Query         psy10483
Match_columns 287
No_of_seqs    257 out of 1622
Neff          8.2 
Searched_HMMs 46136
Date          Fri Aug 16 19:19:54 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy10483.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/10483hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01607 CBM_14:  Chitin bindin  99.2 2.8E-11   6E-16   80.7   3.8   49   71-123     4-53  (53)
  2 smart00494 ChtBD2 Chitin-bindi  99.0 4.1E-10 8.9E-15   75.6   4.9   54   65-124     2-55  (56)
  3 PF01607 CBM_14:  Chitin bindin  99.0 2.8E-10 6.1E-15   75.8   3.4   45  141-187     5-49  (53)
  4 smart00494 ChtBD2 Chitin-bindi  98.9 1.9E-09   4E-14   72.4   4.3   47  223-271     9-55  (56)
  5 PF03427 CBM_19:  Carbohydrate   73.4     3.7 8.1E-05   27.9   2.6   21  154-174    35-55  (61)
  6 PF03427 CBM_19:  Carbohydrate   71.9     2.8   6E-05   28.5   1.7   21  232-253    35-55  (61)
  7 PF08475 Baculo_VP91_N:  Viral   48.2      28 0.00061   29.2   4.0   38   74-117   105-142 (183)
  8 PF08475 Baculo_VP91_N:  Viral   42.1      33 0.00072   28.8   3.5   44  225-274   107-150 (183)
  9 PF12662 cEGF:  Complement Clr-  33.4      32  0.0007   18.7   1.4   17  247-263     5-21  (24)
 10 cd00064 FU Furin-like repeats.  28.8      47   0.001   20.9   1.9   20  242-261    29-48  (49)
 11 PF01826 TIL:  Trypsin Inhibito  28.0      42 0.00092   21.7   1.6   18   25-43     36-53  (55)

No 1  
>PF01607 CBM_14:  Chitin binding Peritrophin-A domain;  InterPro: IPR002557 This entry represents a chitin binding domain []. It is found in (amongst others) the Peritrophin-A chitin binding proteins, particularly the peritrophic matrix proteins of insects and animal chitinases [, , ]. Copies of the domain are also found in some baculoviruses. It is an extracellular domain that contains six conserved cysteines that probably form three disulphide bridges. Chitin binding has been demonstrated for a protein containing only two of these domains [].; GO: 0008061 chitin binding, 0006030 chitin metabolic process, 0005576 extracellular region; PDB: 1DQC_A.
Probab=99.16  E-value=2.8e-11  Score=80.70  Aligned_cols=49  Identities=43%  Similarity=0.981  Sum_probs=37.5

Q ss_pred             CCCccccCCCCCCceEEecCCccCceeeCCCCCeecCCCCCcCccccCcc-ccC
Q psy10483         71 LKNSYYPDSIQCDLYYHCSDGQLVEEKLCPDGLLFDDSNPAHERCDTNVN-VEC  123 (287)
Q Consensus        71 ~~~G~~~~p~~C~~y~~C~~g~~~~~~~Cp~g~~Fd~~~~~~~~C~~~~~-~~C  123 (287)
                      ..+|+++++.+|++||+|.+|.+ .+++||.|++||..   +++|+++.. +.|
T Consensus         4 ~~~~~~~~~~~C~~Y~~C~~g~~-~~~~C~~g~~fd~~---~~~C~~~~~~~~C   53 (53)
T PF01607_consen    4 RGDGFYPHPDDCRKYYQCVNGQA-VEQRCPEGLYFDPS---SQRCVPPSNVVQC   53 (53)
T ss_dssp             -SSEEE--SS-SSEEEEEETTEE-EEEE-TTS-EE-TT---TSSEE-TTT-TT-
T ss_pred             cCCeeEeCCCCCCEEEEeeCCcE-ECCCCcCCCEECcC---cCEEcCCccCCCC
Confidence            56889999999999999999999 99999999999999   999999887 555


No 2  
>smart00494 ChtBD2 Chitin-binding domain type 2.
Probab=99.02  E-value=4.1e-10  Score=75.62  Aligned_cols=54  Identities=41%  Similarity=0.933  Sum_probs=48.9

Q ss_pred             CCCCCCCCCccccCCCCCCceEEecCCccCceeeCCCCCeecCCCCCcCccccCccccCC
Q psy10483         65 KCPVDKLKNSYYPDSIQCDLYYHCSDGQLVEEKLCPDGLLFDDSNPAHERCDTNVNVECG  124 (287)
Q Consensus        65 ~C~~~~~~~G~~~~p~~C~~y~~C~~g~~~~~~~Cp~g~~Fd~~~~~~~~C~~~~~~~C~  124 (287)
                      .|..  ...|+++++.+|++||+|.+|.+ ..+.||.|++||..   ++.|+++..+.|.
T Consensus         2 ~C~~--~~~g~~~~~~~C~~y~~C~~~~~-~~~~C~~g~~f~~~---~~~C~~~~~~~C~   55 (56)
T smart00494        2 ECPG--RGDGLYPHPTDCSKYYQCSNGRP-IVGSCPAGLVFDPA---TQTCDWPDNVGCG   55 (56)
T ss_pred             cCCC--CCCccccCcccCCeeEEcCCCcE-EeccCcCCCeECCC---CCCcCCcccCCCC
Confidence            4666  56889999999999999999988 99999999999999   9999999887775


No 3  
>PF01607 CBM_14:  Chitin binding Peritrophin-A domain;  InterPro: IPR002557 This entry represents a chitin binding domain []. It is found in (amongst others) the Peritrophin-A chitin binding proteins, particularly the peritrophic matrix proteins of insects and animal chitinases [, , ]. Copies of the domain are also found in some baculoviruses. It is an extracellular domain that contains six conserved cysteines that probably form three disulphide bridges. Chitin binding has been demonstrated for a protein containing only two of these domains [].; GO: 0008061 chitin binding, 0006030 chitin metabolic process, 0005576 extracellular region; PDB: 1DQC_A.
Probab=99.00  E-value=2.8e-10  Score=75.77  Aligned_cols=45  Identities=42%  Similarity=0.943  Sum_probs=35.6

Q ss_pred             CCCeeecCCCccCcccEEcCCCceeEecCCCCCeeeCCCCCcCCCCC
Q psy10483        141 ANGFFRHYDEKVCDKFVNCVDGVPNELPCPPGLIYDDSVSSCAWPSE  187 (287)
Q Consensus       141 ~~G~~~~p~~~~C~~y~~C~~g~~~~~~Cp~G~~Fd~~~~~C~~~~~  187 (287)
                      .+|+++++.+  |++||+|.+|.++++.||.|++||+.+++|+++..
T Consensus         5 ~~~~~~~~~~--C~~Y~~C~~g~~~~~~C~~g~~fd~~~~~C~~~~~   49 (53)
T PF01607_consen    5 GDGFYPHPDD--CRKYYQCVNGQAVEQRCPEGLYFDPSSQRCVPPSN   49 (53)
T ss_dssp             SSEEE--SS---SSEEEEEETTEEEEEE-TTS-EE-TTTSSEE-TTT
T ss_pred             CCeeEeCCCC--CCEEEEeeCCcEECCCCcCCCEECcCcCEEcCCcc
Confidence            4689999766  99999999999999999999999999999999887


No 4  
>smart00494 ChtBD2 Chitin-binding domain type 2.
Probab=98.89  E-value=1.9e-09  Score=72.38  Aligned_cols=47  Identities=51%  Similarity=1.169  Sum_probs=43.6

Q ss_pred             CCCCCCccCccceeeccccceeeccCCCCCCcccCCCcCCCCCCCCCCC
Q psy10483        223 PTFPHPEDCQKFYICRNGVQAQYGSCPAGSVYNEESFKCDEPENVPGCE  271 (287)
Q Consensus       223 ~~~~~~~~C~~Yy~C~~g~~~~~~~Cp~G~~Fd~~~~~C~~~~~v~~C~  271 (287)
                      ++++|+.+|++||+|..| .+..+.||.|++||..++.|+++..+ .|.
T Consensus         9 g~~~~~~~C~~y~~C~~~-~~~~~~C~~g~~f~~~~~~C~~~~~~-~C~   55 (56)
T smart00494        9 GLYPHPTDCSKYYQCSNG-RPIVGSCPAGLVFDPATQTCDWPDNV-GCG   55 (56)
T ss_pred             ccccCcccCCeeEEcCCC-cEEeccCcCCCeECCCCCCcCCcccC-CCC
Confidence            469999999999999999 99999999999999999999999875 674


No 5  
>PF03427 CBM_19:  Carbohydrate binding domain (family 19);  InterPro: IPR005089 A carbohydrate-binding module (CBM) is defined as a contiguous amino acid sequence within a carbohydrate-active enzyme with a discreet fold having carbohydrate-binding activity. A few exceptions are CBMs in cellulosomal scaffolding proteins and rare instances of independent putative CBMs. The requirement of CBMs existing as modules within larger enzymes sets this class of carbohydrate-binding protein apart from other non-catalytic sugar binding proteins such as lectins and sugar transport proteins. CBMs were previously classified as cellulose-binding domains (CBDs) based on the initial discovery of several modules that bound cellulose [, ]. However, additional modules in carbohydrate-active enzymes are continually being found that bind carbohydrates other than cellulose yet otherwise meet the CBM criteria, hence the need to reclassify these polypeptides using more inclusive terminology. Previous classification of cellulose-binding domains were based on amino acid similarity. Groupings of CBDs were called "Types" and numbered with roman numerals (e.g. Type I or Type II CBDs). In keeping with the glycoside hydrolase classification, these groupings are now called families and numbered with Arabic numerals. Families 1 to 13 are the same as Types I to XIII. For a detailed review on the structure and binding modes of CBMs see []. This entry represents CBM19 from CAZY which consists of 60-70 residues with chitin-binding function.; GO: 0004568 chitinase activity, 0006032 chitin catabolic process
Probab=73.35  E-value=3.7  Score=27.91  Aligned_cols=21  Identities=33%  Similarity=0.645  Sum_probs=19.1

Q ss_pred             cccEEcCCCceeEecCCCCCe
Q psy10483        154 DKFVNCVDGVPNELPCPPGLI  174 (287)
Q Consensus       154 ~~y~~C~~g~~~~~~Cp~G~~  174 (287)
                      .+|-+|.+|..+...||.|++
T Consensus        35 G~faiC~~G~Wv~~~C~~Gt~   55 (61)
T PF03427_consen   35 GSFAICDHGTWVITPCPAGTT   55 (61)
T ss_pred             CCEEEcCCCcEEEeeCCCCCE
Confidence            469999999999999999986


No 6  
>PF03427 CBM_19:  Carbohydrate binding domain (family 19);  InterPro: IPR005089 A carbohydrate-binding module (CBM) is defined as a contiguous amino acid sequence within a carbohydrate-active enzyme with a discreet fold having carbohydrate-binding activity. A few exceptions are CBMs in cellulosomal scaffolding proteins and rare instances of independent putative CBMs. The requirement of CBMs existing as modules within larger enzymes sets this class of carbohydrate-binding protein apart from other non-catalytic sugar binding proteins such as lectins and sugar transport proteins. CBMs were previously classified as cellulose-binding domains (CBDs) based on the initial discovery of several modules that bound cellulose [, ]. However, additional modules in carbohydrate-active enzymes are continually being found that bind carbohydrates other than cellulose yet otherwise meet the CBM criteria, hence the need to reclassify these polypeptides using more inclusive terminology. Previous classification of cellulose-binding domains were based on amino acid similarity. Groupings of CBDs were called "Types" and numbered with roman numerals (e.g. Type I or Type II CBDs). In keeping with the glycoside hydrolase classification, these groupings are now called families and numbered with Arabic numerals. Families 1 to 13 are the same as Types I to XIII. For a detailed review on the structure and binding modes of CBMs see []. This entry represents CBM19 from CAZY which consists of 60-70 residues with chitin-binding function.; GO: 0004568 chitinase activity, 0006032 chitin catabolic process
Probab=71.85  E-value=2.8  Score=28.52  Aligned_cols=21  Identities=38%  Similarity=0.793  Sum_probs=19.1

Q ss_pred             ccceeeccccceeeccCCCCCC
Q psy10483        232 QKFYICRNGVQAQYGSCPAGSV  253 (287)
Q Consensus       232 ~~Yy~C~~g~~~~~~~Cp~G~~  253 (287)
                      .+|-+|.+| .+....||.|++
T Consensus        35 G~faiC~~G-~Wv~~~C~~Gt~   55 (61)
T PF03427_consen   35 GSFAICDHG-TWVITPCPAGTT   55 (61)
T ss_pred             CCEEEcCCC-cEEEeeCCCCCE
Confidence            479999999 999999999985


No 7  
>PF08475 Baculo_VP91_N:  Viral capsid protein 91 N-terminal;  InterPro: IPR013682 This domain is found in Baculoviridae including the nucleopolyhedrovirus at the N terminus of the viral capsid protein 91 (VP91) []. 
Probab=48.16  E-value=28  Score=29.18  Aligned_cols=38  Identities=18%  Similarity=0.350  Sum_probs=31.2

Q ss_pred             ccccCCCCCCceEEecCCccCceeeCCCCCeecCCCCCcCcccc
Q psy10483         74 SYYPDSIQCDLYYHCSDGQLVEEKLCPDGLLFDDSNPAHERCDT  117 (287)
Q Consensus        74 G~~~~p~~C~~y~~C~~g~~~~~~~Cp~g~~Fd~~~~~~~~C~~  117 (287)
                      ..-+|+.+=++|..=.+... ..+.||.+..||..     +|++
T Consensus       105 rV~~~~~d~~kF~~~~DDGw-v~~~CP~~~~FD~~-----~Cvp  142 (183)
T PF08475_consen  105 RVRPHPNDPTKFIARGDDGW-VDMDCPENERFDGN-----KCVP  142 (183)
T ss_pred             ceecCCCCCceEEEEecCCc-EEEeCCCccccccc-----ceee
Confidence            36678888899988776566 99999999999974     7885


No 8  
>PF08475 Baculo_VP91_N:  Viral capsid protein 91 N-terminal;  InterPro: IPR013682 This domain is found in Baculoviridae including the nucleopolyhedrovirus at the N terminus of the viral capsid protein 91 (VP91) []. 
Probab=42.11  E-value=33  Score=28.76  Aligned_cols=44  Identities=30%  Similarity=0.508  Sum_probs=35.5

Q ss_pred             CCCCccCccceeeccccceeeccCCCCCCcccCCCcCCCCCCCCCCCCCC
Q psy10483        225 FPHPEDCQKFYICRNGVQAQYGSCPAGSVYNEESFKCDEPENVPGCENWF  274 (287)
Q Consensus       225 ~~~~~~C~~Yy~C~~g~~~~~~~Cp~G~~Fd~~~~~C~~~~~v~~C~~~~  274 (287)
                      -+|+.+=++|..=.+- -+..+.||.+..||..  +|+..   +-|....
T Consensus       107 ~~~~~d~~kF~~~~DD-Gwv~~~CP~~~~FD~~--~Cvp~---p~C~~~~  150 (183)
T PF08475_consen  107 RPHPNDPTKFIARGDD-GWVDMDCPENERFDGN--KCVPI---PPCDNKP  150 (183)
T ss_pred             ecCCCCCceEEEEecC-CcEEEeCCCccccccc--ceeec---CccCCCC
Confidence            5677888899888776 6999999999999999  99875   3685443


No 9  
>PF12662 cEGF:  Complement Clr-like EGF-like
Probab=33.37  E-value=32  Score=18.73  Aligned_cols=17  Identities=29%  Similarity=0.825  Sum_probs=14.1

Q ss_pred             cCCCCCCcccCCCcCCC
Q psy10483        247 SCPAGSVYNEESFKCDE  263 (287)
Q Consensus       247 ~Cp~G~~Fd~~~~~C~~  263 (287)
                      +|++|+..++....|..
T Consensus         5 ~C~~Gy~l~~d~~~C~D   21 (24)
T PF12662_consen    5 SCPPGYQLSPDGRSCED   21 (24)
T ss_pred             eCCCCCcCCCCCCcccc
Confidence            68999999888888864


No 10 
>cd00064 FU Furin-like repeats. Cysteine rich region. Exact function of the domain is not known. Furin is a serine-kinase dependent proprotein processor. Other members of this family include endoproteases and cell surface receptors.
Probab=28.78  E-value=47  Score=20.91  Aligned_cols=20  Identities=25%  Similarity=0.522  Sum_probs=14.2

Q ss_pred             ceeeccCCCCCCcccCCCcC
Q psy10483        242 QAQYGSCPAGSVYNEESFKC  261 (287)
Q Consensus       242 ~~~~~~Cp~G~~Fd~~~~~C  261 (287)
                      ..-+..||.+++++.....|
T Consensus        29 ~~Cv~~C~~~~~~~~~~~~C   48 (49)
T cd00064          29 GTCVSECPEGTYADTEGGVC   48 (49)
T ss_pred             CcccccCCCCceecCcCCcC
Confidence            34445899999998666655


No 11 
>PF01826 TIL:  Trypsin Inhibitor like cysteine rich domain;  InterPro: IPR002919 This domain is found in proteinase inhibitors as well as in many extracellular proteins. The domain typically contains ten cysteine residues that form five disulphide bonds. The cysteine residues that form the disulphide bonds are 1-7, 2-6, 3-5, 4-10 and 8-9. This inhibitor domain belongs to MEROPS inhibitor family I8 (clan IA). Proteins containing this domain inhibit peptidases belonging to families S1 (IPR001254 from INTERPRO), S8 (IPR000209 from INTERPRO), and M4 (IPR001570 from INTERPRO) [] and are restricted to the chordata, nematoda, arthropoda and echinodermata. Examples of proteins containing this domain are:  chymotrypsin/elastase inhibitor from Ascaris suum (pig roundworm) Acp62F protein from Drosophila melanogaster  Bombina trypsin inhibitor from Bombina maxima (large-webbed bell toad) Bombyx subtilisin inhibitor from Bombyx mori (silk moth) von Willebrand factor ; PDB: 2P3F_N 1HX2_A 1CCV_A 1EAI_D 2H9E_C 1COU_A 1ATE_A 1ATB_A 1ATD_A 1ATA_A ....
Probab=28.03  E-value=42  Score=21.73  Aligned_cols=18  Identities=17%  Similarity=0.061  Sum_probs=14.6

Q ss_pred             ecCCceEeeCCCCcccccc
Q psy10483         25 EQGNYLVLSDSRRLCIRYN   43 (287)
Q Consensus        25 ~c~~gl~fd~~~~~C~~~~   43 (287)
                      .|+.|++++.. +.|++++
T Consensus        36 ~C~~G~v~~~~-~~CV~~~   53 (55)
T PF01826_consen   36 FCPPGYVRNDN-GRCVPPS   53 (55)
T ss_dssp             EETTTEEEETT-SEEEEGG
T ss_pred             CCCCCeeEcCC-CCEEcHH
Confidence            38899999987 8898753


Done!