss_pred             e
Q psy1045         112 G  112 (113)
Q Consensus       112 v  112 (113)
                      .
T Consensus        74 ~   74 (102)
T smart00233       74 T   74 (102)
T ss_pred             e
Confidence            4


No 4  
>cd00821 PH Pleckstrin homology (PH) domain. Pleckstrin homology (PH) domain. PH domains are only found in eukaryotes. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=95.72  E-value=0.033  Score=33.21  Aligned_cols=54  Identities=22%  Similarity=0.380  Sum_probs=37.8

Q ss_pred             ccccceeeeEEEecCCeeeEEecCCCC---CCCcccccccceeehhccCCccCCCCCCeeEEee
Q psy1045          52 QKWEKCRLALVKTVGGYMLEFYSPPKS---LKPKKGVFCFLITEARETSALEMPDHENTFVLKG  112 (113)
Q Consensus        52 ~~WqkcRL~Lrk~~~g~~LEfy~PPKs---skPK~~i~Cs~I~EVR~tt~LEMPD~~nTFVLKv  112 (113)
                      ..|+++.++|.    +..|.+|.++..   ..|+..++... .+|+.....+  +..++|.|+.
T Consensus        14 ~~w~~~~~~L~----~~~l~~~~~~~~~~~~~~~~~i~l~~-~~v~~~~~~~--~~~~~f~i~~   70 (96)
T cd00821          14 KGWKRRWFVLF----NDLLLYYKKKSSKKSYKPKGSIPLSG-AEVEESPDDS--GRKNCFEIRT   70 (96)
T ss_pred             CCccEEEEEEE----CCEEEEEECCCCCcCCCCcceEEcCC-CEEEECCCcC--CCCcEEEEec
Confidence            68999999998    346667777766   67777777777 5555543332  4578888864


No 5  
>cd00900 PH-like Pleckstrin homology-like domain. Pleckstrin homology-like domain.  This family includes the PH domain, both the Shc-like and IRS-like PTB domains, the ran-binding domain, the EVH1 domain, a domain in neurobeachin and the third domain of FERM. All of these domains have a PH fold, but lack significant sequence similarity. They are generally involved in targeting to protein to the appropriate cellular location or interacting with a binding partner.  The PH domain is commonly found in eukaryotic signaling proteins. This domain family possesses multiple functions including the ability to bind inositol phosphates and to other proteins.
Probab=95.14  E-value=0.16  Score=30.42  Aligned_cols=68  Identities=19%  Similarity=0.251  Sum_probs=45.7

Q ss_pred             eeeeeeeccCCCCCcccccceeeeEEEecCCeeeEEecCCCCCCCc-ccccccceeehhccCCccCCCCCCeeEEe
Q psy1045          37 EGIVNYLVGENTDGTQKWEKCRLALVKTVGGYMLEFYSPPKSLKPK-KGVFCFLITEARETSALEMPDHENTFVLK  111 (113)
Q Consensus        37 EG~l~yl~~~~~~~~~~WqkcRL~Lrk~~~g~~LEfy~PPKsskPK-~~i~Cs~I~EVR~tt~LEMPD~~nTFVLK  111 (113)
                      +|.|.+.......+...|++..++|.    +..|-+|+++...++. ..++...|. |.......  +..++|.+.
T Consensus         2 ~g~l~~~~~~~~~~~~~w~~~~~~l~----~~~l~~~~~~~~~~~~~~~~~l~~~~-v~~~~~~~--~~~~~F~i~   70 (99)
T cd00900           2 EGYLLKLGSDDVSKGKRWKRRWFFLF----DDGLLLYKSDDKKEIKPGSIPLSEIS-VEEDPDGS--DDPNCFAIV   70 (99)
T ss_pred             ccEEEEeCCCccccccCceeeEEEEE----CCEEEEEEcCCCCcCCCCEEEccceE-EEECCCCC--CCCceEEEE
Confidence            57777776654335678999999997    3678899999888877 456655555 44432211  457888775


No 6  
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain. Insulin receptor substrate (IRS) pleckstrin homology (PH) domain. PH domains are only found in eukaryotes, and are often involved in targeting proteins to the plasma membrane via lipid binding. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPases, adaptors, a well as cytoskeletal associated molecules and in lipid associated enzymes.  The IRS PH domain targets IRS molecules to the plasma membrane, usually in response to insulin stimulation.
Probab=95.14  E-value=0.05  Score=38.25  Aligned_cols=54  Identities=22%  Similarity=0.232  Sum_probs=42.1

Q ss_pred             eeEeeeeeeeccCCCCCcccccceeeeEEEecCC--eeeEEecCCCC-----CCCcccccccceeehhc
Q psy1045          34 CRKEGIVNYLVGENTDGTQKWEKCRLALVKTVGG--YMLEFYSPPKS-----LKPKKGVFCFLITEARE   95 (113)
Q Consensus        34 ~~rEG~l~yl~~~~~~~~~~WqkcRL~Lrk~~~g--~~LEfy~PPKs-----skPK~~i~Cs~I~EVR~   95 (113)
                      ++++|-|.=.        ..|.|+=.+|++..++  +.||.|.+-|.     ++|+=.|+..++..|..
T Consensus         2 v~k~GyL~K~--------K~~kkRwFVLr~~~~~~p~~Leyyk~ek~~~~~~~~p~~vI~L~~c~~v~~   62 (101)
T cd01257           2 VRKSGYLRKQ--------KSMHKRFFVLRAESSGGPARLEYYENEKKFLQKGSAPKRVIPLESCFNINK   62 (101)
T ss_pred             ccEEEEEeEe--------cCcEeEEEEEecCCCCCCceEEEECChhhccccCCCceEEEEccceEEEee
Confidence            5677776532        6899999999977543  89999999874     78999998888877743


No 7  
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain. Beta-spectrin pleckstrin homology (PH) domain. Beta spectrin binds actin and functions as a major component of the cytoskeleton underlying cellular membranes. Beta spectrin consists of multiple spectrin repeats followed by a PH domain,  which binds to Inositol-1,4,5-Trisphosphate. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions.  PH domains are often involved in targeting proteins to the plasma membrane via lipid binding. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=92.07  E-value=0.76  Score=30.66  Aligned_cols=59  Identities=20%  Similarity=0.255  Sum_probs=33.3

Q ss_pred             CcccccceeeeEEEecCCeeeEEecCCCCCCCc-ccccccceeehhccCCccCCCCCCeeEEee
Q psy1045          50 GTQKWEKCRLALVKTVGGYMLEFYSPPKSLKPK-KGVFCFLITEARETSALEMPDHENTFVLKG  112 (113)
Q Consensus        50 ~~~~WqkcRL~Lrk~~~g~~LEfy~PPKsskPK-~~i~Cs~I~EVR~tt~LEMPD~~nTFVLKv  112 (113)
                      +...|+++-.+|+.    ..|-||..++....+ .+++..+|..+.-.-..+.+.+.|+|-|+.
T Consensus        19 ~~~~Wk~r~~vL~~----~~L~~ykd~~~~~~~~~~~~~i~l~~~~i~~~~~~~k~~~~F~l~~   78 (104)
T cd01253          19 SNRSWDNVYGVLCG----QSLSFYKDEKMAAENVHGEPPVDLTGAQCEVASDYTKKKHVFRLRL   78 (104)
T ss_pred             CCCCcceEEEEEeC----CEEEEEecCcccccCCCCCCcEeccCCEEEecCCcccCceEEEEEe
Confidence            46789999999974    578999887754222 233322332221111122334468887763


No 8  
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain. Gab (Grb2-associated binder) pleckstrin homology (PH) domain. The Gab subfamily includes several Gab proteins, Drosophila DOS and C. elegans SOC-1. They are scaffolding adaptor proteins, which possess N-terminal PH domains and a C-terminus with proline-rich regions and multiple phosphorylation sites. Following activation of growth factor receptors, Gab proteins are tyrosine phosphorylated and activate PI3K, which generates 3-phosphoinositide lipids. By binding to these lipids via the PH domain, Gab proteins remain in proximity to the receptor, leading to further signaling. While not all Gab proteins depend on the PH domain for recruitment, it is required for Gab activity. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display str
Probab=91.02  E-value=1.1  Score=30.60  Aligned_cols=45  Identities=16%  Similarity=0.191  Sum_probs=38.2

Q ss_pred             cccccceeeeEEEec---CCeeeEEecCCCCCCCcccccccceeehhc
Q psy1045          51 TQKWEKCRLALVKTV---GGYMLEFYSPPKSLKPKKGVFCFLITEARE   95 (113)
Q Consensus        51 ~~~WqkcRL~Lrk~~---~g~~LEfy~PPKsskPK~~i~Cs~I~EVR~   95 (113)
                      ...|.+.-.+|+...   +.+.|+.|.-++.++|+=.|..+.+.+|..
T Consensus        16 ~~~WkrRwFvL~~~~l~~~~~~L~Yyk~~~~~k~~g~I~L~~~~~v~~   63 (108)
T cd01266          16 RTKWVRRYFVLHCGDRERNLFALEYYKTSRKFKLEFVIDLESCSQVDP   63 (108)
T ss_pred             ccCcEEEEEEEeccccCCCcceEEEECCCCCCccceEEECCccEEEcc
Confidence            468999999999652   458999999999999999999999887743


No 9  
>KOG2550|consensus
Probab=90.20  E-value=0.095  Score=46.81  Aligned_cols=16  Identities=75%  Similarity=1.014  Sum_probs=14.6

Q ss_pred             Chhhhhhhcccccccc
Q psy1045           1 MAIAMALCGGIGRIKN   16 (113)
Q Consensus         1 ~~~~~~~~~~~~~~~~   16 (113)
                      |||||||+||||-|..
T Consensus        78 MAiaMAl~ggIg~IHh   93 (503)
T KOG2550|consen   78 MAIAMALLGGIGFIHH   93 (503)
T ss_pred             HHHHHHhcCCceeeec
Confidence            8999999999999864


No 10 
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein. This model represents a family of proteins, often annotated as a putative IMP dehydrogenase, related to IMP dehydrogenase and GMP reductase and restricted to the high GC Gram-positive bacteria. All species in which a member is found so far (Corynebacterium glutamicum, Mycobacterium tuberculosis, Streptomyces coelicolor, etc.) also have IMP dehydrogenase as described by TIGRFAMs entry TIGR01302.
Probab=87.07  E-value=0.21  Score=43.43  Aligned_cols=16  Identities=38%  Similarity=0.389  Sum_probs=14.8

Q ss_pred             Chhhhhhhcccccccc
Q psy1045           1 MAIAMALCGGIGRIKN   16 (113)
Q Consensus         1 ~~~~~~~~~~~~~~~~   16 (113)
                      ||||||.|||||-|.+
T Consensus        59 MAi~~A~~GGigvIh~   74 (475)
T TIGR01303        59 MAETVARRGGIVILPQ   74 (475)
T ss_pred             HHHHHHHCCCEEEEeC
Confidence            8999999999999875


No 11 
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain. Set binding factor Pleckstrin Homology (PH) domain. Set binding factor is a  myotubularin-related pseudo-phosphatase consisting of a Denn domain,  a Gram domain, an inactive phosphatase domain, a SID motif and a C-terminal PH domain. Its PH domain is predicted to bind lipids based upon its ability to respond to phosphatidylinositol 3-kinase .
Probab=83.55  E-value=2.2  Score=27.81  Aligned_cols=42  Identities=12%  Similarity=0.138  Sum_probs=33.6

Q ss_pred             cccccceeeeEEEecCCeeeEEecCCCCCCCcccccccceeehh
Q psy1045          51 TQKWEKCRLALVKTVGGYMLEFYSPPKSLKPKKGVFCFLITEAR   94 (113)
Q Consensus        51 ~~~WqkcRL~Lrk~~~g~~LEfy~PPKsskPK~~i~Cs~I~EVR   94 (113)
                      ...|.+.-.+|...  +..|..|..++.++|+=.|....+..|-
T Consensus        12 ~k~WkkRwFvL~~~--~~~L~Yy~~~~~~~~~g~I~L~~~~~v~   53 (101)
T cd01235          12 LKGWKPRWFVLDPD--KHQLRYYDDFEDTAEKGCIDLAEVKSVN   53 (101)
T ss_pred             CCCccceEEEEECC--CCEEEEecCCCCCccceEEEcceeEEEe
Confidence            46899988888753  4589999999999999888888766554


No 12 
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain. Unc-104 pleckstrin homology (PH) domain. Unc-104 is a kinesin-like protein containing an N-terminal kinesin catalytic domain, followed by a forkhead associated domain with a C-terminal PH domain. These proteins are responsible for the transport of membrane vesicles along microtubules. The mechanism involves the binding of the  PH domain to phosphatidiylinositol (4,5) P2-containing liposomes.
Probab=82.98  E-value=4.5  Score=27.36  Aligned_cols=48  Identities=15%  Similarity=0.214  Sum_probs=36.2

Q ss_pred             eEeeeeeeeccCCCCCcccccceeeeEEEecCCeeeEEecCCCCCCCcccccccce
Q psy1045          35 RKEGIVNYLVGENTDGTQKWEKCRLALVKTVGGYMLEFYSPPKSLKPKKGVFCFLI   90 (113)
Q Consensus        35 ~rEG~l~yl~~~~~~~~~~WqkcRL~Lrk~~~g~~LEfy~PPKsskPK~~i~Cs~I   90 (113)
                      .|+|.|.--.+    ....|.++-.+|+.    -.|..|-..+...|+-.|....+
T Consensus         3 ~k~G~L~Kkg~----~~k~WkkRwfvL~~----~~L~yyk~~~~~~~~~~I~L~~~   50 (100)
T cd01233           3 SKKGYLNFPEE----TNSGWTRRFVVVRR----PYLHIYRSDKDPVERGVINLSTA   50 (100)
T ss_pred             ceeEEEEeeCC----CCCCcEEEEEEEEC----CEEEEEccCCCccEeeEEEeccc
Confidence            47777754333    23679999999986    47888888888899988887755


No 13 
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain. Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain. Oxysterol binding proteins are a multigene family that is conserved in yeast, flies, worms, mammals and plants. They all contain a C-terminal oxysterol binding domain, and most contain an N-terminal PH domain. OSBP PH domains bind to membrane phosphoinositides and thus likely play an important role in intracellular targeting. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=79.02  E-value=11  Score=23.57  Aligned_cols=45  Identities=22%  Similarity=0.343  Sum_probs=30.3

Q ss_pred             eeeeeeeccCCCCCcccccceeeeEEEecCCeeeEEecCCCCC--CCcccccccc
Q psy1045          37 EGIVNYLVGENTDGTQKWEKCRLALVKTVGGYMLEFYSPPKSL--KPKKGVFCFL   89 (113)
Q Consensus        37 EG~l~yl~~~~~~~~~~WqkcRL~Lrk~~~g~~LEfy~PPKss--kPK~~i~Cs~   89 (113)
                      ||.|....+    ....|+++-.+|+    +-.|-+|..++.+  .|+-.|....
T Consensus         2 ~G~L~k~~~----~~~~W~~r~~vl~----~~~L~~~~~~~~~~~~~~~~i~l~~   48 (91)
T cd01246           2 EGWLLKWTN----YLKGWQKRWFVLD----NGLLSYYKNKSSMRGKPRGTILLSG   48 (91)
T ss_pred             eEEEEEecc----cCCCceeeEEEEE----CCEEEEEecCccCCCCceEEEEece
Confidence            566655543    2367999888886    4577788888766  7776665554


No 14 
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain. FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain. FGD has a RhoGEF (DH) domain, followed by a PH domain, a FYVE domain and a C-terminal PH domain. FGD is a guanine nucleotide exchange factor that activates the Rho GTPase Cdc42. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=63.17  E-value=25  Score=23.83  Aligned_cols=35  Identities=34%  Similarity=0.368  Sum_probs=23.2

Q ss_pred             eeeEeeeeeeeccCCCCCcccccceeeeEEEecCCeeeEEecC
Q psy1045          33 ECRKEGIVNYLVGENTDGTQKWEKCRLALVKTVGGYMLEFYSP   75 (113)
Q Consensus        33 e~~rEG~l~yl~~~~~~~~~~WqkcRL~Lrk~~~g~~LEfy~P   75 (113)
                      |+++||.|.-+...    ...|+.-.+.|..   + +|=.+.|
T Consensus         1 e~ikeG~L~K~~~~----~~~~k~RyffLFn---d-~Ll~~~~   35 (101)
T cd01219           1 ELLKEGSVLKISST----TEKTEERYLFLFN---D-LLLYCVP   35 (101)
T ss_pred             CcccceEEEEEecC----CCCceeEEEEEeC---C-EEEEEEc
Confidence            67899999766553    3568887777765   3 4445553


No 15 
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional
Probab=57.22  E-value=3.9  Score=35.74  Aligned_cols=15  Identities=80%  Similarity=1.094  Sum_probs=13.9

Q ss_pred             Chhhhhhhccccccc
Q psy1045           1 MAIAMALCGGIGRIK   15 (113)
Q Consensus         1 ~~~~~~~~~~~~~~~   15 (113)
                      ||||||..||+|-|-
T Consensus        66 ma~a~a~~GglGvi~   80 (495)
T PTZ00314         66 MAIAMALMGGIGVIH   80 (495)
T ss_pred             HHHHHHHCCCeEEec
Confidence            799999999999984


No 16 
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain. Centaurin Pleckstrin homology (PH) domain. Centaurin beta and gamma consist of a PH domain, an ArfGAP domain and three ankyrin repeats. Centaurain gamma also has an N-terminal Ras homology domain. Centaurin alpha has a different domain architecture and its PH domain is in a different subfamily.  Centaurin can bind to phosphatidlyinositol (3,4,5)P3.  PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=55.54  E-value=48  Score=20.64  Aligned_cols=34  Identities=21%  Similarity=0.246  Sum_probs=19.9

Q ss_pred             cccccceeeeEEEecCCeeeEEecCCCC--CCCccccccc
Q psy1045          51 TQKWEKCRLALVKTVGGYMLEFYSPPKS--LKPKKGVFCF   88 (113)
Q Consensus        51 ~~~WqkcRL~Lrk~~~g~~LEfy~PPKs--skPK~~i~Cs   88 (113)
                      ...|+++-.+|+   ++. |-+|..+..  ..|...|...
T Consensus        13 ~~~W~kr~~~L~---~~~-l~~y~~~~~~~~~~~~~i~l~   48 (94)
T cd01250          13 NKEWKKRWFVLK---NGQ-LTYHHRLKDYDNAHVKEIDLR   48 (94)
T ss_pred             CCCceEEEEEEe---CCe-EEEEcCCcccccccceEEecc
Confidence            457988888886   333 445655443  4565555543


No 17 
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras)  (CNK) pleckstrin homology (PH) domain. Connector enhancer of KSR (Kinase suppressor of ras)  (CNK) pleckstrin homology (PH) domain. CNK is believed to regulate the activity and the subcellular localization of RAS activated RAF. CNK is composed of N-terminal SAM and PDZ domains along with a central or C-terminal PH domain.  PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPAses, adaptors, a well as cytoskelet
Probab=53.60  E-value=60  Score=21.11  Aligned_cols=36  Identities=22%  Similarity=0.296  Sum_probs=28.7

Q ss_pred             cccccceeeeEEEecCCeeeEEecCCCCCCCcccccccce
Q psy1045          51 TQKWEKCRLALVKTVGGYMLEFYSPPKSLKPKKGVFCFLI   90 (113)
Q Consensus        51 ~~~WqkcRL~Lrk~~~g~~LEfy~PPKsskPK~~i~Cs~I   90 (113)
                      ...|++.=.+|+.    -.|-+|..++.++|+-.|+....
T Consensus        17 ~k~WkkrwfvL~~----~~L~yyk~~~~~~~~~~I~L~~~   52 (96)
T cd01260          17 GQKWARRWFVLKG----TTLYWYRSKQDEKAEGLIFLSGF   52 (96)
T ss_pred             ccCceeEEEEEEC----CEEEEECCCCCCccceEEEccCC
Confidence            4589998888873    57889999988999988876653


No 18 
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain. Akt pleckstrin homology (PH) domain.  Akt (Protein Kinase B (PKB)) is a phosphatidylinositol 3'-kinase (PI3K)-dependent Ser/Thr kinase. The PH domain recruits Akt to the plasma membrane by binding to phosphoinositides (PtdIns-3,4-P2) and is required for activation. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=49.75  E-value=80  Score=21.41  Aligned_cols=69  Identities=16%  Similarity=0.144  Sum_probs=39.9

Q ss_pred             eEeeeeeeeccCCCCCcccccceeeeEEEecCCeeeEEecCCCCCCCcccccccceeehhccCCccCCCC-CCeeEEe
Q psy1045          35 RKEGIVNYLVGENTDGTQKWEKCRLALVKTVGGYMLEFYSPPKSLKPKKGVFCFLITEARETSALEMPDH-ENTFVLK  111 (113)
Q Consensus        35 ~rEG~l~yl~~~~~~~~~~WqkcRL~Lrk~~~g~~LEfy~PPKsskPK~~i~Cs~I~EVR~tt~LEMPD~-~nTFVLK  111 (113)
                      ++||.|.=-.+    .-..|.++-.+|+.  +|.++=+++-|+ +.++..++... ..|+.|+..+..++ .|.|-+.
T Consensus         2 ~k~G~L~K~g~----~~~~Wk~R~f~L~~--~~~l~~yk~~~~-~~~~~~i~l~~-~~v~~~~~~~~~~~~~~~F~i~   71 (102)
T cd01241           2 VKEGWLHKRGE----YIKTWRPRYFLLKS--DGSFIGYKEKPE-DGDPFLPPLNN-FSVAECQLMKTERPRPNTFIIR   71 (102)
T ss_pred             cEEEEEEeecC----CCCCCeeEEEEEeC--CCeEEEEecCCC-ccCccccccCC-eEEeeeeeeeccCCCcceEEEE
Confidence            47777753322    35689888888874  244555667664 34444555444 35666665444333 4777664


No 19 
>COG0516 GuaB IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism]
Probab=48.46  E-value=7  Score=29.04  Aligned_cols=14  Identities=71%  Similarity=0.921  Sum_probs=12.4

Q ss_pred             Chhhhhhhcccccc
Q psy1045           1 MAIAMALCGGIGRI   14 (113)
Q Consensus         1 ~~~~~~~~~~~~~~   14 (113)
                      ||||||-=||||-|
T Consensus        63 mAi~ma~~GGIGVi   76 (170)
T COG0516          63 MAIAMARDGGIGVM   76 (170)
T ss_pred             HhHHHHHcCCeEEE
Confidence            78999999999944


No 20 
>PF00478 IMPDH:  IMP dehydrogenase / GMP reductase domain;  InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase. These enzymes adopt a TIM barrel structure. IMP dehydrogenase (1.1.1.205 from EC) (IMPDH) catalyzes the rate-limiting reaction of de novo GTP biosynthesis, the NAD-dependent reduction of IMP into XMP [].  Inosine 5-phosphate + NAD+ + H2O = xanthosine 5-phosphate + NADH  IMP dehydrogenase is associated with cell proliferation and is a possible target for cancer chemotherapy. Mammalian and bacterial IMPDHs are tetramers of identical chains. There are two IMP dehydrogenase isozymes in humans []. IMP dehydrogenase nearly always contains a long insertion that has two CBS domains within it. GMP reductase (1.7.1.7 from EC) catalyzes the irreversible and NADPH-dependent reductive deamination of GMP into IMP [].  NADPH + guanosine 5-phosphate = NADP+ + inosine 5-phosphate + NH3  It converts nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and maintains intracellular balance of A and G nucleotides.; GO: 0003824 catalytic activity, 0055114 oxidation-reduction process; PDB: 3FFS_D 1VRD_A 1JCN_B 1EEP_B 3TSB_B 3USB_B 3TSD_A 4FF0_A 4FEZ_A 3KHJ_D ....
Probab=41.70  E-value=9.2  Score=32.67  Aligned_cols=16  Identities=63%  Similarity=0.866  Sum_probs=14.3

Q ss_pred             Chhhhhhhcccccccc
Q psy1045           1 MAIAMALCGGIGRIKN   16 (113)
Q Consensus         1 ~~~~~~~~~~~~~~~~   16 (113)
                      ||||||..||+|-|-.
T Consensus        53 mAiama~~Gglgvih~   68 (352)
T PF00478_consen   53 MAIAMARLGGLGVIHR   68 (352)
T ss_dssp             HHHHHHHTTSEEEEES
T ss_pred             HHHHHHHhcCCceecC
Confidence            7999999999998754


No 21 
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain. Cytohesin Pleckstrin homology (PH) domain. Cytohesin is an ARF-Guanine nucleotide Exchange Factor (GEF), which has a Sec7-type Arf-GEFdomain and a pleckstrin homology domain. It specifically binds phosphatidylinositol-3,4,5-trisphosphate (PtdIns(3,4, 5)P3) via its PH domain and it acts as a PI 3-kinase effector mediating biological responses such as cell adhesion and membrane trafficking.  PH domains are only found in eukaryotes. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=32.14  E-value=1.7e+02  Score=20.16  Aligned_cols=47  Identities=15%  Similarity=0.249  Sum_probs=34.2

Q ss_pred             EeeeeeeeccCCCCCcccccceeeeEEEecCCeeeEEecCCCCCCCcccccccce
Q psy1045          36 KEGIVNYLVGENTDGTQKWEKCRLALVKTVGGYMLEFYSPPKSLKPKKGVFCFLI   90 (113)
Q Consensus        36 rEG~l~yl~~~~~~~~~~WqkcRL~Lrk~~~g~~LEfy~PPKsskPK~~i~Cs~I   90 (113)
                      |||.|.--.+    .-..|++.-.+|..    ..|-+|.-++..+|+-.|+...+
T Consensus         2 k~G~L~K~~~----~~~~WkkRwfvL~~----~~L~yyk~~~~~~~~g~I~L~~~   48 (125)
T cd01252           2 REGWLLKQGG----RVKTWKRRWFILTD----NCLYYFEYTTDKEPRGIIPLENV   48 (125)
T ss_pred             cEEEEEEeCC----CCCCeEeEEEEEEC----CEEEEEcCCCCCCceEEEECCCc
Confidence            5676653322    23679998888863    46899998888999998888753


No 22 
>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain. Son of Sevenless (SOS) Pleckstrin homology (PH) domain. SOS is a Ras guanine nucleotide exchange factor. It has a RhoGEF (DbH) domain, a PH domain, and a RasGEF domain.  The SOS PH domain can bind to inositol 1,4,5-triphosphate. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=30.64  E-value=88  Score=22.56  Aligned_cols=14  Identities=21%  Similarity=0.150  Sum_probs=10.9

Q ss_pred             eeeEeeeeeeeccC
Q psy1045          33 ECRKEGIVNYLVGE   46 (113)
Q Consensus        33 e~~rEG~l~yl~~~   46 (113)
                      |+++||.|.-+...
T Consensus         3 elI~EG~L~ki~~~   16 (112)
T cd01261           3 EFIMEGTLTRVGPS   16 (112)
T ss_pred             cccccCcEEEEecc
Confidence            78899999877643


No 23 
>cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins. This subfamily contains the N-terminal, non-catalytic, domain of Burkholderia sp. NF100 MhqB and similar proteins. MhqB is a type I extradiol dioxygenase involved in the catabolism of methylhydroquinone, an intermediate in the degradation of fenitrothion. The purified enzyme has shown extradiol ring cleavage activity toward 3-methylcatechol. Fe2+ was suggested as a cofactor, the same as most other enzymes in the family. Burkholderia sp. NF100 MhqB is encoded on the plasmid pNF1. The type I family of extradiol dioxygenases contains two structurally homologous barrel-shaped domains at the N- and C-terminal. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism.
Probab=30.23  E-value=59  Score=21.01  Aligned_cols=21  Identities=19%  Similarity=0.188  Sum_probs=16.6

Q ss_pred             eeeEEEecCCeeeEEecCCCC
Q psy1045          58 RLALVKTVGGYMLEFYSPPKS   78 (113)
Q Consensus        58 RL~Lrk~~~g~~LEfy~PPKs   78 (113)
                      +.+-.....|..+||+.++||
T Consensus        92 ~~~~~~DP~Gn~iel~~~~~~  112 (112)
T cd08344          92 DGVWFRDPDGNLLQVKVAEKS  112 (112)
T ss_pred             CEEEEECCCCCEEEEecCCCC
Confidence            345566678999999999986


No 24 
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated
Probab=28.81  E-value=21  Score=31.26  Aligned_cols=16  Identities=31%  Similarity=0.372  Sum_probs=14.6

Q ss_pred             Chhhhhhhcccccccc
Q psy1045           1 MAIAMALCGGIGRIKN   16 (113)
Q Consensus         1 ~~~~~~~~~~~~~~~~   16 (113)
                      |||+||..||||-|..
T Consensus        60 MAiaLAr~GGiGvih~   75 (479)
T PRK07807         60 MAETVARRGGLVVLPQ   75 (479)
T ss_pred             HHHHHHHCCCceEeeC
Confidence            7999999999999874


No 25 
>PF07776 zf-AD:  Zinc-finger associated domain (zf-AD)  ;  InterPro: IPR012934 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The zf-AD domain, also known as ZAD, forms an atypical treble-cleft-like zinc co-ordinating fold. The zf-AD domain is thought to be involved in mediating dimer formation, but does not bind to DNA [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005634 nucleus; PDB: 1PZW_A.
Probab=28.69  E-value=16  Score=21.76  Aligned_cols=38  Identities=16%  Similarity=0.379  Sum_probs=16.4

Q ss_pred             eeeeEEEecCCeeeEEecCCCCCCCcccccccceeehhccCCccCCC
Q psy1045          57 CRLALVKTVGGYMLEFYSPPKSLKPKKGVFCFLITEARETSALEMPD  103 (113)
Q Consensus        57 cRL~Lrk~~~g~~LEfy~PPKsskPK~~i~Cs~I~EVR~tt~LEMPD  103 (113)
                      ||+++ ....+-...+|....+.        .....+..++.+++.+
T Consensus         2 CRlCl-~~~~~~~~~i~~~~~~~--------~l~~~i~~~~~~~i~~   39 (75)
T PF07776_consen    2 CRLCL-SESNENLVSIFDSSEES--------SLAEMIEECTGIQISP   39 (75)
T ss_dssp             -TTT----SSTTEEESS-SS-S---------SHHHHHHHH-SS---S
T ss_pred             cccCC-CCCCCCcccCcCCcchh--------HHHHHHHHHhCCcCcC
Confidence            88888 44455666777766443        4445555556665543


No 26 
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain. Outspread Pleckstrin homology (PH) domain. Outspread contains two PH domains and a C-terminal coiled-coil region. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPAses, adaptors, a well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=26.62  E-value=1.5e+02  Score=20.96  Aligned_cols=60  Identities=10%  Similarity=0.218  Sum_probs=37.0

Q ss_pred             CcccccceeeeEEEecCCeeeEEe-cCCCCCCCcccccccceeehhccC-------CccCCCCCCeeEEee
Q psy1045          50 GTQKWEKCRLALVKTVGGYMLEFY-SPPKSLKPKKGVFCFLITEARETS-------ALEMPDHENTFVLKG  112 (113)
Q Consensus        50 ~~~~WqkcRL~Lrk~~~g~~LEfy-~PPKsskPK~~i~Cs~I~EVR~tt-------~LEMPD~~nTFVLKv  112 (113)
                      .-..|+|==.+|+.   +..|.+| +.|..++|+=.|+.+...+|....       .+++--++.||.|+.
T Consensus        20 ~~K~WkrRWFvL~~---~~~L~y~~d~~~~~~p~G~IdL~~~~~V~~~~~~~~~~~~f~I~tp~R~f~l~A   87 (104)
T cd01236          20 RSKRWQRRWFILYD---HGLLTYALDEMPTTLPQGTIDMNQCTDVVDAEARTGQKFSICILTPDKEHFIKA   87 (104)
T ss_pred             eeccccceEEEEeC---CCEEEEeeCCCCCcccceEEEccceEEEeecccccCCccEEEEECCCceEEEEe
Confidence            35678664466663   3467777 444568999888888888877432       244444445555543


No 27 
>PF06590 PerB:  PerB protein;  InterPro: IPR009513 This family consists of several PerB or BfpV proteins found specifically in Escherichia coli. PerB is thought to play a role in regulating the expression of BfpA [].
Probab=26.12  E-value=41  Score=25.25  Aligned_cols=13  Identities=31%  Similarity=0.738  Sum_probs=11.1

Q ss_pred             CeeeEEecCCCCC
Q psy1045          67 GYMLEFYSPPKSL   79 (113)
Q Consensus        67 g~~LEfy~PPKss   79 (113)
                      .-++-||.|||+|
T Consensus        38 seiiv~fippkas   50 (129)
T PF06590_consen   38 SEIIVFFIPPKAS   50 (129)
T ss_pred             ceEEEEEeCCCCc
Confidence            4677899999998


No 28 
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain. RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain. This protein has a domain architecture of SH2-SH3-SH2-PH-C2-Ras_GAP. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPAses, adaptors, a well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=23.81  E-value=1.1e+02  Score=21.53  Aligned_cols=44  Identities=20%  Similarity=0.112  Sum_probs=31.8

Q ss_pred             cccccceeeeEEEecCCeeeEEecCCCCCCCcccccccceeehhc
Q psy1045          51 TQKWEKCRLALVKTVGGYMLEFYSPPKSLKPKKGVFCFLITEARE   95 (113)
Q Consensus        51 ~~~WqkcRL~Lrk~~~g~~LEfy~PPKsskPK~~i~Cs~I~EVR~   95 (113)
                      ...|.+-...|...+..-.|-+|.++++.+|+--|+...+ .||.
T Consensus        13 ~K~wK~rwF~l~~~~s~~~l~yf~~~~~~~p~gli~l~~~-~V~~   56 (98)
T cd01245          13 TKLWKTLYFALILDGSRSHESLLSSPKKTKPIGLIDLSDA-YLYP   56 (98)
T ss_pred             ccccceeEEEEecCCCCceEEEEcCCCCCCccceeecccc-EEEE
Confidence            5678887788864445688889999999999866555544 4444


No 29 
>PF15360 Apelin:  APJ endogenous ligand
Probab=22.50  E-value=51  Score=21.98  Aligned_cols=27  Identities=30%  Similarity=0.463  Sum_probs=19.3

Q ss_pred             EeeeeeeeccCCC--CCcccccceeeeEE
Q psy1045          36 KEGIVNYLVGENT--DGTQKWEKCRLALV   62 (113)
Q Consensus        36 rEG~l~yl~~~~~--~~~~~WqkcRL~Lr   62 (113)
                      .||.++||+....  .+...||..|--.|
T Consensus        13 EEg~vr~lvqp~~~R~g~g~~qgg~rkfR   41 (55)
T PF15360_consen   13 EEGNVRHLVQPRGSRNGPGPWQGGRRKFR   41 (55)
T ss_pred             ccccceeeccccCCCCCCCCCccchhhhh
Confidence            6899999977544  46678887764433


No 30 
>TIGR00068 glyox_I lactoylglutathione lyase. Glyoxylase I is a homodimer in many species. In some eukaryotes, including yeasts and plants, the orthologous protein carries a tandem duplication, is twice as long, and hits this model twice.
Probab=22.13  E-value=99  Score=21.29  Aligned_cols=27  Identities=19%  Similarity=0.306  Sum_probs=20.7

Q ss_pred             cceeeeEEEecCCeeeEEecCCCCCCC
Q psy1045          55 EKCRLALVKTVGGYMLEFYSPPKSLKP   81 (113)
Q Consensus        55 qkcRL~Lrk~~~g~~LEfy~PPKsskP   81 (113)
                      ...+....+...|+.+||+.+++..+|
T Consensus       121 ~~~~~~~~~DPdG~~iel~~~~~~~~~  147 (150)
T TIGR00068       121 GTTVIAFVEDPDGYKIELIQRKSTKDG  147 (150)
T ss_pred             CceEEEEEECCCCCEEEEEECCchhhh
Confidence            345677777788999999998876554


No 31 
>PRK10291 glyoxalase I; Provisional
Probab=21.91  E-value=1.2e+02  Score=19.97  Aligned_cols=26  Identities=23%  Similarity=0.354  Sum_probs=20.1

Q ss_pred             cccceeeeEEEecCCeeeEEecCCCC
Q psy1045          53 KWEKCRLALVKTVGGYMLEFYSPPKS   78 (113)
Q Consensus        53 ~WqkcRL~Lrk~~~g~~LEfy~PPKs   78 (113)
                      .|...+.+..+...|+.+||+.+.++
T Consensus        98 ~~~~~~~~~i~DPdG~~iel~~~~~~  123 (129)
T PRK10291         98 KGGTTVIAFVEDPDGYKIELIEEKDA  123 (129)
T ss_pred             CCCceEEEEEECCCCCEEEEEEcccc
Confidence            36666777777788999999998753


No 32 
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated
Probab=21.60  E-value=35  Score=30.13  Aligned_cols=15  Identities=53%  Similarity=0.600  Sum_probs=13.1

Q ss_pred             Chhhhhhhccccccc
Q psy1045           1 MAIAMALCGGIGRIK   15 (113)
Q Consensus         1 ~~~~~~~~~~~~~~~   15 (113)
                      ||||||..||+|-|.
T Consensus        67 lAiala~~gG~g~Ih   81 (502)
T PRK07107         67 MAIALAREGGLSFIF   81 (502)
T ss_pred             HHHHHHHcCCCeEee
Confidence            799999999999643


No 33 
>PF04283 CheF-arch:  Chemotaxis signal transduction system protein F from archaea;  InterPro: IPR007381 This is an archaeal protein of unknown function.
Probab=20.58  E-value=1.2e+02  Score=24.18  Aligned_cols=39  Identities=21%  Similarity=0.125  Sum_probs=27.0

Q ss_pred             CcccccceeeeEEEecCCeeeEEecCCCCCCCcccccccceeehhcc
Q psy1045          50 GTQKWEKCRLALVKTVGGYMLEFYSPPKSLKPKKGVFCFLITEARET   96 (113)
Q Consensus        50 ~~~~WqkcRL~Lrk~~~g~~LEfy~PPKsskPK~~i~Cs~I~EVR~t   96 (113)
                      ....|.+||.+|-..    .|.|-..+    -|..|+.+.|.+|.--
T Consensus        21 ~d~~W~~~rIiLs~~----rlvl~~~~----~k~~Ipls~I~Di~~~   59 (221)
T PF04283_consen   21 PDGKWVKGRIILSND----RLVLAFND----GKITIPLSSIEDIGVR   59 (221)
T ss_pred             ccCCcEEEEEEEecC----EEEEEcCC----CeEEEecceeEecccc
Confidence            458999999999752    23333322    3569999999988653


No 34 
>cd01264 PH_melted Melted pleckstrin homology (PH) domain. Melted pleckstrin homology (PH) domain. The melted protein has a C-terminal PH domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=20.41  E-value=1.3e+02  Score=21.27  Aligned_cols=46  Identities=22%  Similarity=0.278  Sum_probs=31.5

Q ss_pred             CeeeEEecCCCCCCCc-ccccccceeehhccC----------CccCCCCCCeeEEee
Q psy1045          67 GYMLEFYSPPKSLKPK-KGVFCFLITEARETS----------ALEMPDHENTFVLKG  112 (113)
Q Consensus        67 g~~LEfy~PPKsskPK-~~i~Cs~I~EVR~tt----------~LEMPD~~nTFVLKv  112 (113)
                      |..|.+|.-....+|. -.|..+.+..|+.+.          .+|+-.++-||.|++
T Consensus        28 ~~~L~y~K~~~~~~~~~g~IdL~~~~sVk~~~~~~~~~~~~~~Fei~tp~rt~~l~A   84 (101)
T cd01264          28 GAQLLFQKGKSKDDPDDCSIDLSKIRSVKAVAKKRRDRSLPKAFEIFTADKTYILKA   84 (101)
T ss_pred             CCEEEEEeccCccCCCCceEEcccceEEeeccccccccccCcEEEEEcCCceEEEEe
Confidence            4446677554333444 689988888887753          567777778888875


Done!