Diaphorina citri psyllid: psy10459

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-----

MTIRPDTVKHRPDQVKLKQERHHSAKTNAEGSDPNEQDKDTERKLSVLETHGYSLGDVVGMGSYATVKLATSARHSQDVAIKIISKVQAPIDYLKKFLPREIEVVKGLKHPNLIRFLQAIETTHRVYIIMEYAKNGSLLEVIRKERYIDEDKGRRWFSQLADAIDYCHKKSVVHRDIKCENLLLDDKYNIKLSDFGFARKYSVNNTDYKQNLSETFCGSYAYASPEILKGVPYTPQQSDIWSMGVVLFAMVYGRLPFDDTNYSELLKQVQKRVVFPESPRLSSSCKALISNILSPVKFRIQMEDIRQDPWLKEDSNPVGKSKSAPEVIPFKKSRN

cccccccccccccccccccccccccccccccccccccccccccccccEEEccEEEEEEECccccEEEEEEEEcccccEEEEEEEEccccccHHHHcHHHHHHHHHHHcccccccEEEEEEEcccEEEEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEECccccccccccccccccccccccccccccccccHHccccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHccccccccccccHHHHHHHHHHcccccccccHHHHHccccccccccccccccccccccccccccc

***********************************************LETHGYSLGDVVGMGSYATVKLATSARHSQDVAIKIISKVQAPIDYLKKFLPREIEVVKGLKHPNLIRFLQAIETTHRVYIIMEYAKNGSLLEVIRKERYIDEDKGRRWFSQLADAIDYCHKKSVVHRDIKCENLLLDDKYNIKLSDFGFARKYSVNNTDYKQNLSETFCGSYAYASPEILKGVPYTPQQSDIWSMGVVLFAMVYGRLPFDDTNYSELLKQVQKRVVFPESPRLSSSCKALISNILSPVKFRIQMEDIRQDPWLKEDSNP******************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Testis-specific serine/threonine-protein kinase 4	May be involved in a signaling pathway during male germ cell development or mature sperm function. Phosphorylates CREB1 on Ser-133 and stimulates downstream signaling.	confident	Q9D411
Testis-specific serine/threonine-protein kinase 4	May be involved in a signaling pathway during male germ cell development or mature sperm function (By similarity). Phosphorylates CREB1 on Ser-133 and stimulates downstream signaling.	confident	Q6SA08

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0048812 [BP]	neuron projection morphogenesis	probable	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0071840, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0008150
GO:0035175 [MF]	histone kinase activity (H3-S10 specific)	probable	GO:0003824, GO:0016773, GO:0016772, GO:0035174, GO:0016301, GO:0035173, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0043987 [BP]	histone H3-S10 phosphorylation	probable	GO:0018105, GO:0016310, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018193, GO:0071704, GO:0016570, GO:0016572, GO:0006468, GO:0009987, GO:0006464, GO:0035404, GO:0036211, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0018209, GO:0051276, GO:0019538, GO:0043412, GO:0044237, GO:0043170, GO:0006796, GO:0006793, GO:0044763, GO:0016568, GO:0016569
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0043988 [BP]	histone H3-S28 phosphorylation	probable	GO:0018105, GO:0016310, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018193, GO:0071704, GO:0016570, GO:0016572, GO:0006468, GO:0009987, GO:0006464, GO:0035404, GO:0036211, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0018209, GO:0051276, GO:0019538, GO:0043412, GO:0044237, GO:0043170, GO:0006796, GO:0006793, GO:0044763, GO:0016568, GO:0016569
GO:0000775 [CC]	chromosome, centromeric region	probable	GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0044022 [MF]	histone kinase activity (H3-S28 specific)	probable	GO:0003824, GO:0016773, GO:0016772, GO:0035174, GO:0016301, GO:0035173, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0000287 [MF]	magnesium ion binding	probable	GO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0004713 [MF]	protein tyrosine kinase activity	probable	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0007286 [BP]	spermatid development	probable	GO:0048610, GO:0022412, GO:0048468, GO:0019953, GO:0032501, GO:0007276, GO:0000003, GO:0048869, GO:0048515, GO:0030855, GO:0002064, GO:0032502, GO:0030154, GO:0048609, GO:0032504, GO:0060429, GO:0009888, GO:0044767, GO:0022414, GO:0007283, GO:0044763, GO:0048232, GO:0007281, GO:0044699, GO:0044702, GO:0003006, GO:0048856, GO:0008150, GO:0009987
GO:0009892 [BP]	negative regulation of metabolic process	probable	GO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0019222
GO:0032793 [BP]	positive regulation of CREB transcription factor activity	probable	GO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0050789, GO:2000112, GO:0060255, GO:0065007, GO:0044093, GO:0065009, GO:0010468, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:2001141, GO:0051091, GO:0051090, GO:0051252, GO:0006355, GO:0010556
GO:0010906 [BP]	regulation of glucose metabolic process	probable	GO:0080090, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0010675, GO:0008150, GO:0006109, GO:0050789
GO:0050793 [BP]	regulation of developmental process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0005874 [CC]	microtubule	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0009737 [BP]	response to abscisic acid stimulus	probable	GO:1901700, GO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0009725, GO:0042221, GO:0097305, GO:0010033
GO:1901701 [BP]	cellular response to oxygen-containing compound	probable	GO:1901700, GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0044699
GO:0048523 [BP]	negative regulation of cellular process	probable	GO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007243 [BP]	intracellular protein kinase cascade	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0009504 [CC]	cell plate	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0051179 [BP]	localization	probable	GO:0008150
GO:0019216 [BP]	regulation of lipid metabolic process	probable	GO:0008150, GO:0065007, GO:0080090, GO:0019222, GO:0050789
GO:0051239 [BP]	regulation of multicellular organismal process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0051233 [CC]	spindle midzone	probable	GO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0050321 [MF]	tau-protein kinase activity	probable	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0009894 [BP]	regulation of catabolic process	probable	GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0004679 [MF]	AMP-activated protein kinase activity	probable	GO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0048583 [BP]	regulation of response to stimulus	probable	GO:0008150, GO:0065007, GO:0050789
GO:0042538 [BP]	hyperosmotic salinity response	probable	GO:0009628, GO:0050896, GO:0008150, GO:0006950, GO:0006970, GO:0006972, GO:0009651
GO:0005773 [CC]	vacuole	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0010243 [BP]	response to organic nitrogen	probable	GO:0009719, GO:0050896, GO:1901698, GO:0008150, GO:0042221, GO:0010033
GO:0010604 [BP]	positive regulation of macromolecule metabolic process	probable	GO:0009893, GO:0019222, GO:0060255, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0005938 [CC]	cell cortex	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0042802 [MF]	identical protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0032870 [BP]	cellular response to hormone stimulus	probable	GO:0071495, GO:0009719, GO:0051716, GO:0009725, GO:0050896, GO:0009987, GO:0008150, GO:0071310, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0032133 [CC]	chromosome passenger complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0005622, GO:0005875, GO:0044422
GO:0009506 [CC]	plasmodesma	probable	GO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0030424 [CC]	axon	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0005814 [CC]	centriole	probable	GO:0005737, GO:0005856, GO:0015630, GO:0043228, GO:0005575, GO:0043232, GO:0005813, GO:0044464, GO:0044444, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044450, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0046777 [BP]	protein autophosphorylation	probable	GO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0065008 [BP]	regulation of biological quality	probable	GO:0008150, GO:0065007
GO:0042149 [BP]	cellular response to glucose starvation	probable	GO:0009267, GO:0051716, GO:0031669, GO:0033554, GO:0009605, GO:0050896, GO:0009987, GO:0031668, GO:0031667, GO:0008150, GO:0006950, GO:0071496, GO:0044763, GO:0044699, GO:0042594, GO:0007154, GO:0009991
GO:0001669 [CC]	acrosomal vesicle	probable	GO:0005737, GO:0043231, GO:0016023, GO:0030141, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0031410, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0044459 [CC]	plasma membrane part	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0031325 [BP]	positive regulation of cellular metabolic process	probable	GO:0009893, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0007010 [BP]	cytoskeleton organization	probable	GO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.7.-.-	Transferring phosphorous-containing groups.	probable
2.7.11.-	Protein-serine/threonine kinases.	probable
2.7.11.1	Transferred entry: 2.7.11.19.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3N9X, chain A
Confidence level:very confident
Coverage over the Query: 49-201,216-331
View the alignment between query and template
View the model in PyMOL

Template: 1UU3, chain A
Confidence level:very confident
Coverage over the Query: 56-201,216-313
View the alignment between query and template
View the model in PyMOL