Query psy10455
Match_columns 99
No_of_seqs 31 out of 33
Neff 2.8
Searched_HMMs 46136
Date Fri Aug 16 18:38:56 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy10455.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10455hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PF08074 CHDCT2: CHDCT2 (NUC03 99.9 5.2E-24 1.1E-28 161.7 1.7 60 1-60 93-154 (173)
2 PF13846 DUF4196: Domain of un 56.5 3.8 8.2E-05 30.1 0.1 13 82-94 53-65 (112)
3 PF06587 DUF1137: Protein of u 49.6 7.3 0.00016 30.0 0.7 21 77-97 44-65 (159)
4 PF08060 NOSIC: NOSIC (NUC001) 29.2 25 0.00055 21.5 0.6 18 4-21 28-45 (53)
5 PF09598 Stm1_N: Stm1; InterP 23.4 31 0.00067 22.8 0.3 19 42-60 4-23 (68)
6 PF00806 PUF: Pumilio-family R 21.2 73 0.0016 17.0 1.5 16 24-39 8-23 (35)
7 KOG2616|consensus 21.2 49 0.0011 27.4 1.1 39 10-48 195-240 (266)
8 KOG0868|consensus 19.0 50 0.0011 26.6 0.7 12 74-85 53-64 (217)
9 PF11973 NQRA_SLBB: NQRA C-ter 14.0 36 0.00078 21.2 -1.0 35 24-58 3-42 (51)
10 smart00025 Pumilio Pumilio-lik 13.3 1.3E+02 0.0027 15.0 1.2 15 25-39 9-23 (36)
No 1
>PF08074 CHDCT2: CHDCT2 (NUC038) domain; InterPro: IPR012957 The CHDCT2 C-terminal domain is found in PHD/RING fingers and chromo domain-associated CHD-like helicases [].; GO: 0003677 DNA binding, 0005524 ATP binding, 0008270 zinc ion binding, 0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=99.88 E-value=5.2e-24 Score=161.70 Aligned_cols=60 Identities=68% Similarity=0.908 Sum_probs=57.8
Q ss_pred CccccccchhhhhhhhcchhhhhhhcCCCCchhhhHHHH--HHhhhcccccchhhhhcccCC
Q psy10455 1 MSLNARFGEVECLAESHQHLSKESLAGNKPANAVLHKVV--AEEVLDDEDEDDDRSKRRSRG 60 (99)
Q Consensus 1 ~~L~~rFaelEclA~sh~~l~kes~aGnk~an~vLhKvL--lEeLLdDEKdDvdRlps~~~~ 60 (99)
|+||+||+++||+|+|||||++||++||+|||+|||||| |||||+|||.|+.|+|+..++
T Consensus 93 ~~L~~~fae~e~laeshq~l~kes~~gnk~a~~vl~kvL~qleelLsDMKaDV~RLPatlsr 154 (173)
T PF08074_consen 93 MALNARFAELECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKADVTRLPATLSR 154 (173)
T ss_pred HHHhhhhhhhhhccchhhhcchhhhCCCCCccHHHHHHHHHHHHHHHHhhccccccCccccc
Confidence 689999999999999999999999999999999999999 999999999999999998754
No 2
>PF13846 DUF4196: Domain of unknown function (DUF4196)
Probab=56.49 E-value=3.8 Score=30.06 Aligned_cols=13 Identities=62% Similarity=0.647 Sum_probs=11.1
Q ss_pred eeeeecccccCCc
Q psy10455 82 LKIKLGKRKQASS 94 (99)
Q Consensus 82 lkiklgkrkr~ss 94 (99)
=-||.|||||.||
T Consensus 53 E~Ik~gkRkr~SS 65 (112)
T PF13846_consen 53 EHIKRGKRKRLSS 65 (112)
T ss_pred hhhcccccceeee
Confidence 3589999999887
No 3
>PF06587 DUF1137: Protein of unknown function (DUF1137); InterPro: IPR010564 This family consists of several hypothetical proteins specific to Chlamydia species. The function of this family is unknown.
Probab=49.65 E-value=7.3 Score=30.00 Aligned_cols=21 Identities=52% Similarity=0.586 Sum_probs=16.6
Q ss_pred CCCCceeee-ecccccCCcccc
Q psy10455 77 SKVPTLKIK-LGKRKQASSITD 97 (99)
Q Consensus 77 ~kvptlkik-lgkrkr~ss~~~ 97 (99)
.--|-|||| ||-|||--|.++
T Consensus 44 ~~PPFLKIKKlgv~K~I~Spe~ 65 (159)
T PF06587_consen 44 KAPPFLKIKKLGVRKQICSPEQ 65 (159)
T ss_pred CCCCceEeeeccceeeecChHH
Confidence 344679999 999999887664
No 4
>PF08060 NOSIC: NOSIC (NUC001) domain; InterPro: IPR012976 This is the central domain in Nop56/SIK1-like proteins [].; PDB: 3PLA_K 3ICX_B 3ID6_A 3ID5_E 3NVM_A 3NMU_B 2NNW_C 3NVI_A 3NVK_A 2OZB_E ....
Probab=29.22 E-value=25 Score=21.52 Aligned_cols=18 Identities=22% Similarity=0.287 Sum_probs=13.0
Q ss_pred ccccchhhhhhhhcchhh
Q psy10455 4 NARFGEVECLAESHQHLS 21 (99)
Q Consensus 4 ~~rFaelEclA~sh~~l~ 21 (99)
+.||.|||.|...+..-.
T Consensus 28 ~~~FPEL~~lv~~~~~Y~ 45 (53)
T PF08060_consen 28 SWHFPELESLVPNPIDYA 45 (53)
T ss_dssp TTTSTTHHHHS-SHHHHH
T ss_pred HccchhHHHHcCCHHHHH
Confidence 569999999988765443
No 5
>PF09598 Stm1_N: Stm1; InterPro: IPR019084 This domain is found at the N-terminal region of the Stm1 protein. Stm1 is a G4 quadraplex and purine motif triplex nucleic acid-binding protein. It has been implicated in many biological processes including apoptosis and telomere biosynthesis. Stm1 is known to interact with CDC13 [], and is known to associate with ribosomes and nuclear telomere cap complexes []. ; PDB: 3U5G_h 3U5C_h.
Probab=23.38 E-value=31 Score=22.80 Aligned_cols=19 Identities=11% Similarity=0.349 Sum_probs=0.6
Q ss_pred hhhccc-ccchhhhhcccCC
Q psy10455 42 EVLDDE-DEDDDRSKRRSRG 60 (99)
Q Consensus 42 eLLdDE-KdDvdRlps~~~~ 60 (99)
+||-|. ++|.++++..+-+
T Consensus 4 dLLGnD~e~Dp~~~~~~p~k 23 (68)
T PF09598_consen 4 DLLGNDDEDDPSQLPAPPTK 23 (68)
T ss_dssp -----------------S--
T ss_pred hhcCCCcccCcccccCccch
Confidence 577666 5577788766643
No 6
>PF00806 PUF: Pumilio-family RNA binding repeat; InterPro: IPR001313 The drosophila pumilio gene codes for an unusual protein that binds through the Puf domain that usually occurs as a tandem repeat of eight domains. The FBF-2 protein of Caenorhabditis elegans also has a Puf domain. Both proteins function as translational repressors in early embryonic development by binding sequences in the 3' UTR of target mRNAs [, ]. The same type of repetitive domain has been found in in a number of other proteins from all eukaryotic kingdoms. The Puf proteins characterised to date have been reported to bind to 3'-untranslated region (UTR) sequences encompassing a so-called UGUR tetranucleotide motif and thereby to repress gene expression by affecting mRNA translation or stability. In Saccharomyces cerevisiae (Baker's yeast), five proteins, termed Puf1p to Puf5p, bear six to eight Puf repeats []. Puf3p binds nearly exclusively to cytoplasmic mRNAs that encode mitochondrial proteins; Puf1p and Puf2p interact preferentially with mRNAs encoding membrane-associated proteins; Puf4p preferentially binds mRNAs encoding nucleolar ribosomal RNA-processing factors; and Puf5p is associated with mRNAs encoding chromatin modifiers and components of the spindle pole body. This suggests the existence of an extensive network of RNA-protein interactions that coordinate the post-transcriptional fate of large sets of cytotopically and functionally related RNAs through each stage of its lifecycle.; GO: 0003723 RNA binding; PDB: 3BX2_A 4DZS_B 3BX3_B 3BWT_A 3GVT_B 3GVO_A 1IB2_A 3Q0N_A 2YJY_A 1M8Z_A ....
Probab=21.25 E-value=73 Score=17.03 Aligned_cols=16 Identities=25% Similarity=0.382 Sum_probs=13.5
Q ss_pred hhcCCCCchhhhHHHH
Q psy10455 24 SLAGNKPANAVLHKVV 39 (99)
Q Consensus 24 s~aGnk~an~vLhKvL 39 (99)
.++-|+.+|-|+.|+|
T Consensus 8 ~l~~d~~Gn~VvQk~l 23 (35)
T PF00806_consen 8 ELSKDQYGNYVVQKCL 23 (35)
T ss_dssp HHHTSTTHHHHHHHHH
T ss_pred HHHhccccCHHHHHHH
Confidence 4566899999999998
No 7
>KOG2616|consensus
Probab=21.24 E-value=49 Score=27.39 Aligned_cols=39 Identities=18% Similarity=0.199 Sum_probs=30.7
Q ss_pred hhhhhhhcchhhhhhhc-------CCCCchhhhHHHHHHhhhcccc
Q psy10455 10 VECLAESHQHLSKESLA-------GNKPANAVLHKVVAEEVLDDED 48 (99)
Q Consensus 10 lEclA~sh~~l~kes~a-------Gnk~an~vLhKvLlEeLLdDEK 48 (99)
.=||+++|-.=+.++.+ |+-++++.+|+.+++.|+..++
T Consensus 195 ~i~lstAh~aKFa~AV~~Al~~~~s~yn~~~~~h~~~l~~l~~~ek 240 (266)
T KOG2616|consen 195 YICLSTAHPAKFAEAVNAALSTPESPYNFVALVHPEELCTLMRREK 240 (266)
T ss_pred eEEecccChhhhhHHHHHHhcCCCCCccccchhcHHHHHHHHhhhh
Confidence 34888888887777643 5668899999999999988763
No 8
>KOG0868|consensus
Probab=18.96 E-value=50 Score=26.64 Aligned_cols=12 Identities=50% Similarity=0.645 Sum_probs=9.5
Q ss_pred CCCCCCCceeee
Q psy10455 74 ASTSKVPTLKIK 85 (99)
Q Consensus 74 ~~~~kvptlkik 85 (99)
.|..|||||+|-
T Consensus 53 NPm~kVP~L~i~ 64 (217)
T KOG0868|consen 53 NPMEKVPTLVID 64 (217)
T ss_pred CchhhCCeEEEC
Confidence 457789999984
No 9
>PF11973 NQRA_SLBB: NQRA C-terminal domain; InterPro: IPR022615 This domain is found in bacterial Na(+)-translocating NADH-quinone reductase subunit A (NQRA) proteins. The Na(+)-translocating NADH: ubiquinone oxidoreductase (Na(+)-NQR) generates an electrochemical Na(+) potential driven by aerobic respiration []. The function of this domain has not been characterised.; GO: 0016655 oxidoreductase activity, acting on NADH or NADPH, quinone or similar compound as acceptor, 0055114 oxidation-reduction process
Probab=13.96 E-value=36 Score=21.19 Aligned_cols=35 Identities=26% Similarity=0.280 Sum_probs=25.2
Q ss_pred hhcCCCCchhhhHHHH----HHhhhccc-ccchhhhhccc
Q psy10455 24 SLAGNKPANAVLHKVV----AEEVLDDE-DEDDDRSKRRS 58 (99)
Q Consensus 24 s~aGnk~an~vLhKvL----lEeLLdDE-KdDvdRlps~~ 58 (99)
+++|..-.|+-+-+++ +.+|+.++ ++|..|.=+..
T Consensus 3 AlaG~~v~~p~y~rt~~Ga~i~~l~~g~~~~~~~RiIsG~ 42 (51)
T PF11973_consen 3 ALAGPGVKNPRYVRTRIGASISDLLAGNLKEDNVRIISGS 42 (51)
T ss_pred EecCccCCcccEEEEeCCcCHHHHhCcccCCCCcEEEEcC
Confidence 4677777777777777 99999998 66666654443
No 10
>smart00025 Pumilio Pumilio-like repeats. Pumilio-like repeats that bind RNA.
Probab=13.26 E-value=1.3e+02 Score=15.03 Aligned_cols=15 Identities=27% Similarity=0.479 Sum_probs=12.7
Q ss_pred hcCCCCchhhhHHHH
Q psy10455 25 LAGNKPANAVLHKVV 39 (99)
Q Consensus 25 ~aGnk~an~vLhKvL 39 (99)
++-++.+|.|+.|+|
T Consensus 9 l~~~~~g~~viqk~l 23 (36)
T smart00025 9 LSKDQYGNRVVQKLL 23 (36)
T ss_pred HHhcchhhHHHHHHH
Confidence 456788999999998
Done!