Query         psy10473
Match_columns 124
No_of_seqs    109 out of 202
Neff          4.6 
Searched_HMMs 46136
Date          Fri Aug 16 19:06:40 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10473.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10473hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2674|consensus               99.8 1.6E-21 3.5E-26  166.8   6.7   74    6-83    301-375 (409)
  2 PF03416 Peptidase_C54:  Peptid  99.5 1.4E-14   3E-19  118.2   3.4   41   20-60    238-278 (278)
  3 PF00169 PH:  PH domain;  Inter  62.0       9 0.00019   24.2   2.6   23   41-63     81-103 (104)
  4 PHA02975 hypothetical protein;  55.0      17 0.00036   24.8   3.0   21   44-64     12-32  (69)
  5 PHA02650 hypothetical protein;  49.0      21 0.00046   25.0   2.8   21   44-64     12-32  (81)
  6 smart00233 PH Pleckstrin homol  48.8      19 0.00041   21.9   2.4   24   40-63     78-101 (102)
  7 cd09012 Glo_EDI_BRP_like_24 Th  44.4      27 0.00058   23.5   2.8   22   40-61     70-91  (124)
  8 cd03073 PDI_b'_ERp72_ERp57 PDI  40.9      47   0.001   23.4   3.7   37   40-76     17-59  (111)
  9 PF12253 CAF1A:  Chromatin asse  39.5      21 0.00045   24.5   1.6   10   74-83      8-17  (77)
 10 cd00821 PH Pleckstrin homology  39.2      27 0.00059   21.0   2.0   22   40-61     74-95  (96)
 11 PHA02819 hypothetical protein;  38.3      32 0.00069   23.6   2.4   21   44-64     12-32  (71)
 12 PHA02844 putative transmembran  37.9      33 0.00072   23.8   2.4   21   44-64     12-32  (75)
 13 PF11478 Tachystatin_B:  Antimi  37.8       8 0.00017   23.6  -0.6   10   38-47     17-26  (42)
 14 PF12575 DUF3753:  Protein of u  36.8      36 0.00079   23.3   2.5   21   44-64     12-32  (72)
 15 PHA03054 IMV membrane protein;  35.8      49  0.0011   22.7   3.0   21   44-64     12-32  (72)
 16 PF00903 Glyoxalase:  Glyoxalas  34.6      46 0.00099   21.5   2.7   23   40-62     75-97  (128)
 17 cd07255 Glo_EDI_BRP_like_12 Th  34.2      44 0.00096   22.1   2.6   22   40-61     66-87  (125)
 18 PHA02692 hypothetical protein;  33.7      44 0.00095   22.9   2.4   21   44-64     12-32  (70)
 19 cd00900 PH-like Pleckstrin hom  33.5      49  0.0011   20.1   2.5   23   39-61     76-98  (99)
 20 cd01230 PH_EFA6 EFA6 Pleckstri  32.6      48   0.001   24.0   2.7   25   40-64     88-112 (117)
 21 smart00545 JmjN Small domain f  32.2      70  0.0015   19.4   3.0   36   45-82      5-41  (42)
 22 cd08346 PcpA_N_like N-terminal  31.6      52  0.0011   21.4   2.6   23   40-62     75-97  (126)
 23 cd07235 MRD Mitomycin C resist  30.3      61  0.0013   21.4   2.8   23   39-61     67-89  (122)
 24 PHA00527 hypothetical protein   30.3      37  0.0008   25.4   1.8   19   43-61     22-40  (129)
 25 cd07251 Glo_EDI_BRP_like_10 Th  30.0      64  0.0014   20.9   2.8   24   38-61     64-87  (121)
 26 cd01225 PH_Cool_Pix Cool (clon  29.6      54  0.0012   24.1   2.5   25   35-62     84-108 (111)
 27 cd07241 Glo_EDI_BRP_like_3 Thi  29.2      61  0.0013   21.1   2.6   23   40-62     72-94  (125)
 28 cd09013 BphC-JF8_N_like N-term  27.7      66  0.0014   21.4   2.6   21   41-61     65-85  (121)
 29 cd08362 BphC5-RrK37_N_like N-t  25.9      75  0.0016   20.8   2.6   22   40-61     60-81  (120)
 30 PRK06724 hypothetical protein;  25.1      73  0.0016   22.5   2.5   21   41-61     66-86  (128)
 31 cd07240 ED_TypeI_classII_N N-t  24.5      83  0.0018   20.3   2.6   21   41-61     60-80  (117)
 32 cd01241 PH_Akt Akt pleckstrin   24.4      69  0.0015   22.0   2.2   20   43-62     82-101 (102)
 33 cd07242 Glo_EDI_BRP_like_6 Thi  24.1      84  0.0018   20.9   2.6   22   40-61     70-91  (128)
 34 cd06404 PB1_aPKC PB1 domain is  22.2      85  0.0018   22.0   2.3   32   31-73     11-43  (83)
 35 cd01245 PH_RasGAP_CG5898 RAS G  21.9      96  0.0021   21.8   2.6   30   32-61     67-97  (98)
 36 PF03108 DBD_Tnp_Mut:  MuDR fam  21.7      90   0.002   19.6   2.2   25   37-61      1-25  (67)
 37 cd07266 HPCD_N_class_II N-term  21.7   1E+02  0.0022   20.3   2.6   23   39-61     61-83  (121)
 38 PF07433 DUF1513:  Protein of u  21.4      49  0.0011   28.1   1.2   19   24-42    123-142 (305)
 39 cd08361 PpCmtC_N N-terminal do  21.2   1E+02  0.0022   20.9   2.6   22   40-61     61-82  (124)
 40 cd08364 FosX FosX, a fosfomyci  21.0      77  0.0017   21.9   2.0   19   42-61     70-88  (131)
 41 cd01222 PH_clg Clg (common-sit  20.9 1.3E+02  0.0028   21.1   3.0   27   37-63     69-95  (97)

No 1  
>KOG2674|consensus
Probab=99.84  E-value=1.6e-21  Score=166.80  Aligned_cols=74  Identities=32%  Similarity=0.695  Sum_probs=60.6

Q ss_pred             ccCCCCCCCcccccCccccCCCccccccccCCccceeecccCChHHHHHHHHHHHHhhc-CCCCCcEEEecCCCCCCCC
Q psy10473          6 IGVYDKEQDSEKKLDSTYHCPQASRLHILHMDPSIAVCFLCKTENDFASLCSQIRAELR-PEQQPLFELIEDPIEDWTP   83 (124)
Q Consensus         6 ~~~~~~~~~~~~~~d~SyHC~~prrm~i~~mDPS~alGFyC~te~DFedl~~~i~~~l~-~~~~PLF~v~e~rp~~~~~   83 (124)
                      |+|.....++    ++||||+.||||+|.+|||||||||||++++||++||.+++++++ ..+.++|.+...+|.||..
T Consensus       301 V~vs~~~~~~----~esfHC~~~~km~f~~mDPS~alGF~c~~~~dF~~~c~~l~k~~~~s~~~~~~~lf~~~~~h~~~  375 (409)
T KOG2674|consen  301 VEVSKAKDVP----DETFHCQSLRKMAFEDMDPSLALGFYCKDEDDFDNLCSELKKSLSLSSALEMFELFTRVPSHWET  375 (409)
T ss_pred             ccccccCCCC----ccccccCchhhcchhhcCcceEEEEEecCHHHHHHHHHHHHHHhccccCcccccceecccccccc
Confidence            3444445566    889999999999999999999999999999999999999999776 5554556666677777753


No 2  
>PF03416 Peptidase_C54:  Peptidase family C54 This family belongs to family C54 of the peptidase classification.;  InterPro: IPR005078 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This is a group of cysteine peptidases which constitute MEROPS peptidase family C54 (Aut2 peptidase family, clan CA), which are a group of proteins of unknown function.; PDB: 2CY7_A 2ZZP_A 2D1I_B 2Z0E_A 2Z0D_A 2P82_D.
Probab=99.49  E-value=1.4e-14  Score=118.18  Aligned_cols=41  Identities=41%  Similarity=0.993  Sum_probs=37.2

Q ss_pred             CccccCCCccccccccCCccceeecccCChHHHHHHHHHHH
Q psy10473         20 DSTYHCPQASRLHILHMDPSIAVCFLCKTENDFASLCSQIR   60 (124)
Q Consensus        20 d~SyHC~~prrm~i~~mDPS~alGFyC~te~DFedl~~~i~   60 (124)
                      ++||||..+++|++++|||||||||||+|++||++||++|+
T Consensus       238 ~~s~h~~~~~~~~~~~lDPS~~lgF~~~~~~d~~~~~~~i~  278 (278)
T PF03416_consen  238 DSSYHCSSPRKMPISKLDPSMALGFYCRNEEDFEDFCKRIQ  278 (278)
T ss_dssp             -GGGC-SSSEEEEGGGS-SEEEEEEEESSHHHHHHHHHHHH
T ss_pred             CCceecCCcccCcHhhcCCCEEEEEEECCHHHHHHHHHhcC
Confidence            48999999999999999999999999999999999999986


No 3  
>PF00169 PH:  PH domain;  InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ]. The pleckstrin homology domain commonly found in eukaryotic signalling proteins. The domain family possesses multiple functions including the abilities to bind inositol phosphates, and various proteins. PH domains have been found to possess inserted domains (such as in PLC gamma, syntrophins) and to be inserted within other domains. Mutations in Brutons tyrosine kinase (Btk) within its PH domain cause X-linked agammaglobulinaemia (XLA) in patients. Point mutations cluster into the positively charged end of the molecule around the predicted binding site for phosphatidylinositol lipids. The 3D structure of several PH domains has been determined []. All known cases have a common structure consisting of two perpendicular anti-parallel beta sheets, followed by a C-terminal amphipathic helix. The loops connecting the beta-strands differ greatly in length, making the PH domain relatively difficult to detect. There are no totally invariant residues within the PH domain. Proteins reported to contain one more PH domains belong to the following families:  Pleckstrin, the protein where this domain was first detected, is the major substrate of protein kinase C in platelets. Pleckstrin is one of the rare proteins to contains two PH domains. Ser/Thr protein kinases such as the Akt/Rac family, the beta-adrenergic receptor kinases, the mu isoform of PKC and the trypanosomal NrkA family. Tyrosine protein kinases belonging to the Btk/Itk/Tec subfamily. Insulin Receptor Substrate 1 (IRS-1). Regulators of small G-proteins like guanine nucleotide releasing factor GNRP (Ras-GRF) (which contains 2 PH domains), guanine nucleotide exchange proteins like vav, dbl, SoS and Saccharomyces cerevisiae CDC24, GTPase activating proteins like rasGAP and BEM2/IPL2, and the human break point cluster protein bcr. Cytoskeletal proteins such as dynamin (see IPR001401 from INTERPRO), Caenorhabditis elegans kinesin-like protein unc-104 (see IPR001752 from INTERPRO), spectrin beta-chain, syntrophin (2 PH domains) and S. cerevisiae nuclear migration protein NUM1. Mammalian phosphatidylinositol-specific phospholipase C (PI-PLC) (see IPR000909 from INTERPRO) isoforms gamma and delta. Isoform gamma contains two PH domains, the second one is split into two parts separated by about 400 residues. Oxysterol binding proteins OSBP, S. cerevisiae OSH1 and YHR073w. Mouse protein citron, a putative rho/rac effector that binds to the GTP-bound forms of rho and rac. Several S. cerevisiae proteins involved in cell cycle regulation and bud formation like BEM2, BEM3, BUD4 and the BEM1-binding proteins BOI2 (BEB1) and BOI1 (BOB1). C. elegans protein MIG-10. C. elegans hypothetical proteins C04D8.1, K06H7.4 and ZK632.12. S. cerevisiae hypothetical proteins YBR129c and YHR155w. ; GO: 0005515 protein binding; PDB: 1DYN_B 2DYN_B 3SNH_A 3ZYS_C 1X05_A 2I5F_A 1ZM0_B 1XX0_A 2I5C_C 3A8P_D ....
Probab=61.97  E-value=9  Score=24.17  Aligned_cols=23  Identities=13%  Similarity=0.235  Sum_probs=20.1

Q ss_pred             eeecccCChHHHHHHHHHHHHhh
Q psy10473         41 AVCFLCKTENDFASLCSQIRAEL   63 (124)
Q Consensus        41 alGFyC~te~DFedl~~~i~~~l   63 (124)
                      .+=|.|.|+++...|.+.|+..+
T Consensus        81 ~~~~~~~s~~~~~~W~~~i~~~~  103 (104)
T PF00169_consen   81 SYLFSAESEEERKRWIQAIQKAI  103 (104)
T ss_dssp             EEEEEESSHHHHHHHHHHHHHHH
T ss_pred             EEEEEcCCHHHHHHHHHHHHHHh
Confidence            56688999999999999999864


No 4  
>PHA02975 hypothetical protein; Provisional
Probab=55.00  E-value=17  Score=24.83  Aligned_cols=21  Identities=29%  Similarity=0.464  Sum_probs=19.1

Q ss_pred             cccCChHHHHHHHHHHHHhhc
Q psy10473         44 FLCKTENDFASLCSQIRAELR   64 (124)
Q Consensus        44 FyC~te~DFedl~~~i~~~l~   64 (124)
                      |+-.+.+||++|.+-++.++.
T Consensus        12 FmsS~DdDF~nFI~vVksVLt   32 (69)
T PHA02975         12 FLESNDSDFEDFIDTIMHVLT   32 (69)
T ss_pred             hcCCChHHHHHHHHHHHHHHc
Confidence            677889999999999999887


No 5  
>PHA02650 hypothetical protein; Provisional
Probab=49.00  E-value=21  Score=25.02  Aligned_cols=21  Identities=24%  Similarity=0.610  Sum_probs=19.1

Q ss_pred             cccCChHHHHHHHHHHHHhhc
Q psy10473         44 FLCKTENDFASLCSQIRAELR   64 (124)
Q Consensus        44 FyC~te~DFedl~~~i~~~l~   64 (124)
                      |+-.+.+||++|.+-++.++.
T Consensus        12 FmsS~DdDFnnFI~VVkSVLt   32 (81)
T PHA02650         12 FMSSTDDDFNNFIDVVKSVLS   32 (81)
T ss_pred             hcCCcHHHHHHHHHHHHHHHc
Confidence            677889999999999999887


No 6  
>smart00233 PH Pleckstrin homology domain. Domain commonly found in eukaryotic signalling proteins. The domain family possesses multiple functions including the abilities to bind inositol phosphates, and various proteins. PH domains have been found to possess inserted domains (such as in PLC gamma, syntrophins) and to be inserted within other domains. Mutations in Brutons tyrosine kinase (Btk) within its PH domain cause X-linked agammaglobulinaemia (XLA) in patients. Point mutations cluster into the positively charged end of the molecule around the predicted binding site for phosphatidylinositol lipids.
Probab=48.79  E-value=19  Score=21.93  Aligned_cols=24  Identities=8%  Similarity=0.188  Sum_probs=21.2

Q ss_pred             ceeecccCChHHHHHHHHHHHHhh
Q psy10473         40 IAVCFLCKTENDFASLCSQIRAEL   63 (124)
Q Consensus        40 ~alGFyC~te~DFedl~~~i~~~l   63 (124)
                      ..+=|.|.|+++...|...|+..+
T Consensus        78 ~~~~f~~~s~~~~~~W~~~i~~~~  101 (102)
T smart00233       78 RSYLLQAESEEEREEWVDALRKAI  101 (102)
T ss_pred             ceEEEEcCCHHHHHHHHHHHHHhh
Confidence            478899999999999999998753


No 7  
>cd09012 Glo_EDI_BRP_like_24 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II).  The protein superfamily contains members with or without domain swapping.
Probab=44.44  E-value=27  Score=23.52  Aligned_cols=22  Identities=9%  Similarity=0.253  Sum_probs=20.5

Q ss_pred             ceeecccCChHHHHHHHHHHHH
Q psy10473         40 IAVCFLCKTENDFASLCSQIRA   61 (124)
Q Consensus        40 ~alGFyC~te~DFedl~~~i~~   61 (124)
                      ..|+|+|.+.++.+.+++++++
T Consensus        70 ~~l~f~v~~~~~vd~~~~~l~~   91 (124)
T cd09012          70 VLISLSADSREEVDELVEKALA   91 (124)
T ss_pred             EEEEEeCCCHHHHHHHHHHHHH
Confidence            4699999999999999999988


No 8  
>cd03073 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI. They exhibit both disulfide oxidase and reductase functions, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides and acting as isomerases to correct any non-native disulfide bonds. They also display chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. ERp57 contains two redox-active TRX (a) domains and two redox inactive TRX-like (b) domains.  It shares the same domain arrangement of abb'a' as PDI, but lacks the C-terminal acid-rich region (c domain) that is present in PDI. ERp72 contains one additional redox-active TRX (a) domain at the N-terminus with a molecular structure of a"abb'a'. ERp57 interacts with the lectin chaperones, calnexin and calreticulin, and specifically promotes the oxidative folding of glycoprotei
Probab=40.90  E-value=47  Score=23.43  Aligned_cols=37  Identities=5%  Similarity=0.084  Sum_probs=29.0

Q ss_pred             ceeecccC----ChHHHHHHHHHHHHhhc-CC-CCCcEEEecC
Q psy10473         40 IAVCFLCK----TENDFASLCSQIRAELR-PE-QQPLFELIED   76 (124)
Q Consensus        40 ~alGFyC~----te~DFedl~~~i~~~l~-~~-~~PLF~v~e~   76 (124)
                      +++.|||.    +.++++.|..+++++.. -. ++=+|-+++.
T Consensus        17 l~~~~~~~~~~~~~~~~~~~~~~~~~vAk~fk~gki~Fv~~D~   59 (111)
T cd03073          17 LVVAYYNVDYSKNPKGTNYWRNRVLKVAKDFPDRKLNFAVADK   59 (111)
T ss_pred             eEEEEEeccccCChhHHHHHHHHHHHHHHHCcCCeEEEEEEcH
Confidence            38999988    89999999999999887 23 4566766543


No 9  
>PF12253 CAF1A:  Chromatin assembly factor 1 subunit A;  InterPro: IPR022043  The CAF-1 or chromatin assembly factor-1 consists of three subunits, and this is the first, or A []. The A domain is uniquely required for the progression of S phase in mouse cells [], independent of its ability to promote histone deposition [] but dependent on its ability to interact with HP1 - heterochromatin protein 1-rich heterochromatin domains next to centromeres that are crucial for chromosome segregation during mitosis. This HP1-CAF-1 interaction module functions as a built-in replication control for heterochromatin, which, like a control barrier, has an impact on S-phase progression in addition to DNA-based checkpoints []. 
Probab=39.48  E-value=21  Score=24.53  Aligned_cols=10  Identities=0%  Similarity=-0.276  Sum_probs=5.9

Q ss_pred             ecCCCCCCCC
Q psy10473         74 IEDPIEDWTP   83 (124)
Q Consensus        74 ~e~rp~~~~~   83 (124)
                      -..||++|..
T Consensus         8 e~~RPpY~GT   17 (77)
T PF12253_consen    8 ENVRPPYYGT   17 (77)
T ss_pred             CCCCCCEeeE
Confidence            3467777643


No 10 
>cd00821 PH Pleckstrin homology (PH) domain. Pleckstrin homology (PH) domain. PH domains are only found in eukaryotes. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=39.22  E-value=27  Score=21.02  Aligned_cols=22  Identities=5%  Similarity=0.116  Sum_probs=20.1

Q ss_pred             ceeecccCChHHHHHHHHHHHH
Q psy10473         40 IAVCFLCKTENDFASLCSQIRA   61 (124)
Q Consensus        40 ~alGFyC~te~DFedl~~~i~~   61 (124)
                      -.+=|.|.|+++...|.+.|+.
T Consensus        74 ~~~~~~~~s~~~~~~W~~~l~~   95 (96)
T cd00821          74 RSYLLQAESEEEREEWIEALQS   95 (96)
T ss_pred             cEEEEEeCCHHHHHHHHHHHhc
Confidence            7888999999999999999875


No 11 
>PHA02819 hypothetical protein; Provisional
Probab=38.34  E-value=32  Score=23.60  Aligned_cols=21  Identities=19%  Similarity=0.608  Sum_probs=18.9

Q ss_pred             cccCChHHHHHHHHHHHHhhc
Q psy10473         44 FLCKTENDFASLCSQIRAELR   64 (124)
Q Consensus        44 FyC~te~DFedl~~~i~~~l~   64 (124)
                      |+-.+.+||++|.+-++.++.
T Consensus        12 FmsS~DdDFnnFI~VVksVLt   32 (71)
T PHA02819         12 FMSSSDDDFNNFINVVKSVLN   32 (71)
T ss_pred             hhCCchhHHHHHHHHHHHHHc
Confidence            677889999999999999876


No 12 
>PHA02844 putative transmembrane protein; Provisional
Probab=37.86  E-value=33  Score=23.75  Aligned_cols=21  Identities=24%  Similarity=0.539  Sum_probs=19.0

Q ss_pred             cccCChHHHHHHHHHHHHhhc
Q psy10473         44 FLCKTENDFASLCSQIRAELR   64 (124)
Q Consensus        44 FyC~te~DFedl~~~i~~~l~   64 (124)
                      |+-.+.+||++|.+-++.++.
T Consensus        12 FmsS~DdDFnnFI~vVksVLt   32 (75)
T PHA02844         12 FLSSENEDFNNFIDVVKSVLS   32 (75)
T ss_pred             hcCCchHHHHHHHHHHHHHHc
Confidence            677889999999999999886


No 13 
>PF11478 Tachystatin_B:  Antimicrobial chitin binding protein tachystatin B;  InterPro: IPR020957  Tachystatin B is an antimicrobial chitin binding peptide and consists of two isotopes B1 and B2. Both structures contain a short antiparallel beta sheet with an inhibitory cysteine knot motif. Tyr(14) and Arg(17) are thought to be the essential residues for chitin binding []. ; PDB: 2DCW_A 2DCV_A.
Probab=37.78  E-value=8  Score=23.61  Aligned_cols=10  Identities=20%  Similarity=0.604  Sum_probs=8.1

Q ss_pred             ccceeecccC
Q psy10473         38 PSIAVCFLCK   47 (124)
Q Consensus        38 PS~alGFyC~   47 (124)
                      -||+.|+||+
T Consensus        17 rsccfgyycr   26 (42)
T PF11478_consen   17 RSCCFGYYCR   26 (42)
T ss_dssp             S-BSTTEEEE
T ss_pred             CceEeEEEEc
Confidence            4899999997


No 14 
>PF12575 DUF3753:  Protein of unknown function (DUF3753);  InterPro: IPR009175 This group represents an uncharacterised conserved protein belonging to poxvirus family I2.
Probab=36.79  E-value=36  Score=23.33  Aligned_cols=21  Identities=19%  Similarity=0.600  Sum_probs=19.0

Q ss_pred             cccCChHHHHHHHHHHHHhhc
Q psy10473         44 FLCKTENDFASLCSQIRAELR   64 (124)
Q Consensus        44 FyC~te~DFedl~~~i~~~l~   64 (124)
                      |+-.+.+||++|.+-+++++.
T Consensus        12 Fmss~ddDf~~Fi~vVksVlt   32 (72)
T PF12575_consen   12 FMSSSDDDFNNFINVVKSVLT   32 (72)
T ss_pred             hcCCCHHHHHHHHHHHHHHHc
Confidence            777899999999999999875


No 15 
>PHA03054 IMV membrane protein; Provisional
Probab=35.76  E-value=49  Score=22.73  Aligned_cols=21  Identities=19%  Similarity=0.471  Sum_probs=18.9

Q ss_pred             cccCChHHHHHHHHHHHHhhc
Q psy10473         44 FLCKTENDFASLCSQIRAELR   64 (124)
Q Consensus        44 FyC~te~DFedl~~~i~~~l~   64 (124)
                      |+-.+.+||++|.+-++.++.
T Consensus        12 F~ss~d~Df~~Fi~vV~sVl~   32 (72)
T PHA03054         12 FMGSPEDDLTDFIEIVKSVLS   32 (72)
T ss_pred             hhCCchHHHHHHHHHHHHHHc
Confidence            677889999999999999876


No 16 
>PF00903 Glyoxalase:  Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily This Prosite is specific to glyoxalases This Prosite is specific to Extradiol ring-cleavage dioxygenases This prints entry is specific to bleomycin resistance protein.;  InterPro: IPR004360 Glyoxalase I (4.4.1.5 from EC) (lactoylglutathione lyase) catalyzes the first step of the glyoxal pathway. S-lactoylglutathione is then converted by glyoxalase II to lactic acid []. Glyoxalase I is an ubiquitous enzyme which binds one mole of zinc per subunit. The bacterial and yeast enzymes are monomeric while the mammalian one is homodimeric. The sequence of glyoxalase I is well conserved. The domain represented by this entry is found in glyoxalase I and in other related proteins, including fosfomycin resistance proteins FosB [], FosA [], FosX [] and dioxygenases (eg. 4-hydroxyphenylpyruvate dioxygenase).; PDB: 1CJX_A 1NPB_E 3OJT_C 3OJN_A 2IG9_B 3OJJ_B 3OJK_D 1Q0C_D 1F1X_C 3BZA_B ....
Probab=34.56  E-value=46  Score=21.51  Aligned_cols=23  Identities=17%  Similarity=0.381  Sum_probs=21.0

Q ss_pred             ceeecccCChHHHHHHHHHHHHh
Q psy10473         40 IAVCFLCKTENDFASLCSQIRAE   62 (124)
Q Consensus        40 ~alGFyC~te~DFedl~~~i~~~   62 (124)
                      .-++|.|.+.+|.+.+.+++++.
T Consensus        75 ~~i~~~~~~~~dl~~~~~~l~~~   97 (128)
T PF00903_consen   75 HHIAFLAFDVDDLDAAYERLKAQ   97 (128)
T ss_dssp             EEEEEEESSHHHHHHHHHHHHHT
T ss_pred             eeEEEEeccHHHHHHHHHHHhhc
Confidence            46899999999999999999983


No 17 
>cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=34.21  E-value=44  Score=22.08  Aligned_cols=22  Identities=14%  Similarity=0.196  Sum_probs=20.1

Q ss_pred             ceeecccCChHHHHHHHHHHHH
Q psy10473         40 IAVCFLCKTENDFASLCSQIRA   61 (124)
Q Consensus        40 ~alGFyC~te~DFedl~~~i~~   61 (124)
                      .-++|.+.|.++++.+++++++
T Consensus        66 ~hi~f~v~~~~~v~~~~~~l~~   87 (125)
T cd07255          66 YHFAILLPSRADLAAALRRLIE   87 (125)
T ss_pred             EEEEEECCCHHHHHHHHHHHHH
Confidence            3688999999999999999988


No 18 
>PHA02692 hypothetical protein; Provisional
Probab=33.74  E-value=44  Score=22.86  Aligned_cols=21  Identities=24%  Similarity=0.596  Sum_probs=18.7

Q ss_pred             cccCChHHHHHHHHHHHHhhc
Q psy10473         44 FLCKTENDFASLCSQIRAELR   64 (124)
Q Consensus        44 FyC~te~DFedl~~~i~~~l~   64 (124)
                      |+-.+.+||++|.+-++.++.
T Consensus        12 Fmss~DdDF~~Fi~vVksVLt   32 (70)
T PHA02692         12 FLSNSDEDFEEFLNIVRTVMT   32 (70)
T ss_pred             hcCCCHHHHHHHHHHHHHHHc
Confidence            677788999999999999886


No 19 
>cd00900 PH-like Pleckstrin homology-like domain. Pleckstrin homology-like domain.  This family includes the PH domain, both the Shc-like and IRS-like PTB domains, the ran-binding domain, the EVH1 domain, a domain in neurobeachin and the third domain of FERM. All of these domains have a PH fold, but lack significant sequence similarity. They are generally involved in targeting to protein to the appropriate cellular location or interacting with a binding partner.  The PH domain is commonly found in eukaryotic signaling proteins. This domain family possesses multiple functions including the ability to bind inositol phosphates and to other proteins.
Probab=33.54  E-value=49  Score=20.06  Aligned_cols=23  Identities=9%  Similarity=0.202  Sum_probs=21.2

Q ss_pred             cceeecccCChHHHHHHHHHHHH
Q psy10473         39 SIAVCFLCKTENDFASLCSQIRA   61 (124)
Q Consensus        39 S~alGFyC~te~DFedl~~~i~~   61 (124)
                      .-++-|.|.|.++...|...|+.
T Consensus        76 ~~~~~~~~~~~~~~~~W~~al~~   98 (99)
T cd00900          76 RRVFVFQADSEEEAQEWVEALQQ   98 (99)
T ss_pred             cEEEEEEcCCHHHHHHHHHHHhc
Confidence            78999999999999999999875


No 20 
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 Pleckstrin Homology (PH) domain. EFA6  is an guanine nucleotide exchange factor for ARF6, which is involved in membrane recycling. It consists of a SEC7 domain followed by a PH domain.  The EFA6 PH domain regulates its association with the plasma membrane. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=32.61  E-value=48  Score=24.01  Aligned_cols=25  Identities=12%  Similarity=0.109  Sum_probs=21.3

Q ss_pred             ceeecccCChHHHHHHHHHHHHhhc
Q psy10473         40 IAVCFLCKTENDFASLCSQIRAELR   64 (124)
Q Consensus        40 ~alGFyC~te~DFedl~~~i~~~l~   64 (124)
                      --+=|-|.+++|++.|+..|+....
T Consensus        88 ~~~lfqA~~~ee~~~Wi~~I~~~~~  112 (117)
T cd01230          88 REFLFQTSSLKELQSWIERINVVAA  112 (117)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHHHH
Confidence            4566999999999999999998654


No 21 
>smart00545 JmjN Small domain found in the jumonji family of transcription factors. To date, this domain always co-occurs with the JmjC domain (although the reverse is not true).
Probab=32.22  E-value=70  Score=19.43  Aligned_cols=36  Identities=17%  Similarity=0.339  Sum_probs=26.9

Q ss_pred             ccCChHHHHHHHHHHHHhhc-CCCCCcEEEecCCCCCCC
Q psy10473         45 LCKTENDFASLCSQIRAELR-PEQQPLFELIEDPIEDWT   82 (124)
Q Consensus        45 yC~te~DFedl~~~i~~~l~-~~~~PLF~v~e~rp~~~~   82 (124)
                      |-.|.++|.|.+.-|+++-. ..++.+.-|+  -|+.|-
T Consensus         5 f~Pt~eEF~Dp~~yi~~i~~~~~~yGi~KIv--PP~~w~   41 (42)
T smart00545        5 FYPTMEEFKDPLAYISKIRPQAEKYGICKVV--PPKSWK   41 (42)
T ss_pred             EcCCHHHHHCHHHHHHHHHHHHhhCCEEEEE--CCCCCC
Confidence            45689999999999988655 6788888774  355564


No 22 
>cd08346 PcpA_N_like N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins. The N-terminal domain of Sphingobium chlorophenolicum (formerly Sphingomonas chlorophenolica) 2,6-dichloro-p-hydroquinone1,2-dioxygenase (PcpA), and similar proteins. PcpA is a key enzyme in the pentachlorophenol (PCP) degradation pathway, catalyzing the conversion of 2,6-dichloro-p-hydroquinone to 2-chloromaleylacetate. This domain belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases.
Probab=31.61  E-value=52  Score=21.37  Aligned_cols=23  Identities=17%  Similarity=0.316  Sum_probs=20.7

Q ss_pred             ceeecccCChHHHHHHHHHHHHh
Q psy10473         40 IAVCFLCKTENDFASLCSQIRAE   62 (124)
Q Consensus        40 ~alGFyC~te~DFedl~~~i~~~   62 (124)
                      -.|+|.+.+.++++.+.+++++.
T Consensus        75 ~hi~f~v~~~~~~~~~~~~~~~~   97 (126)
T cd08346          75 HHIAFSVPSEASLDAWRERLRAA   97 (126)
T ss_pred             EEEEEEcCCHHHHHHHHHHHHHc
Confidence            47999999999999999999883


No 23 
>cd07235 MRD Mitomycin C resistance protein (MRD). Mitomycin C (MC) is a naturally occurring antibiotic, and antitumor agent used in the treatment of cancer. Its antitumor activity is exerted primarily through monofunctional and bifunctional alkylation of DNA. MRD binds to MC and functions as a component of the MC exporting system. MC is bound to MRD by a stacking interaction between a His and a Trp. MRD adopts a structural fold similar to bleomycin resistance protein, glyoxalase I, and extradiol dioxygenases; and it has binding sites at an identical location to binding sites in these evolutionarily related enzymes.
Probab=30.32  E-value=61  Score=21.42  Aligned_cols=23  Identities=30%  Similarity=0.654  Sum_probs=20.8

Q ss_pred             cceeecccCChHHHHHHHHHHHH
Q psy10473         39 SIAVCFLCKTENDFASLCSQIRA   61 (124)
Q Consensus        39 S~alGFyC~te~DFedl~~~i~~   61 (124)
                      +..|+|.|.+.+|.+.+.+++++
T Consensus        67 ~~~l~~~~~~~~dvd~~~~~l~~   89 (122)
T cd07235          67 RIALAFLCETPAEVDALYAELVG   89 (122)
T ss_pred             cEEEEEEcCCHHHHHHHHHHHHH
Confidence            45789999999999999999987


No 24 
>PHA00527 hypothetical protein
Probab=30.29  E-value=37  Score=25.36  Aligned_cols=19  Identities=16%  Similarity=0.786  Sum_probs=16.1

Q ss_pred             ecccCChHHHHHHHHHHHH
Q psy10473         43 CFLCKTENDFASLCSQIRA   61 (124)
Q Consensus        43 GFyC~te~DFedl~~~i~~   61 (124)
                      -.|||+..+|+.+|..+.-
T Consensus        22 v~~CR~~~EWQ~~~~~LGV   40 (129)
T PHA00527         22 VYLCRSKEEWQQACIHLGV   40 (129)
T ss_pred             EEEEcChHHHHHHHHHhCC
Confidence            3689999999999998753


No 25 
>cd07251 Glo_EDI_BRP_like_10 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=30.04  E-value=64  Score=20.92  Aligned_cols=24  Identities=13%  Similarity=0.290  Sum_probs=21.1

Q ss_pred             ccceeecccCChHHHHHHHHHHHH
Q psy10473         38 PSIAVCFLCKTENDFASLCSQIRA   61 (124)
Q Consensus        38 PS~alGFyC~te~DFedl~~~i~~   61 (124)
                      +.+++.|.+.+.++++.+++++++
T Consensus        64 ~~~~~~~~~~~~~d~~~~~~~l~~   87 (121)
T cd07251          64 SGITLAHNVRSEEEVDAVLARAAA   87 (121)
T ss_pred             cceEEEEEcCCHHHHHHHHHHHHh
Confidence            356789999999999999999988


No 26 
>cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain. Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain. Cool/Pix contains an N-terminal SH3 domain followed by a RhoGEF (DH) and PH domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=29.57  E-value=54  Score=24.15  Aligned_cols=25  Identities=12%  Similarity=0.298  Sum_probs=20.1

Q ss_pred             cCCccceeecccCChHHHHHHHHHHHHh
Q psy10473         35 HMDPSIAVCFLCKTENDFASLCSQIRAE   62 (124)
Q Consensus        35 ~mDPS~alGFyC~te~DFedl~~~i~~~   62 (124)
                      -++|.   =++|.+++|+..|...+++.
T Consensus        84 li~~i---~v~C~~~~e~~~Wl~hL~~~  108 (111)
T cd01225          84 LIERI---VVVCNNPQDAQEWVELLNAN  108 (111)
T ss_pred             CcCcE---EEEeCCHHHHHHHHHHHHhh
Confidence            34554   46899999999999999874


No 27 
>cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=29.24  E-value=61  Score=21.08  Aligned_cols=23  Identities=17%  Similarity=0.372  Sum_probs=20.5

Q ss_pred             ceeecccCChHHHHHHHHHHHHh
Q psy10473         40 IAVCFLCKTENDFASLCSQIRAE   62 (124)
Q Consensus        40 ~alGFyC~te~DFedl~~~i~~~   62 (124)
                      .-|+|-+.+.++++.+++++++.
T Consensus        72 ~hi~f~v~~~~~v~~~~~~l~~~   94 (125)
T cd07241          72 AHLAFSVGSKEAVDELTERLRAD   94 (125)
T ss_pred             EEEEEECCCHHHHHHHHHHHHHC
Confidence            35999999999999999999883


No 28 
>cd09013 BphC-JF8_N_like N-terminal, non-catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp. JF8 and similar proteins. 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC) catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, a key step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). BphC belongs to the type I extradiol dioxygenase family, which requires a metal ion in the active site in its catalytic mechanism. Polychlorinated biphenyl degrading bacteria demonstrate a multiplicity of BphCs. This subfamily of BphC is represented by the enzyme purified from the thermophilic biphenyl and naphthalene degrader, Bacillus sp. JF8. The members in this family of BphC enzymes may use either Mn(II) or Fe(II) as cofactors. The enzyme purified from Bacillus sp. JF8 is Mn(II)-dependent, however, the enzyme from Rhodococcus jostii RHAI has Fe(II) bound to it. BphC_JF8 is thermostable and its optimum activity is at 85 degrees C
Probab=27.75  E-value=66  Score=21.42  Aligned_cols=21  Identities=5%  Similarity=0.200  Sum_probs=19.9

Q ss_pred             eeecccCChHHHHHHHHHHHH
Q psy10473         41 AVCFLCKTENDFASLCSQIRA   61 (124)
Q Consensus        41 alGFyC~te~DFedl~~~i~~   61 (124)
                      .+||...++++++.+.+++++
T Consensus        65 h~af~v~~~~~v~~~~~~l~~   85 (121)
T cd09013          65 HIAWRASSPEALERRVAALEA   85 (121)
T ss_pred             EEEEEcCCHHHHHHHHHHHHH
Confidence            599999999999999999988


No 29 
>cd08362 BphC5-RrK37_N_like N-terminal, non-catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Rhodococcus rhodochrous K37, and similar proteins. 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC) catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, the third step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). The enzyme contains a N-terminal and a C-terminal domain of similar structure fold, resulting from an ancient gene duplication. BphC belongs to the type I extradiol dioxygenase family, which requires a metal in the active site for its catalytic activity. Polychlorinated biphenyl degrading bacteria demonstrate multiplicity of BphCs. Bacterium Rhodococcus rhodochrous K37 has eight genes encoding BphC enzymes. This family includes the N-terminal domain of BphC5-RrK37. The crystal structure of the protein from Novosphingobium aromaticivorans has a Mn(II)in the active site, although most proteins of type I extradiol dioxyge
Probab=25.92  E-value=75  Score=20.76  Aligned_cols=22  Identities=27%  Similarity=0.356  Sum_probs=20.2

Q ss_pred             ceeecccCChHHHHHHHHHHHH
Q psy10473         40 IAVCFLCKTENDFASLCSQIRA   61 (124)
Q Consensus        40 ~alGFyC~te~DFedl~~~i~~   61 (124)
                      -.++|.|.+.++++.+.+++++
T Consensus        60 ~~~~~~v~~~~~l~~~~~~l~~   81 (120)
T cd08362          60 DVVSFSVASRADVDALARQVAA   81 (120)
T ss_pred             ceEEEEeCCHHHHHHHHHHHHH
Confidence            4689999999999999999997


No 30 
>PRK06724 hypothetical protein; Provisional
Probab=25.07  E-value=73  Score=22.49  Aligned_cols=21  Identities=5%  Similarity=0.289  Sum_probs=19.5

Q ss_pred             eeecccCChHHHHHHHHHHHH
Q psy10473         41 AVCFLCKTENDFASLCSQIRA   61 (124)
Q Consensus        41 alGFyC~te~DFedl~~~i~~   61 (124)
                      -+||-+.++++++.+++++++
T Consensus        66 h~af~v~~~~dvd~~~~~l~~   86 (128)
T PRK06724         66 HICYQAINRKVVDEVAEFLSS   86 (128)
T ss_pred             eEEEecCChHHHHHHHHHHHH
Confidence            588999999999999999988


No 31 
>cd07240 ED_TypeI_classII_N N-terminal domain of type I, class II extradiol dioxygenases; non-catalytic domain. This family contains the N-terminal, non-catalytic, domain of type I, class II extradiol dioxygenases. Dioxygenases catalyze the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms, resulting in the cleavage of aromatic rings. Two major groups of dioxygenases have been identified according to the cleavage site; extradiol enzymes cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon, whereas intradiol enzymes cleave the aromatic ring between two hydroxyl groups. Extradiol dioxygenases are classified into type I and type II enzymes. Type I extradiol dioxygenases include class I and class II enzymes. These two classes of enzymes show sequence similarity; the two-domain class II enzymes evolved from a class I enzyme through gene duplication. The extradiol dioxygenases represented in this fa
Probab=24.54  E-value=83  Score=20.30  Aligned_cols=21  Identities=29%  Similarity=0.512  Sum_probs=19.5

Q ss_pred             eeecccCChHHHHHHHHHHHH
Q psy10473         41 AVCFLCKTENDFASLCSQIRA   61 (124)
Q Consensus        41 alGFyC~te~DFedl~~~i~~   61 (124)
                      -++|.+.+.++++.+.+++++
T Consensus        60 h~~~~v~~~~~v~~~~~~l~~   80 (117)
T cd07240          60 ALGFEVASEEDLEALAAHLEA   80 (117)
T ss_pred             eEEEEcCCHHHHHHHHHHHHH
Confidence            479999999999999999988


No 32 
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain. Akt pleckstrin homology (PH) domain.  Akt (Protein Kinase B (PKB)) is a phosphatidylinositol 3'-kinase (PI3K)-dependent Ser/Thr kinase. The PH domain recruits Akt to the plasma membrane by binding to phosphoinositides (PtdIns-3,4-P2) and is required for activation. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=24.44  E-value=69  Score=21.97  Aligned_cols=20  Identities=10%  Similarity=0.159  Sum_probs=18.1

Q ss_pred             ecccCChHHHHHHHHHHHHh
Q psy10473         43 CFLCKTENDFASLCSQIRAE   62 (124)
Q Consensus        43 GFyC~te~DFedl~~~i~~~   62 (124)
                      =|+|.|+++-+.|.+.|+.+
T Consensus        82 ~f~a~s~ee~~eWi~ai~~v  101 (102)
T cd01241          82 TFHVESPEEREEWIHAIQTV  101 (102)
T ss_pred             EEEeCCHHHHHHHHHHHHhh
Confidence            68899999999999999874


No 33 
>cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=24.11  E-value=84  Score=20.86  Aligned_cols=22  Identities=9%  Similarity=0.220  Sum_probs=20.1

Q ss_pred             ceeecccCChHHHHHHHHHHHH
Q psy10473         40 IAVCFLCKTENDFASLCSQIRA   61 (124)
Q Consensus        40 ~alGFyC~te~DFedl~~~i~~   61 (124)
                      -.++|-+.+.++++.+.+++++
T Consensus        70 ~hia~~v~~~~d~~~~~~~l~~   91 (128)
T cd07242          70 HHLAFRAPSREAVDELYARLAK   91 (128)
T ss_pred             eEEEEEcCCHHHHHHHHHHHHH
Confidence            4699999999999999999988


No 34 
>cd06404 PB1_aPKC PB1 domain is an essential modular domain of the atypical protein kinase C (aPKC) which in complex with Par6 and Par3  proteins is crucial for establishment of apical-basal polarity of animal cells. PB1 domain is a modular domain mediating specific protein-protein interaction which play roles in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi,
Probab=22.20  E-value=85  Score=22.00  Aligned_cols=32  Identities=41%  Similarity=0.802  Sum_probs=22.1

Q ss_pred             cccccCCccceeecccCChHHHHHHHHHHHHhhc-CCCCCcEEE
Q psy10473         31 LHILHMDPSIAVCFLCKTENDFASLCSQIRAELR-PEQQPLFEL   73 (124)
Q Consensus        31 m~i~~mDPS~alGFyC~te~DFedl~~~i~~~l~-~~~~PLF~v   73 (124)
                      +-+..+|||+.          |+.||+.++.+.. ...+| |++
T Consensus        11 i~it~~d~~~s----------~e~L~~~v~~~c~~~~~q~-ft~   43 (83)
T cd06404          11 IMITSIDPSIS----------LEELCNEVRDMCRFHNDQP-FTL   43 (83)
T ss_pred             EEEEEcCCCcC----------HHHHHHHHHHHhCCCCCCc-EEE
Confidence            44566777654          8999999999776 44445 555


No 35 
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain. RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain. This protein has a domain architecture of SH2-SH3-SH2-PH-C2-Ras_GAP. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPAses, adaptors, a well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=21.94  E-value=96  Score=21.81  Aligned_cols=30  Identities=10%  Similarity=0.347  Sum_probs=24.2

Q ss_pred             ccccCCccc-eeecccCChHHHHHHHHHHHH
Q psy10473         32 HILHMDPSI-AVCFLCKTENDFASLCSQIRA   61 (124)
Q Consensus        32 ~i~~mDPS~-alGFyC~te~DFedl~~~i~~   61 (124)
                      -|.-..||- .+-|+|.+.++-+.|++.|++
T Consensus        67 cFel~~~~~~~~y~~~a~~~er~~Wi~~l~~   97 (98)
T cd01245          67 CFQIVERALPTVYYSCRSSEERDKWIESLQA   97 (98)
T ss_pred             EEEEecCCCCeEEEEeCCHHHHHHHHHHHhc
Confidence            344456666 778999999999999999975


No 36 
>PF03108 DBD_Tnp_Mut:  MuDR family transposase;  InterPro: IPR004332 The plant MuDR transposase domain is present in plant proteins that are presumed to be the transposases for Mutator transposable elements [, ]. The function of these proteins is unknown. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=21.72  E-value=90  Score=19.58  Aligned_cols=25  Identities=12%  Similarity=0.271  Sum_probs=22.0

Q ss_pred             CccceeecccCChHHHHHHHHHHHH
Q psy10473         37 DPSIAVCFLCKTENDFASLCSQIRA   61 (124)
Q Consensus        37 DPS~alGFyC~te~DFedl~~~i~~   61 (124)
                      ||.+.+|-...|.++|........-
T Consensus         1 n~~l~~G~~F~~~~e~k~av~~yai   25 (67)
T PF03108_consen    1 NPELEVGQTFPSKEEFKEAVREYAI   25 (67)
T ss_pred             CCccccCCEECCHHHHHHHHHHHHH
Confidence            7999999999999999988877754


No 37 
>cd07266 HPCD_N_class_II N-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD); belongs to the type I class II family of extradiol dioxygenases. This subfamily contains the N-terminal, non-catalytic, domain of HPCD. HPCD catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate. The aromatic ring of 4-hydroxyphenylacetate is opened by this dioxygenase to yield the 3,4-diol product, 2-hydroxy-5-carboxymethylmuconate semialdehyde. HPCD is a homotetramer and each monomer contains two structurally homologous barrel-shaped domains at the N- and C-terminus. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism. Most extradiol dioxygenases contain Fe(II) in their active site, but HPCD can be activated by either Mn(II) or Fe(II). These enzymes belong to the type I class II family of extradiol dioxygenases. The class III 3,4-dihydroxyphenylacetate 2,3-dioxygenases belong to a differ
Probab=21.72  E-value=1e+02  Score=20.29  Aligned_cols=23  Identities=13%  Similarity=0.190  Sum_probs=20.6

Q ss_pred             cceeecccCChHHHHHHHHHHHH
Q psy10473         39 SIAVCFLCKTENDFASLCSQIRA   61 (124)
Q Consensus        39 S~alGFyC~te~DFedl~~~i~~   61 (124)
                      -..++|-+.+.++++.+.+++++
T Consensus        61 ~~hi~~~v~~~~dv~~~~~~l~~   83 (121)
T cd07266          61 LGHIAFRVRSEEDLDKAEAFFQE   83 (121)
T ss_pred             eeEEEEECCCHHHHHHHHHHHHH
Confidence            45689999999999999999988


No 38 
>PF07433 DUF1513:  Protein of unknown function (DUF1513);  InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=21.42  E-value=49  Score=28.09  Aligned_cols=19  Identities=26%  Similarity=0.455  Sum_probs=15.5

Q ss_pred             cCCCcc-ccccccCCcccee
Q psy10473         24 HCPQAS-RLHILHMDPSIAV   42 (124)
Q Consensus        24 HC~~pr-rm~i~~mDPS~al   42 (124)
                      |-..-| ||++..|+|||++
T Consensus       123 hpd~GR~kLNl~tM~psL~~  142 (305)
T PF07433_consen  123 HPDSGRAKLNLDTMQPSLVY  142 (305)
T ss_pred             CcccCceecChhhcCCceEE
Confidence            445556 9999999999986


No 39 
>cd08361 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC). This subfamily contains the N-terminal, non-catalytic, domain of PpCmtC. 2,3-dihydroxy-p-cumate-3,4-dioxygenase (CmtC of Pseudomonas putida F1) is a dioxygenase involved in the eight-step catabolism pathway of p-cymene. CmtC acts upon the reaction intermediate 2,3-dihydroxy-p-cumate, yielding 2-hydroxy-3-carboxy-6-oxo-7-methylocta-2,4-dienoate. The CmtC belongs to the type I family of extradiol dioxygenases. Fe2+ was suggested as a cofactor, same as other enzymes in the family. The type I family of extradiol dioxygenases contains two structurally homologous barrel-shaped domains at the N- and C-terminal. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism.
Probab=21.17  E-value=1e+02  Score=20.95  Aligned_cols=22  Identities=14%  Similarity=0.262  Sum_probs=20.2

Q ss_pred             ceeecccCChHHHHHHHHHHHH
Q psy10473         40 IAVCFLCKTENDFASLCSQIRA   61 (124)
Q Consensus        40 ~alGFyC~te~DFedl~~~i~~   61 (124)
                      ..+||-+.+++|++.+.+++++
T Consensus        61 ~~iaf~v~~~~dv~~~~~~l~~   82 (124)
T cd08361          61 QASGFELRDDDALESAATELEQ   82 (124)
T ss_pred             EEEEEEECCHHHHHHHHHHHHH
Confidence            4689999999999999999988


No 40 
>cd08364 FosX FosX, a fosfomycin resistance protein, catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1. This subfamily family contains FosX, a fosfomycin resistant protein. Fosfomycin inhibits the enzyme UDP-Nacetylglucosamine-3-enolpyruvyltransferase (MurA), which catalyzes the first committed step in bacterial cell wall biosynthesis. FosX catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of the configuration at C1 in the presence of Mn(II). The hydrated fosfomycin loses the inhibition activity. FosX is evolutionarily related to glyoxalase I and type I extradiol dioxygenases.
Probab=21.02  E-value=77  Score=21.85  Aligned_cols=19  Identities=21%  Similarity=0.412  Sum_probs=17.4

Q ss_pred             eecccCChHHHHHHHHHHHH
Q psy10473         42 VCFLCKTENDFASLCSQIRA   61 (124)
Q Consensus        42 lGFyC~te~DFedl~~~i~~   61 (124)
                      |||.+.+ ++++.|++++++
T Consensus        70 iaf~v~~-~~ld~~~~~l~~   88 (131)
T cd08364          70 IAFKISD-SDVDEYTERIKA   88 (131)
T ss_pred             EEEEcCH-HHHHHHHHHHHH
Confidence            8999976 899999999988


No 41 
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain. Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain. Clg contains a RhoGEF (DH) domain and a PH domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPases, adaptors, a well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=20.91  E-value=1.3e+02  Score=21.14  Aligned_cols=27  Identities=15%  Similarity=0.271  Sum_probs=24.4

Q ss_pred             CccceeecccCChHHHHHHHHHHHHhh
Q psy10473         37 DPSIAVCFLCKTENDFASLCSQIRAEL   63 (124)
Q Consensus        37 DPS~alGFyC~te~DFedl~~~i~~~l   63 (124)
                      .|...+=|.++|.++=..|+++|+..+
T Consensus        69 ~p~~~~~l~A~s~e~K~~W~~~i~~~i   95 (97)
T cd01222          69 DPKGALQLTARNREEKRIWTQQLKRAM   95 (97)
T ss_pred             CCceEEEEEecCHHHHHHHHHHHHHHh
Confidence            577889999999999999999999865


Done!