Query         psy10482
Match_columns 84
No_of_seqs    132 out of 1024
Neff          7.2 
Searched_HMMs 46136
Date          Fri Aug 16 19:19:05 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10482.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10482hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01607 CBM_14:  Chitin bindin  99.5 8.8E-15 1.9E-19   79.2   3.1   45   28-75      8-53  (53)
  2 smart00494 ChtBD2 Chitin-bindi  99.5 3.2E-14 6.9E-19   77.3   5.2   53   19-76      2-55  (56)
  3 PF03427 CBM_19:  Carbohydrate   91.7    0.23   5E-06   28.1   2.7   21   36-56     35-55  (61)
  4 PRK10040 hypothetical protein;  77.0     3.7   8E-05   22.3   2.6   28   13-45     14-42  (52)
  5 TIGR02659 TTQ_MADH_Lt methylam  73.4     1.7 3.7E-05   29.6   1.0   41   30-71     73-120 (186)
  6 PF08475 Baculo_VP91_N:  Viral   69.3     7.7 0.00017   26.4   3.4   33   29-61    107-139 (183)
  7 PF09064 Tme5_EGF_like:  Thromb  60.8     8.3 0.00018   19.3   1.7   21   41-61     12-32  (34)
  8 PF12662 cEGF:  Complement Clr-  59.2     8.7 0.00019   17.6   1.5   16   50-68      5-20  (24)
  9 PF13511 DUF4124:  Domain of un  50.0     7.5 0.00016   20.9   0.6   25    7-31      5-29  (60)
 10 cd00064 FU Furin-like repeats.  44.9      20 0.00043   18.4   1.8   15   50-67     34-48  (49)
 11 PF07645 EGF_CA:  Calcium-bindi  43.7      17 0.00038   18.2   1.4   29   33-61     10-39  (42)
 12 PF02975 Me-amine-dh_L:  Methyl  42.1     2.4 5.1E-05   27.1  -2.5   41   30-71     11-58  (123)
 13 PF00220 Hormone_4:  Neurohypop  40.1      14 0.00031   13.1   0.5    6   49-54      4-9   (9)
 14 PF08779 SARS_X4:  SARS coronav  37.5      26 0.00056   20.5   1.5   19   38-56      5-25  (84)
 15 PF13948 DUF4215:  Domain of un  34.2      40 0.00087   17.5   1.9    8   50-57     20-27  (47)
 16 PF07771 TSGP1:  Tick salivary   32.3      33 0.00071   21.7   1.6   24   15-43     19-45  (120)
 17 cd00109 KU BPTI/Kunitz family   30.0      48   0.001   17.2   1.8   23   53-78     17-39  (54)
 18 PF06387 Calcyon:  D1 dopamine   28.9      36 0.00079   23.2   1.4   17   44-60    106-122 (186)
 19 PF07403 DUF1505:  Protein of u  27.7      62  0.0013   20.5   2.2   10   29-38     30-39  (114)
 20 PF07127 Nodulin_late:  Late no  26.9      98  0.0021   16.4   2.7   20    3-22     13-32  (54)
 21 smart00197 SAA Serum amyloid A  26.3      15 0.00033   22.7  -0.7   25   30-54     25-49  (103)
 22 PHA02714 CD-30-like protein; P  24.8      39 0.00084   21.0   0.9   18   47-67     20-37  (110)
 23 PF01826 TIL:  Trypsin Inhibito  24.6      38 0.00083   17.7   0.8   16   41-60     31-46  (55)
 24 PF12191 stn_TNFRSF12A:  Tumour  23.9      41 0.00088   21.7   0.9   16   49-67     34-49  (129)
 25 PF09717 CPW_WPC:  Plasmodium f  21.5      73  0.0016   17.2   1.5   29   47-79      5-35  (60)
 26 PHA02067 hypothetical protein   21.1      75  0.0016   22.3   1.8   12   12-23     15-26  (221)
 27 KOG2397|consensus               20.6 1.1E+02  0.0024   23.9   2.8   22   40-61     65-88  (480)
 28 TIGR01492 CPW_WPC Plasmodium f  20.4   1E+02  0.0022   16.9   2.0   11   49-59      8-18  (62)
 29 smart00131 KU BPTI/Kunitz fami  20.2      88  0.0019   16.1   1.6   21   54-77     18-38  (53)

No 1  
>PF01607 CBM_14:  Chitin binding Peritrophin-A domain;  InterPro: IPR002557 This entry represents a chitin binding domain []. It is found in (amongst others) the Peritrophin-A chitin binding proteins, particularly the peritrophic matrix proteins of insects and animal chitinases [, , ]. Copies of the domain are also found in some baculoviruses. It is an extracellular domain that contains six conserved cysteines that probably form three disulphide bridges. Chitin binding has been demonstrated for a protein containing only two of these domains [].; GO: 0008061 chitin binding, 0006030 chitin metabolic process, 0005576 extracellular region; PDB: 1DQC_A.
Probab=99.52  E-value=8.8e-15  Score=79.17  Aligned_cols=45  Identities=36%  Similarity=0.897  Sum_probs=35.5

Q ss_pred             EccCccCCcccEEcCCCceeEeeCCCCCeEeccCCCccCCCCCCC-ccc
Q psy10482         28 TYPHPQLCDQFYKCTNGTLTLEQCENGLLYDGNGNVHNHCNYYWG-VDC   75 (84)
Q Consensus        28 ~~~~p~~C~~y~~C~~G~~~~~~Cp~Gl~Fd~~~~~~~~C~~~~~-v~C   75 (84)
                      +++++.+|++||+|.+|.++++.||.|++||+++   +.|++++. +.|
T Consensus         8 ~~~~~~~C~~Y~~C~~g~~~~~~C~~g~~fd~~~---~~C~~~~~~~~C   53 (53)
T PF01607_consen    8 FYPHPDDCRKYYQCVNGQAVEQRCPEGLYFDPSS---QRCVPPSNVVQC   53 (53)
T ss_dssp             EE--SS-SSEEEEEETTEEEEEE-TTS-EE-TTT---SSEE-TTT-TT-
T ss_pred             eEeCCCCCCEEEEeeCCcEECCCCcCCCEECcCc---CEEcCCccCCCC
Confidence            7899999999999999999999999999999999   99999998 666


No 2  
>smart00494 ChtBD2 Chitin-binding domain type 2.
Probab=99.52  E-value=3.2e-14  Score=77.30  Aligned_cols=53  Identities=38%  Similarity=0.968  Sum_probs=48.1

Q ss_pred             CCCCCC-CCeEccCccCCcccEEcCCCceeEeeCCCCCeEeccCCCccCCCCCCCcccC
Q psy10482         19 GCPEPY-GVQTYPHPQLCDQFYKCTNGTLTLEQCENGLLYDGNGNVHNHCNYYWGVDCG   76 (84)
Q Consensus        19 ~C~~~~-g~~~~~~p~~C~~y~~C~~G~~~~~~Cp~Gl~Fd~~~~~~~~C~~~~~v~C~   76 (84)
                      .|+... |  +++||.+|++||+|.+|.++.+.||.|++||..+   +.|++++.++|.
T Consensus         2 ~C~~~~~g--~~~~~~~C~~y~~C~~~~~~~~~C~~g~~f~~~~---~~C~~~~~~~C~   55 (56)
T smart00494        2 ECPGRGDG--LYPHPTDCSKYYQCSNGRPIVGSCPAGLVFDPAT---QTCDWPDNVGCG   55 (56)
T ss_pred             cCCCCCCc--cccCcccCCeeEEcCCCcEEeccCcCCCeECCCC---CCcCCcccCCCC
Confidence            466642 4  8999999999999999999999999999999999   999999999885


No 3  
>PF03427 CBM_19:  Carbohydrate binding domain (family 19);  InterPro: IPR005089 A carbohydrate-binding module (CBM) is defined as a contiguous amino acid sequence within a carbohydrate-active enzyme with a discreet fold having carbohydrate-binding activity. A few exceptions are CBMs in cellulosomal scaffolding proteins and rare instances of independent putative CBMs. The requirement of CBMs existing as modules within larger enzymes sets this class of carbohydrate-binding protein apart from other non-catalytic sugar binding proteins such as lectins and sugar transport proteins. CBMs were previously classified as cellulose-binding domains (CBDs) based on the initial discovery of several modules that bound cellulose [, ]. However, additional modules in carbohydrate-active enzymes are continually being found that bind carbohydrates other than cellulose yet otherwise meet the CBM criteria, hence the need to reclassify these polypeptides using more inclusive terminology. Previous classification of cellulose-binding domains were based on amino acid similarity. Groupings of CBDs were called "Types" and numbered with roman numerals (e.g. Type I or Type II CBDs). In keeping with the glycoside hydrolase classification, these groupings are now called families and numbered with Arabic numerals. Families 1 to 13 are the same as Types I to XIII. For a detailed review on the structure and binding modes of CBMs see []. This entry represents CBM19 from CAZY which consists of 60-70 residues with chitin-binding function.; GO: 0004568 chitinase activity, 0006032 chitin catabolic process
Probab=91.72  E-value=0.23  Score=28.12  Aligned_cols=21  Identities=29%  Similarity=0.656  Sum_probs=19.1

Q ss_pred             cccEEcCCCceeEeeCCCCCe
Q psy10482         36 DQFYKCTNGTLTLEQCENGLL   56 (84)
Q Consensus        36 ~~y~~C~~G~~~~~~Cp~Gl~   56 (84)
                      .+|-.|.+|.++...||.|+.
T Consensus        35 G~faiC~~G~Wv~~~C~~Gt~   55 (61)
T PF03427_consen   35 GSFAICDHGTWVITPCPAGTT   55 (61)
T ss_pred             CCEEEcCCCcEEEeeCCCCCE
Confidence            369999999999999999985


No 4  
>PRK10040 hypothetical protein; Provisional
Probab=77.03  E-value=3.7  Score=22.30  Aligned_cols=28  Identities=18%  Similarity=0.420  Sum_probs=19.9

Q ss_pred             ccCCCCCCCCCCCCeEccCccCC-cccEEcCCCc
Q psy10482         13 LLQAPSGCPEPYGVQTYPHPQLC-DQFYKCTNGT   45 (84)
Q Consensus        13 ~~~~~~~C~~~~g~~~~~~p~~C-~~y~~C~~G~   45 (84)
                      ....+..|+++.|.  +.   .| ..++.|.+|.
T Consensus        14 a~a~n~PCSG~KGG--is---~C~g~~FvCnDGS   42 (52)
T PRK10040         14 ADAGNKPCSGKKGG--IS---HCTGGKFVCNDGS   42 (52)
T ss_pred             HHhcCCCCCCCCCC--cc---cccCCEEEeCCCc
Confidence            45678899998762  44   45 4588999885


No 5  
>TIGR02659 TTQ_MADH_Lt methylamine dehydrogenase light chain. This family consists of the light chain of methylamine dehydrogenase light chain, a periplasmic enzyme. This subunit contains a tryptophan tryptophylquinone (TTQ) prothetic group derived from Trp-114 and Trp-165 of the precursor, numbered according to the sequence from Paracoccus denitrificans. The enzyme forms a complex with the type I blue copper protein amicyanin and cytochrome. Electron transfer procedes from TQQ to the copper and then to the heme group of the cytochrome.
Probab=73.43  E-value=1.7  Score=29.58  Aligned_cols=41  Identities=22%  Similarity=0.400  Sum_probs=32.2

Q ss_pred             cCccCCcccEEcC-CCc------eeEeeCCCCCeEeccCCCccCCCCCC
Q psy10482         30 PHPQLCDQFYKCT-NGT------LTLEQCENGLLYDGNGNVHNHCNYYW   71 (84)
Q Consensus        30 ~~p~~C~~y~~C~-~G~------~~~~~Cp~Gl~Fd~~~~~~~~C~~~~   71 (84)
                      .||..|+.|-+|. +|.      -..-+||+|..-.+.+ |.++|.-|.
T Consensus        73 ~Dp~sCdYWRyCaiDG~LCsCCGGs~tsCPPGTe~Sp~s-WiGTC~NP~  120 (186)
T TIGR02659        73 NDIQACDYWRHCSIDGNICDCSGGSLTSCPPGTKLATSS-WVASCYNPT  120 (186)
T ss_pred             CCCcccchhhhcccCCceEcCcCCCCcCCCCCCCCCCce-eEEeccCCC
Confidence            6899999999996 664      4577899999888877 556776664


No 6  
>PF08475 Baculo_VP91_N:  Viral capsid protein 91 N-terminal;  InterPro: IPR013682 This domain is found in Baculoviridae including the nucleopolyhedrovirus at the N terminus of the viral capsid protein 91 (VP91) []. 
Probab=69.25  E-value=7.7  Score=26.45  Aligned_cols=33  Identities=24%  Similarity=0.394  Sum_probs=28.8

Q ss_pred             ccCccCCcccEEcCCCceeEeeCCCCCeEeccC
Q psy10482         29 YPHPQLCDQFYKCTNGTLTLEQCENGLLYDGNG   61 (84)
Q Consensus        29 ~~~p~~C~~y~~C~~G~~~~~~Cp~Gl~Fd~~~   61 (84)
                      -+|+.+=++|..-.+-....+.||.+..||...
T Consensus       107 ~~~~~d~~kF~~~~DDGwv~~~CP~~~~FD~~~  139 (183)
T PF08475_consen  107 RPHPNDPTKFIARGDDGWVDMDCPENERFDGNK  139 (183)
T ss_pred             ecCCCCCceEEEEecCCcEEEeCCCcccccccc
Confidence            478888899988776669999999999999986


No 7  
>PF09064 Tme5_EGF_like:  Thrombomodulin like fifth domain, EGF-like;  InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet. Disulphide pairing, however, is not of the usual 1-3, 2-4, 5-6 type; rather 1-2, 3-4, 5-6 pairing is found. Its extended major sheet (strands beta-2 and beta-3 and the connecting loop) projects into thrombin's active site groove. This domain is required for interaction of thrombomodulin with thrombin, and subsequent activation of protein-C []. ; GO: 0004888 transmembrane signaling receptor activity, 0016021 integral to membrane
Probab=60.83  E-value=8.3  Score=19.28  Aligned_cols=21  Identities=19%  Similarity=0.444  Sum_probs=14.1

Q ss_pred             cCCCceeEeeCCCCCeEeccC
Q psy10482         41 CTNGTLTLEQCENGLLYDGNG   61 (84)
Q Consensus        41 C~~G~~~~~~Cp~Gl~Fd~~~   61 (84)
                      |.......=.||+|++.|...
T Consensus        12 CDpn~~~~C~CPeGyIlde~~   32 (34)
T PF09064_consen   12 CDPNSPGQCFCPEGYILDEGS   32 (34)
T ss_pred             cCCCCCCceeCCCceEecCCc
Confidence            444444455799999988764


No 8  
>PF12662 cEGF:  Complement Clr-like EGF-like
Probab=59.17  E-value=8.7  Score=17.60  Aligned_cols=16  Identities=25%  Similarity=0.740  Sum_probs=12.5

Q ss_pred             eCCCCCeEeccCCCccCCC
Q psy10482         50 QCENGLLYDGNGNVHNHCN   68 (84)
Q Consensus        50 ~Cp~Gl~Fd~~~~~~~~C~   68 (84)
                      .|++|+..++..   ..|.
T Consensus         5 ~C~~Gy~l~~d~---~~C~   20 (24)
T PF12662_consen    5 SCPPGYQLSPDG---RSCE   20 (24)
T ss_pred             eCCCCCcCCCCC---Cccc
Confidence            588888888877   7774


No 9  
>PF13511 DUF4124:  Domain of unknown function (DUF4124)
Probab=50.03  E-value=7.5  Score=20.86  Aligned_cols=25  Identities=16%  Similarity=0.171  Sum_probs=15.2

Q ss_pred             HHhhhcccCCCCCCCCCCCCeEccC
Q psy10482          7 VVLAQPLLQAPSGCPEPYGVQTYPH   31 (84)
Q Consensus         7 ~~~~~~~~~~~~~C~~~~g~~~~~~   31 (84)
                      +|.+.+....-..|...+|.+.|.|
T Consensus         5 ~l~~~a~aa~vYk~~D~~G~v~ysd   29 (60)
T PF13511_consen    5 LLAASAAAAEVYKWVDENGVVHYSD   29 (60)
T ss_pred             HHhHHHhhccEEEEECCCCCEEECc
Confidence            3334444456778887778656654


No 10 
>cd00064 FU Furin-like repeats. Cysteine rich region. Exact function of the domain is not known. Furin is a serine-kinase dependent proprotein processor. Other members of this family include endoproteases and cell surface receptors.
Probab=44.90  E-value=20  Score=18.36  Aligned_cols=15  Identities=33%  Similarity=0.838  Sum_probs=11.9

Q ss_pred             eCCCCCeEeccCCCccCC
Q psy10482         50 QCENGLLYDGNGNVHNHC   67 (84)
Q Consensus        50 ~Cp~Gl~Fd~~~~~~~~C   67 (84)
                      .||+|.+++...   ..|
T Consensus        34 ~C~~~~~~~~~~---~~C   48 (49)
T cd00064          34 ECPEGTYADTEG---GVC   48 (49)
T ss_pred             cCCCCceecCcC---CcC
Confidence            799999998666   555


No 11 
>PF07645 EGF_CA:  Calcium-binding EGF domain;  InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins. Many of these proteins require calcium for their biological function and a calcium-binding site has been found at the N terminus of some EGF-like domains []. Calcium-binding may be crucial for numerous protein-protein interactions. For human coagulation factor IX it has been shown [] that the calcium-ligands form a pentagonal bipyramid. The first, third and fourth conserved negatively charged or polar residues are side chain ligands. The latter is possibly hydroxylated (see aspartic acid and asparagine hydroxylation site) []. A conserved aromatic residue, as well as the second conserved negative residue, are thought to be involved in stabilising the calcium-binding site. As in non-calcium binding EGF-like domains, there are six conserved cysteines and the structure of both types is very similar as calcium-binding induces only strictly local structural changes [].  +------------------+ +---------+ | | | | nxnnC-x(3,14)-C-x(3,7)-CxxbxxxxaxC-x(1,6)-C-x(8,13)-Cx | | +------------------+ 'n': negatively charged or polar residue [DEQN] 'b': possibly beta-hydroxylated residue [DN] 'a': aromatic amino acid 'C': cysteine, involved in disulphide bond 'x': any amino acid. ; GO: 0005509 calcium ion binding; PDB: 2VJ3_A 1TOZ_A 1LMJ_A 1UZQ_A 1UZK_A 1UZJ_B 1UZP_A 1EMO_A 1EMN_A 2RR0_A ....
Probab=43.68  E-value=17  Score=18.17  Aligned_cols=29  Identities=21%  Similarity=0.379  Sum_probs=20.7

Q ss_pred             cCCcccEEcCCC-ceeEeeCCCCCeEeccC
Q psy10482         33 QLCDQFYKCTNG-TLTLEQCENGLLYDGNG   61 (84)
Q Consensus        33 ~~C~~y~~C~~G-~~~~~~Cp~Gl~Fd~~~   61 (84)
                      ..|.....|.|- ..+.=.|++|+..+...
T Consensus        10 ~~C~~~~~C~N~~Gsy~C~C~~Gy~~~~~~   39 (42)
T PF07645_consen   10 HNCPENGTCVNTEGSYSCSCPPGYELNDDG   39 (42)
T ss_dssp             SSSSTTSEEEEETTEEEEEESTTEEECTTS
T ss_pred             CcCCCCCEEEcCCCCEEeeCCCCcEECCCC
Confidence            467667778764 35666799999977765


No 12 
>PF02975 Me-amine-dh_L:  Methylamine dehydrogenase, L chain;  InterPro: IPR013504 Methylamine dehydrogenase (1.4.99.3 from EC) is a periplasmic quinoprotein found in several methylotrophic bacteria []. It is induced when grown on methylamine as a carbon source MADH and catalyses the oxidative deamination of amines to their corresponding aldehydes. The redox cofactor of this enzyme is tryptophan tryptophylquinone (TTQ). Electrons derived from the oxidation of methylamine are passed to an electron acceptor, which is usually the blue-copper protein amicyanin (IPR002386 from INTERPRO).  RCH2NH2 + H2O + acceptor = RCHO + NH3 + reduced acceptor  MADH is a hetero-tetramer, comprised of two heavy subunits and two light subunits. The light subunit forms two antiparallel beta sheets, and contains the active site of this enzyme which is accessible via a hydrophobic channel between the heavy and light subunits. The redox cofactor TTQ is formed from two posttranlationally modified tryptophan residues within this subunit [].; GO: 0016638 oxidoreductase activity, acting on the CH-NH2 group of donors, 0009308 amine metabolic process, 0055114 oxidation-reduction process, 0042597 periplasmic space; PDB: 1MAE_L 1MAF_L 3C75_M 2MAD_L 2OJY_H 2IUP_H 2HJ4_D 2AGY_H 2AGX_D 2HXC_D ....
Probab=42.06  E-value=2.4  Score=27.06  Aligned_cols=41  Identities=20%  Similarity=0.343  Sum_probs=27.9

Q ss_pred             cCccCCcccEEcC-CCc------eeEeeCCCCCeEeccCCCccCCCCCC
Q psy10482         30 PHPQLCDQFYKCT-NGT------LTLEQCENGLLYDGNGNVHNHCNYYW   71 (84)
Q Consensus        30 ~~p~~C~~y~~C~-~G~------~~~~~Cp~Gl~Fd~~~~~~~~C~~~~   71 (84)
                      .||..|+.|-+|. +|.      ...-+||+|..-.+.+ |.++|.-|.
T Consensus        11 ~D~~sCdYWRyCaiDG~LCsCcGGs~tsCPPGte~Sp~s-WvGtC~NP~   58 (123)
T PF02975_consen   11 GDPTSCDYWRYCAIDGFLCSCCGGSVTSCPPGTEPSPVS-WVGTCRNPA   58 (123)
T ss_dssp             SHTTSTTBGGGTT-EEEBGGGGTSBTTCB-TT-EEESCE-EEEEEEETT
T ss_pred             CCcccccceeeecccCcEEcccCCCcccCCCCCccCcce-eEEEccCCC
Confidence            6788999988886 442      4567899999888876 445675554


No 13 
>PF00220 Hormone_4:  Neurohypophysial hormones, N-terminal Domain;  InterPro: IPR022423 Oxytocin (or ocytocin) and vasopressin [] are small (nine amino acid residues), structurally and functionally related neurohypophysial peptide hormones. Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland while vasopressin has a direct antidiuretic action on the kidney and also causes vasoconstriction of the peripheral vessels. Like the majority of active peptides, both hormones are synthesized as larger protein precursors that are enzymatically converted to their mature forms. Peptides belonging to this family are also found in birds, fish, reptiles and amphibians (mesotocin, isotocin, valitocin, glumitocin, aspargtocin, vasotocin, seritocin, asvatocin, phasvatocin), in worms (annetocin), octopi (cephalotocin), locust (locupressin or neuropeptide F1/F2) and in molluscs (conopressins G and S) [].  The pattern developed to detect this category of peptides spans their entire sequence and includes four invariant amino acid residues.  .; GO: 0005185 neurohypophyseal hormone activity, 0005576 extracellular region
Probab=40.09  E-value=14  Score=13.12  Aligned_cols=6  Identities=33%  Similarity=0.883  Sum_probs=3.0

Q ss_pred             eeCCCC
Q psy10482         49 EQCENG   54 (84)
Q Consensus        49 ~~Cp~G   54 (84)
                      ..||-|
T Consensus         4 ~nCP~G    9 (9)
T PF00220_consen    4 RNCPIG    9 (9)
T ss_pred             ccCCCC
Confidence            356544


No 14 
>PF08779 SARS_X4:  SARS coronavirus X4 like;  InterPro: IPR014888 The structure of the coronavirus X4 protein (also known as 7a and U122) shows similarities to the immunoglobulin like fold and suggests a binding activity to integrin I domains []. ; PDB: 1XAK_A 1YO4_A.
Probab=37.45  E-value=26  Score=20.53  Aligned_cols=19  Identities=32%  Similarity=0.749  Sum_probs=12.7

Q ss_pred             cEEcCCCcee--EeeCCCCCe
Q psy10482         38 FYKCTNGTLT--LEQCENGLL   56 (84)
Q Consensus        38 y~~C~~G~~~--~~~Cp~Gl~   56 (84)
                      |..|..|..+  ...||+|.+
T Consensus         5 yqecvrgttvllkepc~~~ty   25 (84)
T PF08779_consen    5 YQECVRGTTVLLKEPCPSGTY   25 (84)
T ss_dssp             EEEEETTSEEEEE-SSTT-EE
T ss_pred             HHhHhcCceEEecCCCCCCCc
Confidence            6679998744  477999865


No 15 
>PF13948 DUF4215:  Domain of unknown function (DUF4215)
Probab=34.20  E-value=40  Score=17.54  Aligned_cols=8  Identities=25%  Similarity=0.920  Sum_probs=4.1

Q ss_pred             eCCCCCeE
Q psy10482         50 QCENGLLY   57 (84)
Q Consensus        50 ~Cp~Gl~F   57 (84)
                      .|.+|.+-
T Consensus        20 ~CGDgii~   27 (47)
T PF13948_consen   20 ICGDGIIV   27 (47)
T ss_pred             ccCCCeEE
Confidence            45555544


No 16 
>PF07771 TSGP1:  Tick salivary peptide group 1;  InterPro: IPR011694 This entry contains a group of peptides derived from a salivary gland cDNA library of the tick Ixodes scapularis (Black-legged tick) []. Also present are peptides from a related tick species, Ixodes ricinus (Sheep tick). They are characterised by a putative signal peptide, indicative of secretion, and conserved cysteine residues.
Probab=32.33  E-value=33  Score=21.73  Aligned_cols=24  Identities=29%  Similarity=0.690  Sum_probs=13.0

Q ss_pred             CCCCCCCCCCCCeEccCc---cCCcccEEcCC
Q psy10482         15 QAPSGCPEPYGVQTYPHP---QLCDQFYKCTN   43 (84)
Q Consensus        15 ~~~~~C~~~~g~~~~~~p---~~C~~y~~C~~   43 (84)
                      .....||....   -+..   ..|.-|  |.+
T Consensus        19 ~~~~~Cp~~~r---~~~~~~~~~C~YY--C~~   45 (120)
T PF07771_consen   19 AAAHGCPDKTR---PASDTNREGCNYY--CWN   45 (120)
T ss_pred             hhhhcCCCCCc---CCCCCCCCCcEEE--cCC
Confidence            34457888643   1222   347755  874


No 17 
>cd00109 KU BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold. BPTI (bovine pancreatic trypsin inhibitor) is an extensively studied model structure.
Probab=30.00  E-value=48  Score=17.18  Aligned_cols=23  Identities=22%  Similarity=0.508  Sum_probs=14.5

Q ss_pred             CCCeEeccCCCccCCCCCCCcccCCC
Q psy10482         53 NGLLYDGNGNVHNHCNYYWGVDCGNR   78 (84)
Q Consensus        53 ~Gl~Fd~~~~~~~~C~~~~~v~C~~r   78 (84)
                      .+.+||+++   +.|..-....|.+.
T Consensus        17 ~~~~yd~~~---~~C~~f~~~gc~~~   39 (54)
T cd00109          17 PRYYYDATT---KQCEPFTYGGCGGN   39 (54)
T ss_pred             cEEEEeCCC---CccceeECCCccCC
Confidence            467788888   77865444456543


No 18 
>PF06387 Calcyon:  D1 dopamine receptor-interacting protein (calcyon);  InterPro: IPR009431 This family consists of several D1 dopamine receptor-interacting (calcyon) proteins. D1/D5 dopamine receptors in the basal ganglia, hippocampus, and cerebral cortex modulate motor, reward, and cognitive behaviour. D1-like dopamine receptors likely modulate neocortical and hippocampal neuronal excitability and synaptic function via Ca2+ as well as cAMP-dependent signalling []. Defective calcyon proteins have been implicated in both attention-deficit/hyperactivity disorder (ADHD) [] and schizophrenia.; GO: 0050780 dopamine receptor binding, 0007212 dopamine receptor signaling pathway, 0016021 integral to membrane
Probab=28.93  E-value=36  Score=23.18  Aligned_cols=17  Identities=12%  Similarity=0.368  Sum_probs=13.0

Q ss_pred             CceeEeeCCCCCeEecc
Q psy10482         44 GTLTLEQCENGLLYDGN   60 (84)
Q Consensus        44 G~~~~~~Cp~Gl~Fd~~   60 (84)
                      ...+.+.||+|+++...
T Consensus       106 a~wYDqsCPdGFv~khk  122 (186)
T PF06387_consen  106 AIWYDQSCPDGFVLKHK  122 (186)
T ss_pred             eeeecccCCCcceeecc
Confidence            34667799999999743


No 19 
>PF07403 DUF1505:  Protein of unknown function (DUF1505);  InterPro: IPR009981 This family consists of several uncharacterised Caenorhabditis elegans proteins of around 115 resides in length. Members of this family contain 6 highly conserved cysteine residues. The function of this family is unknown.
Probab=27.75  E-value=62  Score=20.47  Aligned_cols=10  Identities=10%  Similarity=0.501  Sum_probs=5.5

Q ss_pred             ccCccCCccc
Q psy10482         29 YPHPQLCDQF   38 (84)
Q Consensus        29 ~~~p~~C~~y   38 (84)
                      +.+..+|..+
T Consensus        30 ~~~~~~C~~~   39 (114)
T PF07403_consen   30 WSSSKNCNDS   39 (114)
T ss_pred             eecCCccccc
Confidence            4556666443


No 20 
>PF07127 Nodulin_late:  Late nodulin protein;  InterPro: IPR009810 This family consists of several plant specific late nodulin sequences which are homologous to the Pisum sativum (Garden pea) ENOD3 protein. ENOD3 is expressed in the late stages of root nodule formation and contains two pairs of cysteine residues toward the proteins C terminus which may be involved in metal-binding [].; GO: 0046872 metal ion binding, 0009878 nodule morphogenesis
Probab=26.92  E-value=98  Score=16.39  Aligned_cols=20  Identities=20%  Similarity=0.267  Sum_probs=7.7

Q ss_pred             hhhHHHhhhcccCCCCCCCC
Q psy10482          3 SLFSVVLAQPLLQAPSGCPE   22 (84)
Q Consensus         3 ~~~~~~~~~~~~~~~~~C~~   22 (84)
                      +.+++++.+........|..
T Consensus        13 iflslflv~~~~~~~~~C~~   32 (54)
T PF07127_consen   13 IFLSLFLVVTNVDAIIPCKT   32 (54)
T ss_pred             HHHHHHHhhcccCCCcccCc
Confidence            33444433332323345533


No 21 
>smart00197 SAA Serum amyloid A proteins. Serum amyloid A proteins are induced during the acute-phase response. Secondary amyloidosis is characterised by the extracellular accumulation in tissues of SAA proteins. SAA proteins are apolipoproteins.
Probab=26.34  E-value=15  Score=22.75  Aligned_cols=25  Identities=12%  Similarity=0.267  Sum_probs=19.1

Q ss_pred             cCccCCcccEEcCCCceeEeeCCCC
Q psy10482         30 PHPQLCDQFYKCTNGTLTLEQCENG   54 (84)
Q Consensus        30 ~~p~~C~~y~~C~~G~~~~~~Cp~G   54 (84)
                      .+-.+|++|+.|..+.--.+.+|.|
T Consensus        25 AN~~nsDKYFharGNydAaqRGpgG   49 (103)
T smart00197       25 ANHQNADKYFHARGNYDAAQRGPGG   49 (103)
T ss_pred             hhhcccchhhhhhcchHHHhcCCcc
Confidence            4457899999998876666677765


No 22 
>PHA02714 CD-30-like protein; Provisional
Probab=24.79  E-value=39  Score=20.99  Aligned_cols=18  Identities=11%  Similarity=0.346  Sum_probs=13.7

Q ss_pred             eEeeCCCCCeEeccCCCccCC
Q psy10482         47 TLEQCENGLLYDGNGNVHNHC   67 (84)
Q Consensus        47 ~~~~Cp~Gl~Fd~~~~~~~~C   67 (84)
                      +..+|+.++++|++.   +.|
T Consensus        20 f~kqC~~dYY~Dpe~---g~C   37 (110)
T PHA02714         20 FGKTCPKDYYLEPED---GLC   37 (110)
T ss_pred             hhccCCCcccccCCC---Cce
Confidence            446899999999887   555


No 23 
>PF01826 TIL:  Trypsin Inhibitor like cysteine rich domain;  InterPro: IPR002919 This domain is found in proteinase inhibitors as well as in many extracellular proteins. The domain typically contains ten cysteine residues that form five disulphide bonds. The cysteine residues that form the disulphide bonds are 1-7, 2-6, 3-5, 4-10 and 8-9. This inhibitor domain belongs to MEROPS inhibitor family I8 (clan IA). Proteins containing this domain inhibit peptidases belonging to families S1 (IPR001254 from INTERPRO), S8 (IPR000209 from INTERPRO), and M4 (IPR001570 from INTERPRO) [] and are restricted to the chordata, nematoda, arthropoda and echinodermata. Examples of proteins containing this domain are:  chymotrypsin/elastase inhibitor from Ascaris suum (pig roundworm) Acp62F protein from Drosophila melanogaster  Bombina trypsin inhibitor from Bombina maxima (large-webbed bell toad) Bombyx subtilisin inhibitor from Bombyx mori (silk moth) von Willebrand factor ; PDB: 2P3F_N 1HX2_A 1CCV_A 1EAI_D 2H9E_C 1COU_A 1ATE_A 1ATB_A 1ATD_A 1ATA_A ....
Probab=24.56  E-value=38  Score=17.70  Aligned_cols=16  Identities=31%  Similarity=0.754  Sum_probs=11.9

Q ss_pred             cCCCceeEeeCCCCCeEecc
Q psy10482         41 CTNGTLTLEQCENGLLYDGN   60 (84)
Q Consensus        41 C~~G~~~~~~Cp~Gl~Fd~~   60 (84)
                      |..|    =.|++|++++..
T Consensus        31 C~~g----C~C~~G~v~~~~   46 (55)
T PF01826_consen   31 CVEG----CFCPPGYVRNDN   46 (55)
T ss_dssp             -ESE----EEETTTEEEETT
T ss_pred             CCcc----CCCCCCeeEcCC
Confidence            5554    469999999887


No 24 
>PF12191 stn_TNFRSF12A:  Tumour necrosis factor receptor stn_TNFRSF12A_TNFR domain;  InterPro: IPR022316 The tumour necrosis factor (TNF) receptor (TNFR) superfamily comprises more than 20 type-I transmembrane proteins. Family members are defined based on similarity in their extracellular domain - a region that contains many cysteine residues arranged in a specific repetitive pattern []. The cysteines allow formation of an extended rod-like structure, responsible for ligand binding []. Upon receptor activation, different intracellular signalling complexes are assembled for different members of the TNFR superfamily, depending on their intracellular domains and sequences []. Activation of TNFRs can therefore induce a range of disparate effects, including cell proliferation, differentiation, survival, or apoptotic cell death, depending upon the receptor involved []. TNFRs are widely distributed and play important roles in many crucial biological processes, such as lymphoid and neuronal development, innate and adaptive immunity, and maintenance of cellular homeostasis []. Drugs that manipulate their signalling have potential roles in the prevention and treatment of many diseases, such as viral infections, coronary heart disease, transplant rejection, and immune disease []. TNF receptor 12 (also known as TWEAK receptor, and fibroblast growth factor-inducible-14 (Fn14)) has been implicated in endothelial cell growth and migration []. The receptor may also play a role in cell-matrix interactions [].; PDB: 2KN0_A 2RPJ_A 2KMZ_A 2EQP_A.
Probab=23.92  E-value=41  Score=21.72  Aligned_cols=16  Identities=19%  Similarity=0.638  Sum_probs=10.8

Q ss_pred             eeCCCCCeEeccCCCccCC
Q psy10482         49 EQCENGLLYDGNGNVHNHC   67 (84)
Q Consensus        49 ~~Cp~Gl~Fd~~~~~~~~C   67 (84)
                      ..||.|..||+..   +.|
T Consensus        34 ~~Cp~G~sWs~dL---dkC   49 (129)
T PF12191_consen   34 TPCPRGSSWSADL---DKC   49 (129)
T ss_dssp             SSS-SSEEEETTT---TEE
T ss_pred             CCCCCCCcCcccc---ccc
Confidence            4677788888777   655


No 25 
>PF09717 CPW_WPC:  Plasmodium falciparum domain of unknown function (CPW_WPC);  InterPro: IPR006387 This entry represents a domain of about 61 residues in length with six well-conserved cysteine residues and six well-conserved aromatic sites. The domain can be found in tandem repeats. It is named for motifs of CPxxW and (less well conserved) WPC. Its function is unknown.
Probab=21.53  E-value=73  Score=17.20  Aligned_cols=29  Identities=14%  Similarity=0.290  Sum_probs=15.9

Q ss_pred             eEeeCCCCCeEeccCCCccCCCCCCCc--ccCCCC
Q psy10482         47 TLEQCENGLLYDGNGNVHNHCNYYWGV--DCGNRK   79 (84)
Q Consensus        47 ~~~~Cp~Gl~Fd~~~~~~~~C~~~~~v--~C~~r~   79 (84)
                      +...||.|.. ....   +.|..|...  .|..+.
T Consensus         5 ys~~CP~~W~-~~~~---~~C~ap~~Y~GpC~~~~   35 (60)
T PF09717_consen    5 YSQPCPEGWI-LSDD---GSCIAPDSYNGPCKRKI   35 (60)
T ss_pred             cccccccccc-cCCC---CeEcCCcccCCCCcCcc
Confidence            3445777766 4444   567666432  365543


No 26 
>PHA02067 hypothetical protein
Probab=21.12  E-value=75  Score=22.29  Aligned_cols=12  Identities=17%  Similarity=0.349  Sum_probs=8.4

Q ss_pred             cccCCCCCCCCC
Q psy10482         12 PLLQAPSGCPEP   23 (84)
Q Consensus        12 ~~~~~~~~C~~~   23 (84)
                      ....+++.|...
T Consensus        15 sA~AASFDCakA   26 (221)
T PHA02067         15 SAMAASFDCNTT   26 (221)
T ss_pred             cccCCCCCcccc
Confidence            446788999743


No 27 
>KOG2397|consensus
Probab=20.59  E-value=1.1e+02  Score=23.90  Aligned_cols=22  Identities=32%  Similarity=0.632  Sum_probs=15.1

Q ss_pred             EcCCCc--eeEeeCCCCCeEeccC
Q psy10482         40 KCTNGT--LTLEQCENGLLYDGNG   61 (84)
Q Consensus        40 ~C~~G~--~~~~~Cp~Gl~Fd~~~   61 (84)
                      -|.+|.  +-...||+|.+|...+
T Consensus        65 DC~DGsDEPGtsACpngkF~C~N~   88 (480)
T KOG2397|consen   65 DCLDGSDEPGTSACPNGKFYCVNQ   88 (480)
T ss_pred             cCCCCCCCCccccCCCCceeeeec
Confidence            366665  3346788888887766


No 28 
>TIGR01492 CPW_WPC Plasmodium falciparum CPW-WPC domain. This model represents a domain of about 61 residues in length with six well-conserved cysteine residues and six well-conserved aromatic sites. The domain can be found in tandem repeats, and is known so far only in Plasmodium falciparum. It is named for motifs of CPxxW and (less well conserved) WPC.
Probab=20.41  E-value=1e+02  Score=16.87  Aligned_cols=11  Identities=9%  Similarity=0.413  Sum_probs=4.9

Q ss_pred             eeCCCCCeEec
Q psy10482         49 EQCENGLLYDG   59 (84)
Q Consensus        49 ~~Cp~Gl~Fd~   59 (84)
                      ..||.|.....
T Consensus         8 ~~CP~~W~~~~   18 (62)
T TIGR01492         8 SPCPENWIQKN   18 (62)
T ss_pred             ccCCccceecC
Confidence            34555444433


No 29 
>smart00131 KU BPTI/Kunitz family of serine protease inhibitors. Serine protease inhibitors. One member of the family is encoded by an alternatively-spliced form of Alzheimer's amyloid beta-protein.
Probab=20.23  E-value=88  Score=16.05  Aligned_cols=21  Identities=24%  Similarity=0.509  Sum_probs=13.0

Q ss_pred             CCeEeccCCCccCCCCCCCcccCC
Q psy10482         54 GLLYDGNGNVHNHCNYYWGVDCGN   77 (84)
Q Consensus        54 Gl~Fd~~~~~~~~C~~~~~v~C~~   77 (84)
                      ..+||+.+   +.|..-....|..
T Consensus        18 ~w~yd~~~---~~C~~f~~~gc~~   38 (53)
T smart00131       18 RYYYDPET---GTCEPFTYGGCGG   38 (53)
T ss_pred             EEEEeCCC---CccceeECCCccC
Confidence            56777777   7776544445544


Done!