Diaphorina citri psyllid: psy10450


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MKIELGREEDEDKVFKSFKFLTLKVSPFPLPSQVETIGDAYMVVSGLPERNGDNHAREISRMALAILEAVQSFSIQHKPDAQLKSGMIEFPHHPKLIRDERALSSSQISPG
ccccccHHHHHHHHHHHHHHHHHccccccccccEEECccEEEEEcccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEEEcccccccEEEcccccccccccccc
****LGREEDEDKVFKSFKFLTLKVSPFPLPSQVETIGDAYMVVSGLPERNGDNHAREISRMALAILEAVQSFSIQHKPDAQLKSGMIEFPHHPKLIRDER**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIELGREEDEDKVFKSFKFLTLKVSPFPLPSQVETIGDAYMVVSGLPERNGDNHAREISRMALAILEAVQSFSIQHKPDAQLKSGMIEFPHHPKLIRDERALSSSQISPG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Atrial natriuretic peptide receptor 1 Receptor for the atrial natriuretic peptide NPPA/ANP and the brain natriuretic peptide NPPB/BNP which are potent vasoactive hormones playing a key role in cardiovascular homeostasis. Has guanylate cyclase activity upon binding of the ligand.confidentP18293
Atrial natriuretic peptide receptor 2 Receptor for the C-type natriuretic peptide NPPC/CNP hormone. Has guanylate cyclase activity upon binding of its ligand. May play a role in the regulation of skeletal growth.confidentP20594
Atrial natriuretic peptide receptor 1 Receptor for the atrial natriuretic peptide NPPA/ANP and the brain natriuretic peptide NPPB/BNP which are potent vasoactive hormones playing a key role in cardiovascular homeostasis. Has guanylate cyclase activity upon binding of the ligand.confidentP18910

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007165 [BP]signal transductionconfidentGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0003674 [MF]molecular_functionconfident
GO:0035556 [BP]intracellular signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0017046 [MF]peptide hormone bindingprobableGO:0033218, GO:0003674, GO:0042277, GO:0042562, GO:0005488
GO:0008217 [BP]regulation of blood pressureprobableGO:0032501, GO:0044707, GO:0008015, GO:0003013, GO:0008150, GO:0065007, GO:0065008, GO:0044699, GO:0003008
GO:0004383 [MF]guanylate cyclase activityprobableGO:0009975, GO:0003824, GO:0016829, GO:0016849, GO:0003674
GO:0016941 [MF]natriuretic peptide receptor activityprobableGO:0038023, GO:0060089, GO:0001653, GO:0003674, GO:0004872, GO:0004871
GO:0007168 [BP]receptor guanylyl cyclase signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007154, GO:0050789, GO:0044699
GO:0005525 [MF]GTP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0006182 [BP]cGMP biosynthetic processprobableGO:0009187, GO:0044249, GO:0034641, GO:0009165, GO:0044237, GO:0072521, GO:0072522, GO:1901362, GO:0046068, GO:1901360, GO:1901576, GO:0044710, GO:0052652, GO:0009259, GO:0008150, GO:0071704, GO:0009190, GO:0018130, GO:0009987, GO:0006139, GO:0006793, GO:0006725, GO:0009152, GO:0009150, GO:0009260, GO:0009058, GO:0009117, GO:0008152, GO:0034654, GO:1901564, GO:0090407, GO:0055086, GO:0046483, GO:0044238, GO:0044271, GO:1901566, GO:1901137, GO:1901135, GO:0046390, GO:0019693, GO:0006163, GO:0006796, GO:0006807, GO:1901293, GO:0006164, GO:0019637, GO:0019438, GO:0006753, GO:0044281
GO:0001503 [BP]ossificationprobableGO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0008188 [MF]neuropeptide receptor activityprobableGO:0008528, GO:0004930, GO:0030594, GO:0038023, GO:0060089, GO:0004888, GO:0001653, GO:0003674, GO:0004872, GO:0004871
GO:0031513 [CC]nonmotile primary ciliumprobableGO:0072372, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0009897 [CC]external side of plasma membraneprobableGO:0009986, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0060348 [BP]bone developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0001501, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0006468 [BP]protein phosphorylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0015643 [MF]toxic substance bindingprobableGO:0003674, GO:0005488
GO:0003018 [BP]vascular process in circulatory systemprobableGO:0032501, GO:0044707, GO:0003013, GO:0008150, GO:0044699, GO:0003008
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0044297 [CC]cell bodyprobableGO:0005575, GO:0044464, GO:0005623
GO:0097011 [BP]cellular response to granulocyte macrophage colony-stimulating factor stimulusprobableGO:0051716, GO:0034097, GO:0071345, GO:0050896, GO:0009987, GO:0008150, GO:0071310, GO:0097012, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0004672 [MF]protein kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674
GO:0043679 [CC]axon terminusprobableGO:0044306, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995
GO:0019901 [MF]protein kinase bindingprobableGO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0090066 [BP]regulation of anatomical structure sizeprobableGO:0008150, GO:0065008, GO:0065007
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0042417 [BP]dopamine metabolic processprobableGO:0009987, GO:1901564, GO:0009712, GO:0006725, GO:0006584, GO:0044237, GO:0071704, GO:0006807, GO:0008150, GO:0008152, GO:0018958, GO:1901360, GO:1901615
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0048662 [BP]negative regulation of smooth muscle cell proliferationprobableGO:0042127, GO:0008285, GO:0048660, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0030828 [BP]positive regulation of cGMP biosynthetic processprobableGO:0019220, GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:1900371, GO:0045981, GO:0080090, GO:0010562, GO:0009891, GO:0030810, GO:0050789, GO:0065007, GO:0048518, GO:0045935, GO:0045937, GO:0019219, GO:0009889, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0051173, GO:0030799, GO:0030808, GO:0030826, GO:0030825, GO:1900542, GO:0030823, GO:1900544, GO:0030804, GO:0030801, GO:1900373, GO:0030802, GO:0006140, GO:0048522

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UVJ, chain A
Confidence level:very confident
Coverage over the Query: 9-110
View the alignment between query and template
View the model in PyMOL