Query         psy10455
Match_columns 99
No_of_seqs    31 out of 33
Neff          2.8 
Searched_HMMs 46136
Date          Fri Aug 16 18:38:56 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10455.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10455hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF08074 CHDCT2:  CHDCT2 (NUC03  99.9 5.2E-24 1.1E-28  161.7   1.7   60    1-60     93-154 (173)
  2 PF13846 DUF4196:  Domain of un  56.5     3.8 8.2E-05   30.1   0.1   13   82-94     53-65  (112)
  3 PF06587 DUF1137:  Protein of u  49.6     7.3 0.00016   30.0   0.7   21   77-97     44-65  (159)
  4 PF08060 NOSIC:  NOSIC (NUC001)  29.2      25 0.00055   21.5   0.6   18    4-21     28-45  (53)
  5 PF09598 Stm1_N:  Stm1;  InterP  23.4      31 0.00067   22.8   0.3   19   42-60      4-23  (68)
  6 PF00806 PUF:  Pumilio-family R  21.2      73  0.0016   17.0   1.5   16   24-39      8-23  (35)
  7 KOG2616|consensus               21.2      49  0.0011   27.4   1.1   39   10-48    195-240 (266)
  8 KOG0868|consensus               19.0      50  0.0011   26.6   0.7   12   74-85     53-64  (217)
  9 PF11973 NQRA_SLBB:  NQRA C-ter  14.0      36 0.00078   21.2  -1.0   35   24-58      3-42  (51)
 10 smart00025 Pumilio Pumilio-lik  13.3 1.3E+02  0.0027   15.0   1.2   15   25-39      9-23  (36)

No 1  
>PF08074 CHDCT2:  CHDCT2 (NUC038) domain;  InterPro: IPR012957 The CHDCT2 C-terminal domain is found in PHD/RING fingers and chromo domain-associated CHD-like helicases [].; GO: 0003677 DNA binding, 0005524 ATP binding, 0008270 zinc ion binding, 0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=99.88  E-value=5.2e-24  Score=161.70  Aligned_cols=60  Identities=68%  Similarity=0.908  Sum_probs=57.8

Q ss_pred             CccccccchhhhhhhhcchhhhhhhcCCCCchhhhHHHH--HHhhhcccccchhhhhcccCC
Q psy10455          1 MSLNARFGEVECLAESHQHLSKESLAGNKPANAVLHKVV--AEEVLDDEDEDDDRSKRRSRG   60 (99)
Q Consensus         1 ~~L~~rFaelEclA~sh~~l~kes~aGnk~an~vLhKvL--lEeLLdDEKdDvdRlps~~~~   60 (99)
                      |+||+||+++||+|+|||||++||++||+|||+||||||  |||||+|||.|+.|+|+..++
T Consensus        93 ~~L~~~fae~e~laeshq~l~kes~~gnk~a~~vl~kvL~qleelLsDMKaDV~RLPatlsr  154 (173)
T PF08074_consen   93 MALNARFAELECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKADVTRLPATLSR  154 (173)
T ss_pred             HHHhhhhhhhhhccchhhhcchhhhCCCCCccHHHHHHHHHHHHHHHHhhccccccCccccc
Confidence            689999999999999999999999999999999999999  999999999999999998754


No 2  
>PF13846 DUF4196:  Domain of unknown function (DUF4196)
Probab=56.49  E-value=3.8  Score=30.06  Aligned_cols=13  Identities=62%  Similarity=0.647  Sum_probs=11.1

Q ss_pred             eeeeecccccCCc
Q psy10455         82 LKIKLGKRKQASS   94 (99)
Q Consensus        82 lkiklgkrkr~ss   94 (99)
                      =-||.|||||.||
T Consensus        53 E~Ik~gkRkr~SS   65 (112)
T PF13846_consen   53 EHIKRGKRKRLSS   65 (112)
T ss_pred             hhhcccccceeee
Confidence            3589999999887


No 3  
>PF06587 DUF1137:  Protein of unknown function (DUF1137);  InterPro: IPR010564 This family consists of several hypothetical proteins specific to Chlamydia species. The function of this family is unknown.
Probab=49.65  E-value=7.3  Score=30.00  Aligned_cols=21  Identities=52%  Similarity=0.586  Sum_probs=16.6

Q ss_pred             CCCCceeee-ecccccCCcccc
Q psy10455         77 SKVPTLKIK-LGKRKQASSITD   97 (99)
Q Consensus        77 ~kvptlkik-lgkrkr~ss~~~   97 (99)
                      .--|-|||| ||-|||--|.++
T Consensus        44 ~~PPFLKIKKlgv~K~I~Spe~   65 (159)
T PF06587_consen   44 KAPPFLKIKKLGVRKQICSPEQ   65 (159)
T ss_pred             CCCCceEeeeccceeeecChHH
Confidence            344679999 999999887664


No 4  
>PF08060 NOSIC:  NOSIC (NUC001) domain;  InterPro: IPR012976 This is the central domain in Nop56/SIK1-like proteins [].; PDB: 3PLA_K 3ICX_B 3ID6_A 3ID5_E 3NVM_A 3NMU_B 2NNW_C 3NVI_A 3NVK_A 2OZB_E ....
Probab=29.22  E-value=25  Score=21.52  Aligned_cols=18  Identities=22%  Similarity=0.287  Sum_probs=13.0

Q ss_pred             ccccchhhhhhhhcchhh
Q psy10455          4 NARFGEVECLAESHQHLS   21 (99)
Q Consensus         4 ~~rFaelEclA~sh~~l~   21 (99)
                      +.||.|||.|...+..-.
T Consensus        28 ~~~FPEL~~lv~~~~~Y~   45 (53)
T PF08060_consen   28 SWHFPELESLVPNPIDYA   45 (53)
T ss_dssp             TTTSTTHHHHS-SHHHHH
T ss_pred             HccchhHHHHcCCHHHHH
Confidence            569999999988765443


No 5  
>PF09598 Stm1_N:  Stm1;  InterPro: IPR019084  This domain is found at the N-terminal region of the Stm1 protein. Stm1 is a G4 quadraplex and purine motif triplex nucleic acid-binding protein. It has been implicated in many biological processes including apoptosis and telomere biosynthesis. Stm1 is known to interact with CDC13 [], and is known to associate with ribosomes and nuclear telomere cap complexes []. ; PDB: 3U5G_h 3U5C_h.
Probab=23.38  E-value=31  Score=22.80  Aligned_cols=19  Identities=11%  Similarity=0.349  Sum_probs=0.6

Q ss_pred             hhhccc-ccchhhhhcccCC
Q psy10455         42 EVLDDE-DEDDDRSKRRSRG   60 (99)
Q Consensus        42 eLLdDE-KdDvdRlps~~~~   60 (99)
                      +||-|. ++|.++++..+-+
T Consensus         4 dLLGnD~e~Dp~~~~~~p~k   23 (68)
T PF09598_consen    4 DLLGNDDEDDPSQLPAPPTK   23 (68)
T ss_dssp             -----------------S--
T ss_pred             hhcCCCcccCcccccCccch
Confidence            577666 5577788766643


No 6  
>PF00806 PUF:  Pumilio-family RNA binding repeat;  InterPro: IPR001313 The drosophila pumilio gene codes for an unusual protein that binds through the Puf domain that usually occurs as a tandem repeat of eight domains. The FBF-2 protein of Caenorhabditis elegans also has a Puf domain. Both proteins function as translational repressors in early embryonic development by binding sequences in the 3' UTR of target mRNAs [, ]. The same type of repetitive domain has been found in in a number of other proteins from all eukaryotic kingdoms. The Puf proteins characterised to date have been reported to bind to 3'-untranslated region (UTR) sequences encompassing a so-called UGUR tetranucleotide motif and thereby to repress gene expression by affecting mRNA translation or stability.  In Saccharomyces cerevisiae (Baker's yeast), five proteins, termed Puf1p to Puf5p, bear six to eight Puf repeats []. Puf3p binds nearly exclusively to cytoplasmic mRNAs that encode mitochondrial proteins; Puf1p and Puf2p interact preferentially with mRNAs encoding membrane-associated proteins; Puf4p preferentially binds mRNAs encoding nucleolar ribosomal RNA-processing factors; and Puf5p is associated with mRNAs encoding chromatin modifiers and components of the spindle pole body. This suggests the existence of an extensive network of RNA-protein interactions that coordinate the post-transcriptional fate of large sets of cytotopically and functionally related RNAs through each stage of its lifecycle.; GO: 0003723 RNA binding; PDB: 3BX2_A 4DZS_B 3BX3_B 3BWT_A 3GVT_B 3GVO_A 1IB2_A 3Q0N_A 2YJY_A 1M8Z_A ....
Probab=21.25  E-value=73  Score=17.03  Aligned_cols=16  Identities=25%  Similarity=0.382  Sum_probs=13.5

Q ss_pred             hhcCCCCchhhhHHHH
Q psy10455         24 SLAGNKPANAVLHKVV   39 (99)
Q Consensus        24 s~aGnk~an~vLhKvL   39 (99)
                      .++-|+.+|-|+.|+|
T Consensus         8 ~l~~d~~Gn~VvQk~l   23 (35)
T PF00806_consen    8 ELSKDQYGNYVVQKCL   23 (35)
T ss_dssp             HHHTSTTHHHHHHHHH
T ss_pred             HHHhccccCHHHHHHH
Confidence            4566899999999998


No 7  
>KOG2616|consensus
Probab=21.24  E-value=49  Score=27.39  Aligned_cols=39  Identities=18%  Similarity=0.199  Sum_probs=30.7

Q ss_pred             hhhhhhhcchhhhhhhc-------CCCCchhhhHHHHHHhhhcccc
Q psy10455         10 VECLAESHQHLSKESLA-------GNKPANAVLHKVVAEEVLDDED   48 (99)
Q Consensus        10 lEclA~sh~~l~kes~a-------Gnk~an~vLhKvLlEeLLdDEK   48 (99)
                      .=||+++|-.=+.++.+       |+-++++.+|+.+++.|+..++
T Consensus       195 ~i~lstAh~aKFa~AV~~Al~~~~s~yn~~~~~h~~~l~~l~~~ek  240 (266)
T KOG2616|consen  195 YICLSTAHPAKFAEAVNAALSTPESPYNFVALVHPEELCTLMRREK  240 (266)
T ss_pred             eEEecccChhhhhHHHHHHhcCCCCCccccchhcHHHHHHHHhhhh
Confidence            34888888887777643       5668899999999999988763


No 8  
>KOG0868|consensus
Probab=18.96  E-value=50  Score=26.64  Aligned_cols=12  Identities=50%  Similarity=0.645  Sum_probs=9.5

Q ss_pred             CCCCCCCceeee
Q psy10455         74 ASTSKVPTLKIK   85 (99)
Q Consensus        74 ~~~~kvptlkik   85 (99)
                      .|..|||||+|-
T Consensus        53 NPm~kVP~L~i~   64 (217)
T KOG0868|consen   53 NPMEKVPTLVID   64 (217)
T ss_pred             CchhhCCeEEEC
Confidence            457789999984


No 9  
>PF11973 NQRA_SLBB:  NQRA C-terminal domain;  InterPro: IPR022615  This domain is found in bacterial Na(+)-translocating NADH-quinone reductase subunit A (NQRA) proteins. The Na(+)-translocating NADH: ubiquinone oxidoreductase (Na(+)-NQR) generates an electrochemical Na(+) potential driven by aerobic respiration []. The function of this domain has not been characterised.; GO: 0016655 oxidoreductase activity, acting on NADH or NADPH, quinone or similar compound as acceptor, 0055114 oxidation-reduction process
Probab=13.96  E-value=36  Score=21.19  Aligned_cols=35  Identities=26%  Similarity=0.280  Sum_probs=25.2

Q ss_pred             hhcCCCCchhhhHHHH----HHhhhccc-ccchhhhhccc
Q psy10455         24 SLAGNKPANAVLHKVV----AEEVLDDE-DEDDDRSKRRS   58 (99)
Q Consensus        24 s~aGnk~an~vLhKvL----lEeLLdDE-KdDvdRlps~~   58 (99)
                      +++|..-.|+-+-+++    +.+|+.++ ++|..|.=+..
T Consensus         3 AlaG~~v~~p~y~rt~~Ga~i~~l~~g~~~~~~~RiIsG~   42 (51)
T PF11973_consen    3 ALAGPGVKNPRYVRTRIGASISDLLAGNLKEDNVRIISGS   42 (51)
T ss_pred             EecCccCCcccEEEEeCCcCHHHHhCcccCCCCcEEEEcC
Confidence            4677777777777777    99999998 66666654443


No 10 
>smart00025 Pumilio Pumilio-like repeats. Pumilio-like repeats that bind RNA.
Probab=13.26  E-value=1.3e+02  Score=15.03  Aligned_cols=15  Identities=27%  Similarity=0.479  Sum_probs=12.7

Q ss_pred             hcCCCCchhhhHHHH
Q psy10455         25 LAGNKPANAVLHKVV   39 (99)
Q Consensus        25 ~aGnk~an~vLhKvL   39 (99)
                      ++-++.+|.|+.|+|
T Consensus         9 l~~~~~g~~viqk~l   23 (36)
T smart00025        9 LSKDQYGNRVVQKLL   23 (36)
T ss_pred             HHhcchhhHHHHHHH
Confidence            456788999999998


Done!