Diaphorina citri psyllid: psy10481

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MAKWGEGDPRWIVEERPDATNVNNWHWTEKNANQWSKDKIKALFLNLEIEMKTAKVKLKDIEKCEGEAVINNRKGKLIFFYEWDITINWTGFASGNDTEVQGKINIPNLSEENNVDEVEVCICTSILIN
ccccccccccEEEEEcccccccccCEECcccccHHHHHHHHHHHccEEEEEcccEEEEEEEEEEEEEEEEEEEccEEEEEEEEEEEEEEEEEEcccccEEEEEEEccccccccccccEEEEEEEEEEcc
*******DPRWIVEERPDATNVNNWHWTEKNANQWSKDKIKALFLNLEIEMKTAKVKLKDIEKCEGEAVINNRKGKLIFFYEWDITINWTGFASGNDTEVQGKINIPNLSEENNVDEVEVCICTSILI*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKWGEGDPRWIVEERPDATNVNNWHWTEKNANQWSKDKIKALFLNLEIEMKTAKVKLKDIEKCEGEAVINNRKGKLIFFYEWDITINWTGFASGNDTEVQGKINIPNLSEENNVDEVEVCICTSILIN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Activator of 90 kDa heat shock protein ATPase homolog 1 Co-chaperone that stimulates HSP90 ATPase activity. May affect a step in the endoplasmic reticulum to Golgi trafficking.confidentQ8BK64
Activator of 90 kDa heat shock protein ATPase homolog Co-chaperone that stimulates hspD/HSP90 ATPase activity.confidentQ55DB6
Activator of 90 kDa heat shock protein ATPase homolog 1 Cochaperone that stimulates HSP90 ATPase activity (By similarity). May affect a step in the endoplasmic reticulum to Golgi trafficking.confidentO95433

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001671 [MF]ATPase activator activityprobableGO:0003674, GO:0030234, GO:0060589, GO:0008047, GO:0060590
GO:0051087 [MF]chaperone bindingprobableGO:0003674, GO:0005488, GO:0005515

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1USU, chain B
Confidence level:very confident
Coverage over the Query: 28-125
View the alignment between query and template
View the model in PyMOL