Diaphorina citri psyllid: psy10486

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
MSSMNVNSSSSTLEWTGQVTVRKKRKPYSKHQTLELEKEFLYNAYVSKQKRWELARSLMLTERQVKIWFQNIEWTGQVTVRKKRKPYSKHQTLELEKEFLYNAYVSKQKRWELARSLMLTERQVKIWFQNRRMKNKKNTQRQAAQASNNNNTSNTNNNTSHHGHHHHHIGHAVTNGGLKHHHQ
cccccccccccccccccccccccccccccccHHHHHccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHcccccHHHHHHccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccc
****************************SKHQTLELEKEFLYNAYVSKQKRWELARSLMLTERQVKIWFQNIEWT****VRKKRKPYSKHQTLELEKEFLYNAYVSKQKRWELARSLMLTERQVKIWFQNR****************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSMNVNSSSSTLEWTGQVTVRKKRKPYSKHQTLELEKEFLYNAYVSKQKRWELARSLMLTERQVKIWFQNIEWTGQVTVRKKRKPYSKHQTLELEKEFLYNAYVSKQKRWELARSLMLTERQVKIWFQNRRMKNKKNTQRQAAQASNNNNTSNTNNNTSHHGHHHHHIGHAVTNGGLKHHHQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0009952 [BP]anterior/posterior pattern specificationprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0003002, GO:0007275, GO:0044699
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071
GO:0048704 [BP]embryonic skeletal system morphogenesisprobableGO:0048705, GO:0048598, GO:0009887, GO:0048562, GO:0044707, GO:0048513, GO:0009790, GO:0048568, GO:0032501, GO:0048856, GO:0044767, GO:0001501, GO:0048706, GO:0008150, GO:0009792, GO:0048731, GO:0043009, GO:0009653, GO:0032502, GO:0007275, GO:0044699
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0045595 [BP]regulation of cell differentiationprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XSD, chain C
Confidence level:very confident
Coverage over the Query: 19-73,86-140
View the alignment between query and template
View the model in PyMOL